Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049313 (Sorl1)
Chromosomal location
Chr 9: 41776572 - 41932372 (-)
Description
sortilin-related receptor, LDLR class A repeats-containing Gene [Source:MGI (curated);Acc:Sorl1-001]
RefSeq_dna
NM_011436 
RefSeq_peptide
NP_035566.2 
UniGene
Mm.121920 
MGI
MGI:1202296 
Uniprot/SWISSPROT
O88307 
Uniprot/SPTREMBL
Q3U2X9 Q3UHM3 Q3UV32 Q8C2R1 Q8CE39 
Human Ortholog
ENSG00000137642 (SORL1)
Omim not available
UniTrap UNI21931
Vector Insertion
Chr 9: 41907354 - 41914510
Public Clones not available
Private Clones OST313748 (lexicon) OST120731 (lexicon) OST120638 (lexicon) OST120623 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18272
Vector Insertion
Chr 9: 41900554 - 41907227
Public Clones (ggtc)
Private Clones OST426629 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11644
Vector Insertion
Chr 9: 41890052 - 41898027
Public Clones P086A02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11633
Vector Insertion
Chr 9: 41880430 - 41889870
Public Clones P086H01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11254
Vector Insertion
Chr 9: 41832553 - 41838961
Public Clones G082B02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10946
Vector Insertion
Chr 9: 41788829 - 41790988
Public Clones P084E05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38183
Vector Insertion
Chr 9: 41784440 - 41785694
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10318
Vector Insertion
Chr 9: 41777940 - 41782019
Public Clones Ex255 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000060989
Sequence
GGGACCCGGCGGCGGCGGTGGCCGTGGCTGCGGTGGCGGGCGCAGCGGAGCGGCCCGGGCGGCTTGGAGCCCCGGGAGCGGCGCGCGCGGCCCCGGCCCT

