Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049305 (Ccdc71)
Chromosomal location
Chr 9: 108362897 - 108366884 (+)
Description
coiled-coil domain containing 71 Gene [Source:MGI Symbol;Acc:MGI:1919704]
RefSeq_dna
NM_133744 
RefSeq_peptide
NP_598505.1 
UniGene
Mm.46488 
MGI
MGI:1919704 
Uniprot/SWISSPROT
Q8VEG0 
Human Ortholog
ENSG00000177352 (CCDC71)
Omim not available
UniTrap UNI20144
Vector Insertion
Chr 9: 108362949 - 108365268
Public Clones (sanger) E130D01 (ggtc)
Private Clones OST371474 (lexicon) OST245752 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000061209
Sequence
GGAGCGGCGGAGGCGGCGCAGAGGTGCGTCCTGGGTCCCCGCGGCGGCGCCG - UNI20144 - GTGCCAAGTGCTGGTTTGTGGATACCCAGGCAAG

CCTGCAGTGCCCAATGCCATGAGCATGGTAGTGCAGCCTGTGGAGGAGAAAGCTGTGCACTCGTGGTCACGTATCTCCACGGCAGGGAAGAAAGCCCTGG

AAGAGGCCCTGCTTGTGTTTAATCCCATGAGCCAGGATCTCAGTGCCACAGAGGCCCAGCTCGTGGCCTTCCTCCAGGGTCTGCGAGATGATGGCTTCCA

ACCGACCATTCTTCGAAGTGGAGATGTCTATGGTTATAGTTCATGCACAGCCAGCCCCCCCAGCCAGACAAAGCTACAAGCTCGTACCATCAACCCACCT

GCCACGTCACTTCCCAAAACTGCTGTGTCAGTCCCTGCAGGCCGGACCACCTTGCTCCCTGTGCCACTGTCTGGCAGGCTGGCTAAAGGGTCCACAGCAG

CCCTAGCCAAGCATGCCACCACTAACCTGCTGCTGAGCTCCCTGAAGCAGTCGAGTGCCAGCAACAGCAGTGGTACAACAGTAGGCTTCCCTGCCCACCT

CTATCCAGGCGTCTACCCAGCCATGCGGCTCTCTGTGGTCCTTGAAGCACTGGTCCCACTCAAGACTCCCTGCTTGGACGTTAAGCACGGGGCACAGTCA

CTGCAGCTGTCACTTGCAAAGTCTCCCCTGAAAGTGAGGAAAGCTTCGGGGAACCCAAAGTCCAAAGCACCCCGAAAAATCACAAGCAAGGGCCTCAAAC

ATCTGACTAGCAAAGGCCCTGGGGCTGGTCTCCGACGAGGCGCTGGAACCCAAAGCAACGGCGCCCAAAGGAAAGGGTGCTCTGCCTTGGGCCCCAAAAC

TGTCCAGGCCCAGGCATCTCAAACCCTGATCAAAGCTGCTCGCGCTCATGCCAGTGTGGCTCAAACCCAGACCAAGACAGTAAGGGTCAGGGCCAAAGCA

AAGCAGGCCAAGCCCAAGGCAGCCAGAGCCAAAGCCAAGGCCGCTGTGGTGAGGGACAAGGCAAAAGACAAGGTAATCCAGGCCAAGGCCAAAGCAGCCC

AGACCAAGCACAAGGGAAAGCCAAAGGGATCGGTTCAGACCAGAACTGGAAGGGCAAACCGGAAAAACAGCTCTGAGACTGTGGGGCGGAAGAGGAAGAA

GGCCGAGGAGACCAAGGGTCTTCCTCCTAAGAAGAGAGCACGGTGTGTGCCCCGACCTCCTAAGGTGTGGCTGGGGCCTGGAACGGCAAAACCTCGAAAG

TCCCAGACCATAAAGGTAGACAGGAAGTGCTCAGATGACGAGGTCCGACAGTGTGCCCAGCAGATCCTCCGTGTGAATCTCTCTCCCGTGGTATGGCTCC

AGCCCTTGCTACCATTTTGATCCCATACTCAACATCCCAAGCCCTTGCAGCAGTACTTGGGAAAACAGCGGAGCTGTCTGTGTGACCAGTGCATTGTGTA

GTGCTCAGGACCCTGCTGCTTCCCGGATCCTGGGGACCTCGGGACTGGTCACCAACATCCTTTCAGAAACGGAGGATTTGGGTGGGGTGGTTTGCGGGAG

GGGTGTTCTCATGGCTCAGTGCACTGTGACTTGTTCTTCAGATTGTATGTCCACGTTCATTCTATCATGTTTTATACCTTTC
Translation
 - UNI20144 - MSMVVQPVEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTASPPSQTKL

QARTINPPATSLPKTAVSVPAGRTTLLPVPLSGRLAKGSTAALAKHATTNLLLSSLKQSSASNSSGTTVGFPAHLYPGVYPAMRLSVVLEALVPLKTPCL

DVKHGAQSLQLSLAKSPLKVRKASGNPKSKAPRKITSKGLKHLTSKGPGAGLRRGAGTQSNGAQRKGCSALGPKTVQAQASQTLIKAARAHASVAQTQTK

TVRVRAKAKQAKPKAARAKAKAAVVRDKAKDKVIQAKAKAAQTKHKGKPKGSVQTRTGRANRKNSSETVGRKRKKAEETKGLPPKKRARCVPRPPKVWLG

PGTAKPRKSQTIKVDRKCSDDEVRQCAQQILRVNLSPVVWLQPLLPF

For any suggestions or comments, please send an email to unitrap@crg.es