Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049115 (Agtr1a)
Chromosomal location
Chr 13: 30428326 - 30474735 (+)
Description
angiotensin II receptor, type 1a Gene [Source:MGI (curated);Acc:Agtr1a-001]
Human Ortholog
not available
Omim not available
UniTrap UNI36439
Vector Insertion
Chr 13: 30436890 - 30472770
Public Clones IST10718E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000066412
Sequence
GGACTGGATGATGCTGTCTGGCCGGAGAGGACTCGAGGCTTGAGTCCTGGTCCACGGGTCGCTGGGGTGGGTCGCTGGGGTGGCTGAAGCCAGTACCAGC

TCTGCGGCTCTCCCAGCTCTGCTGCTCTCCCGG ACTTAACATATGAAAGATTGGTATAAAATGGCTGGCATTTTGTCTGGATAACTCACAGCAACCCTC

CAAGAAAGCCATCACCAG - UNI36439 - ATCAAGTGCATTTTGAACAGTGTCTGAGACCAACTCAACCCAGAAAAGCAAAATGGCCCTTAACTCTT

CTACTGAAGATGGCATCAAAAGAATTCAAGATGACTGCCCCAGGGCTGGCAGGCACAGTTACATATTTGTCATGATCCCTACTCTCTACAGCATCATCTT

TGTGGTGGGAATATTTGGAAACAGCTTGGTGGTGATCGTCATCTACTTTTACATGAAGCTGAAGACTGTGGCCAGTGTCTTTCTTCTAAATCTCGCCCTG

GCTGACTTATGCTTTTTGCTGACTTTGCCCCTGTGGGCTGTCTATACCGCTATGGAATACCGCTGGCCCTTCGGCAATCACCTATGTAAGATCGCTTCGG

CCAGCGTCAGTTTCAACCTCTACGCCAGCGTGTTCCTGCTCACGTGTCTCAGCATCGATCGCTACCTGGCCATTGTCCACCCGATGAAGTCTCGCCTCCG

CCGCACGATGCTGGTGGCCAAAGTCACCTGCATCATCATCTGGCTGATGGCTGGCTTGGCCAGTTTGCCAGCCGTCATCCACCGAAATGTGTATTTCATT

GAGAACACCAATATCACTGTTTGCGCTTTTCATTACGAGTCCCGGAATTCAACGCTCCCCATAGGACTGGGCCTAACCAAGAACATCCTGGGCTTCCTGT

TCCCTTTCCTAATCATTCTTACCAGCTATACTCTTATATGGAAAGCTCTAAAGAAGGCTTATGAAATTCAGAAGAACAAGCCAAGAAATGATGACATCTT

TAGGATAATTATGGCGATTGTGCTTTTCTTCTTCTTCTCCTGGGTCCCCCACCAAATATTCACATTCCTGGATGTGCTGATTCAGCTGGGCGTCATCCAT

GACTGTAAAATTGCCGACATCGTGGACACTGCCATGCCCATAACCATCTGCATAGCGTATTTTAACAACTGCCTGAACCCTCTGTTTTACGGCTTTCTGG

GGAAAAAATTTAAAAAGTATTTCCTCCAGCTCCTGAAATATATTCCCCCAAAGGCCAAGTCGCACTCAAGCCTGTCTACGAAAATGAGCACGCTCTCCTA

CCGCCCCTCAGATAACATGAGCTCAGCCGCCAAAAAGCCTGCGTCTTGTTCTGAGGTGGAGTGACAGGTTCAAAGCTTGCTGGCAATGTAATGCCCTGAC

AGAAACCAGGGCAGCATCGGACTAAATGGCTCACGACCAAAGGACCAGTCCCCCCCCCCCCCTCAGGATCTAAGCAGAAAATGCGTTCAACAGACTGTAG

ATATTGTCTGAAGCTCTGAGAGAAAGCTTTGAAGAAGTAATTATGCAAAGCTGTCTTACATTAATAGATGATGGCTGCCCCAAGGACAAGTCAGGAGCTG

GATGGATTTGTGGGTTTAAAACGGTTTGCTGGCAGACACGCAATCGCAGCGGTCTCCTTTTGATTTCCACACATAGGTATGTAGCATGTGCTAAATATTT

AGACAAGAAACAAGAAATGGAAGTCGAGGTTACTTGTTCTGCTCAGTTCCCCAAGGGCAAGGAACCTTGTTTGTCCCTTTAGTCATTAGCAATGGAGACC

CACGTGTCCCTGTTACTACACATACTTTGAAAAGATCTGCTAACCTGGAGTCATCAAGTTTCAGGAGCCCTTTGTAAAATTCAGCCAGTGTCTTAGAAAC

CTGTACTGTCCCCAAACAATGCCAGTTAGTGGTGTATTTATGTAGCAGTGTAAGCAAAGTTACACATCAAAGTTGCACTGCTTGTACCAACCGTGACATA

GTAGGTATATCAGCTTTAGTTCACATCTGAGAAACATAAACAGTCGGTGGTGAATAGACTACATATCATACAATCTGCCTTGTTCTCTAAAAGTATATAT

CCTCCACATATATGTACATATGTATCTCTAAGCTGTCATTTGATGAAGTTTTGGCAATGTATGTTTACCTCTAAATAAAGTAATTTTATTGTAACGT
Translation
  - UNI36439 - MALNSSTEDGIKRIQDDCPRAGRHSYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWA

VYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIHRNVYFIENTNITVCAFHYE

SRNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFRIIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCKIADIVDTAMP

ITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPKAKSHSSLSTKMSTLSYRPSDNMSSAAKKPASCSEVE

For any suggestions or comments, please send an email to unitrap@crg.es