GGCCCCGCGCTGTCCCGGCGCGCGCTGCACATTCTCTCCTGGCGGCGGCGCCACCTGCGGGAGCGTTCGCCCGAACATGGCGACACGGAGCAGCAGGAGG

GAGTCGAGACTCCCTTTCCTATTCGCCCTGGTCGCGCTGCTACCCCGCGGGGCTCTCGGCGGGGGCTGGACGCAGAGATTGCACGGTGGCCCGGCGCCCT

TGCCCCAGGACCGGGGCTTCTTCGTGGTGCAGGGCGACCCGCGCGATCTCCGGCTAGGAACGCACGGGGATGCCCCGGGGGCGAGCCCGGCGGCCAGGAA

GCCACTCAGGACCCGGCGGAGCGCTGCTCTGCAGCCCCAGCCTATCCAGGTGTATGGACAG GTCAGTCTGAATGACTCCCACAATCAGATGGTGGTGCA

CTGGGCCGGAGAGAAAAGCAACGTGATCGTGGCATTAGCCCGAGACAGCCTGGCGTTGGCAAGGCCCAAGAGCAGTGAT - UNI21931 - GTGTATG

TGTCTTACGACTATGGAAAATCATTCAGTAAGATTTCAGAGAAGCTGAACTTTGGCGTGGGCAACAACAGCGAAGCTGTGATCTCCCAGTTCTACCACAG

CCCTGCTGACAACAAGAGG - UNI18272 - TACATCTTTGTGGATGCTTACGCCCAATACCTCTGGATCACATTTGACTTCTGCAGCACTATCCATG

GCTTCTCCATCCCATTCCGGGCGGCTGATCTCCTCCTCCATAGCAAGGCCTCCAACCTCCTCTTGGGCTTTGACAGGTCTCACCCCAACAAGCAG CTAT

GGAAGTCAGATGATTTTGGCCAGACCTGGATCATGATTCAGGAACACGTGAAGTCCTTCTCTTG - UNI11644 - GGGAATCGACCCCTATGATCAG

CCAAACGCTATCTACATTGAGCGACATGAACCCTTTGGGTTCTCCACAGTGCTCCGCAGTACAGACTTCTTCCAGTCCCGGGAAAACCAGGAAGTGATCC

TGGAGGAAGTGAGAGACTTTCAGCTTCGCGACAAGTATATGTTTGCTACAAAGGTGGTG - UNI11633 - CATCTTCCGGGCAGCCAGCAGCAGTCA

TCTGTCCAGCTCTGGGTCTCCTTTGGCCGGAAGCCTATGAGAGCAGCCCAGTTTGTCACAAAGCATCCTATTAAT GAATATTACATCGCTGATGCCGCC

GAGGACCAGGTGTTCGTGTGTGTTAGCCACAGTAACAACAGCACTAACTTATACATCTCAGAGGCAGAGGGGCTGAAGTTCTCCCTCTCCTTGGAGAATG

TGCTGTATTACAGCCCAGGAGGGGCCGGCAGTGACACTCTGGTGAG GTATTTTGCAAATGAGCCGTTTGCCGACTTTCACCGCGTGGAAGGCTTACAAG

GAGTCTATATTGCCACCCTGATTAATGGTTCTATGAATGAGGAGAACATGAGGTCGGTCATCACCTTTGACAAAGGGGGAACCTGGGAATTTCTTCAGGC

CCCAGCCTTCACAGGATATGGAGAGAAAATCAATTGTGAG CTTTCTCAGGGTTGTTCCCTCCACCTGGCCCAGCGCCTCAGTCAACTGCTCAACCTCCA

ACTTCGGAGGATGCCTATCCTATCCAAGGAGTCAGCCCCCGGTCTCATCATTGCTACCG GCTCTGTGGGAAAGAACTTGGCCAGCAAGACCAATGTGTA

CATCTCTAGCAGTGCTGGAGCCAGGTGGAGAGAG GCTCTTCCCGGACCTCATTACTATACTTGGGGTGACCATGGAGGCATCATCATGGCGATTGCCCA

GGGCATGGAGACCAACGAGCTGAA GTACAGCACCAATGAAGGGGAGACCTGGAAGACGTTCGTCTTCTCGGAGAAGCCTGTGTTTGTGTATGGGCTTCT

CACAGAACCTGGTGAGAAGAGCACCGTCTTCACCATCTTCGGCTCGAACAAGGAGAGTGTCCACAGCTGGCTCATCCTGCAGGTCAATGCCACTGATGCC

TTGG GGGTTCCTTGCACAGAAAACGACTACAAGCTGTGGTCCCCATCTGATGAGCGAGGAAATGAGTGTTTGCTAGGACACAAGACAGTTTTCAAAAGG

AGGACCCCTCATGCCACGTGCTTTAATGGGGAAGACTTTGACCGGCCAGTGGTTGTGTCCAACTGCTCCTGCACCCGGGAGGACTACGAATG TGACTTT

