Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049299 (Trappc1)
Chromosomal location
Chr 11: 69137482 - 69139295 (+)
Description
trafficking protein particle complex 1 Gene [Source:MGI (curated);Acc:Trappc1-002]
RefSeq_dna
NM_001024206 
RefSeq_peptide
NP_001019377.1 
MGI
MGI:1098727 
Uniprot/SWISSPROT
Q5NCF2 
Uniprot/SPTREMBL
B1ASW6 Q14BF8 B1ASW5 
Human Ortholog
ENSG00000170043 (TRAPPC1)
Omim not available
UniTrap UNI28428
Vector Insertion
Chr 11: 69138940 - 69139249
Public Clones not available
Private Clones OST31259 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000060956
Sequence
GGGGGTGGGGTTCCCACCTGGCTGAAGAATCAGGTTCTAGAGAGTTGGGTACCAGCCACTGAGCGAGGCTCTTTATCTTGCAGATGACTGTCCACAATCT

GTACCTTTTTGACCGGAATGGAGTGTGTCTACACTACAGCGAGTGGCACCGCAAGAAGCAAGCAGGGATCCCTAAGGAAGAG GAGTACAAGCTGATGTA

TGGAATGCTCTTCTCCATTCGTTCGTTTGTCAGCAAGATGTCCCCGCTAGACAT GAAGGATGGCTTTCTGTCTTTCCAAACTAGCCGTTACAAACTCCA

TTACTACGAGACTCCCACTGGAATCAAGGTTGTCATGAATACTGACTTGGGCGTGGGCCCTATCCGAGATGTTCTACACCATATCTACAGTGCG - UNI

28428 - AGCTGGCTGAAACATCTACCTCACCCCTCAGAAGAACCTGTGACTGCCTGGGCCCATCTCACTTGTTACATTGAGAGCCCTTCCATCTACCT

GTCTCCGAGAGCTTTCCCCCGAAGGCCTACCACCCACTGCCTTCAAGTCATAAGAATGAAGCTCACAGGAGTCTACGCCAGTTTTATCCCTGCTTGACTC

TGTGAGAAACACAGAATAAACTGAATAAACTTTTTGTCACCCTC
Translation
MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEE EYKLMYGMLFSIRSFVSKMSPLDM MKDGFLSFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVL

HHIYSA - UNI28428 - SWLKHLPHPSEEPVTAWAHLTCYIESPSIYLSPRAFPRRPTTHCLQVIRMKLTGVYASFIPA
Transcript ENSMUST00000102601
Sequence
GTTCTAGAGAGTTGGGTACCAGCCACTGAGCGAGGCTCTTTATCTTGCAGATGACTGTCCACAATCTGTACCTTTTTGACCGGAATGGAGTGTGTCTACA

CTACAGCGAGTGGCACCGCAAGAAGCAAGCAGGGATCCCTAAGGAAGAG GAGTACAAGCTGATGTATGGAATGCTCTTCTCCATTCGTTCGTTTGTCAG

CAAGATGTCCCCGCTAGACAT GAAGGATGGCTTTCTGTCTTTCCAAACTAGCCGTTACAAACTCCATTACTACGAGACTCCCACTGGAATCAAGGTTGT

CATGAATACTGACTTGGGCGTGGGCCCTATCCGAGATGTTCTACACCATATCTACAGTGCG - UNI28428 - CTGTATGTGGAGTTTGTTGTGAAGA

ATCCTCTGTGCCCGCTGGGACAAACTGTGCAAAGTGAGCTCTTTCGATCCCGGCTAGACTCCTATGTCCGATCTTTGCCCTTCTTCTCTGCCAGAGCTGG

CTGAAACATCTACCTCACCCCTCAGAAGAACCTGTGACTGCCTGGGCCCATCTCACTTGTTACATTGAGAGCCCTTCCATCTACCTGTCTCCGAGAGCTT

TCCCCCGAAGGCCTACCACCCACTGCCTTCAAGTCATAAGAATGAAGCTCACAGGAGTCTACGCCAGTTTTATCCCTGCTTGA
Translation
MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEE EYKLMYGMLFSIRSFVSKMSPLDM MKDGFLSFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVL

HHIYSA - UNI28428 - LYVEFVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG
Transcript ENSMUST00000102602
Sequence
GTTAAGGGTTCTTGAGGTTGCCGCTTACGACCCAGCTGGGCTTTATAAACCGGAAGTAGCTTGTCACCCTCTTTCAGAGCAATTCCG ATGACTGTCCAC

AATCTGTACCTTTTTGACCGGAATGGAGTGTGTCTACACTACAGCGAGTGGCACCGCAAGAAGCAAGCAGGGATCCCTAAGGAAGAG GAGTACAAGCTG

ATGTATGGAATGCTCTTCTCCATTCGTTCGTTTGTCAGCAAGATGTCCCCGCTAGACAT GAAGGATGGCTTTCTGTCTTTCCAAACTAGCCGTTACAAA

CTCCATTACTACGAGACTCCCACTGGAATCAAGGTTGTCATGAATACTGACTTGGGCGTGGGCCCTATCCGAGATGTTCTACACCATATCTACAGTGCG 

- UNI28428 - CTGTATGTGGAGTTTGTTGTGAAGAATCCTCTGTGCCCGCTGGGACAAACTGTGCAAAGTGAGCTCTTTCGATCCCGGCTAGACTCC

TATGTCCGATCTTTGCCCTTCTTCTCTGCCAGAGCTGGCTGAAACATCTACCTCACCCCTCAGAAGAACCTGTGACTGCCTGGGCCCATCTCACTTGTTA

CATTGAGAGCCCTTCCATCTACCTGTCTCCGAGAGCTTTCCCCCGAAGGCCTACCACCCACTGCCTTCAAGTCATAAGAATGAAGCTCACAGGAGTCTAC

GCCAGTTTTATCCCTGCTTGACTCTGTGAGAAACACAGAATAAACTGAATAAACTTTTTGTCACCCTC
Translation
 MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEE EYKLMYGMLFSIRSFVSKMSPLDM MKDGFLSFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDV

LHHIYSA - UNI28428 - LYVEFVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG
Transcript ENSMUST00000108662
Sequence
GATGACTGTCCACAATCTGTACCTTTTTGACCGGAATGGAGTGTGTCTACACTACAGCGAGTGGCACCGCAAGAAGCAAGCAGGGATCCCTAAGGAAGAG

 GAGTACAAGCTGATGTATGGAATGCTCTTCTCCATTCGTTCGTTTGTCAGCAAGATGTCCCCGCTAGACAT CCGTTACAAACTCCATTACTACGAGAC

TCCCACTGGAATCAAGGTTGTCATGAATACTGACTTGGGCGTGGGCCCTATCCGAGATGTTCTACACCATATCTACAGTGCG - UNI28428 - CTGT

ATGTGGAGTTTGTTGTGAAGAATCCTCTGTGCCCGCTGGGACAAACTGTGCAAAGTGAGCTCTTTCGATCCCGGCTAGACTCCTATGTCCGATCTTTGCC

CTTCTTCTCTGCCAGAGCTGGCTGAAACATCTACCTCACCCCTCAGAAGAACCTGTGACTGCCTGGGCCCATCTCACTTGTTACATTGAGAGCCCTTCCA

TCTACCTGTCTCCGAGAGCTTTCCCCCGAAGGCCTACCACCCACTGCCTTCAAGTCATAAGAATGAAGCTCACAGGAGTCTACGCCAGTTTTATCCCTGC

TTGACTCTGTGAGAAACACAGAATAAACTGAATAAACTTTTTGTCACCCTC
Translation
MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEE EYKLMYGMLFSIRSFVSKMSPLDI IRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSA - U

NI28428 - LYVEFVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG

For any suggestions or comments, please send an email to unitrap@crg.es