GGCTTCAAGATGAGCGAAGATCTCTCCTTAGAGGTTTGTGTTCCAGACCCTGAGTTTTCTGGGAAGCCCTACAGCCCTCCTGTGCCTTGTCCTGTGGGTT

CTTCATACAGGAGAACGAGAGG CTATCGGAAGATTTCTGGGGATACGTGCAGTGGAGGAGACGTTGAAGCGCGGCTGGAAGGGGAGCTGGTCCCCTGTC

CCCTTGCAG AAGAGAATGAGTTCATCCTATACGCCATGCGCAAGTCCATCTACCGCTACGACTTGGCCTCGGGAGCCACAGAGCAGCTTCCTCTCTCGG

GGCTGCGGGCGGCTGTGGCCCTGGACTTTGACTATGAACGCAACTGCTTGTATTGGTCTGACCTGGCGCTGGACACCATCCAG CGTCTCTGCTTGAACG

GGAGCACAGGGCAGGAGGTGATCATCAATTCCGGCCTGGAGACCGTGGAGGCTTTGGCCTTCGAACCCCTCAGCCAATTACTTTACTGGGTGGATGCCGG

CTTTAAAAAGATCGAG GTAGCTAATCCAGATGGTGACTTCCGACTGACAATCGTCAATTCCTCTGTGCTTGATCGACCCAGGGCTTTAGTCCTTGTACC

CCAAGAAGG GGTGATGTTCTGGACTGACTGGGGGGACCTGAAGCCTGGGATTTACCGGAGCTACATGGACGGCTCTGCTGCCTACCGCCTTGTGTCAGA

GGACGTGAAGTGGCCCAATGGCATCTCTGTGGACAGCCAGTGGATCTACTGGACGGATGCTTACCTGGACTGTATCGAGCGCATCACTTTCAGTGGCCAG

CAGCGTTCAGTCATCCTTGACAGCCTCCCACACCCCTATGCCATCGCTGTCTTTAAG AATGAGATCTACTGGGATGACTGGTCACAGCTCAGCATCTTC

AGAGCTTCGAAGCACAGCAGATCCCAGGTGGAGATTCTAGCAAGCCAGCTCACGGGCCTCATGGACATGAAGGTTTTCTACAAGGGAAAGAATGCTG - 

UNI11254 - GAAGCAACGCTTGTGTCCCTCAGCCCTGCAGTCTACTGTGCCTCCCTAAGGCCAACAACAGCAAAAGCTGCAGGTGTCCAGAAGGTGTG

GCCAGCAGTGTCCTCCCCTCTGGGGACCTGATGTGTGACTGCCCTCAGGGCTATCAAAGGAAGAACAACACCTGTGTCAAAGAAG AGAACACCTGTCTC

CGAAACCAGTATCGCTGCAGCAACGGCAACTGTATCAACAGCATTTGGTGGTGTGATTTCGACAATGACTGTGGAGACATGAGTGACGAGAGAAATTGCC

 CCACGACGGTCTGTGATGCAGACACTCAGTTCCGGTGCCAGGAGTCGGGGACTTGCATTCCACTCTCCTATAAGTGTGACCTTGAAGATGACTGTGGAG

ATAACAGTGATGAGAGTCACTGTG AGATGCACCAGTGTCGTAGCGACGAGTTCAACTGCAGCTCTGGGATGTGCATCCGGTCCTCCTGGGTGTGCGATG

GAGACAACGACTGTAGGGACTGGTCTGATGAAGCCAACTGTACTG CCATCTATCATACCTGTGAGGCCTCCAACTTCCAGTGCCACAATGGCCACTGCA

TCCCCCAGCGATGGGCATGTGACGGTGATGCGGATTGCCAGGATGGCTCTGACGAAGATCCCGTCAGCTGTG AGAAAAAGTGCAATGGATTCCACTGCC

CAAACGGCACGTGCATCCCGTCCAGCAAGCATTGTGATGGGCTGAGGGACTGCCCCGACGGCTCCGATGAGCAGCACTGTG AGCCCTTCTGCACGCGCT

TCATGGACTTCGTGTGTAAGAACCGTCAGCAGTGTCTGTTCCACTCCATGGTGTGTGACGGGATCGTCCAGTGCCGAGATGGCTCTGATGAGGATGCGGC

CTTCGCTGGATGCT CGCAAGACCCCGAGTTCCACAAGGAGTGCGATGAGTTCGGCTTCCAGTGTCAGAACGGAGTGTGCATCAGCTTGATTTGGAAATG

CGATGGGATGGATGACTGCGGGGACTACTCTGACGAGGCCAACTGTG AAAACCCCACGGAAGCCCCAAACTGTTCCCGTTACTTTCAGTTCCACTGTGA

GAATGGCCACTGCATCCCCAACAGGTGGAAATGTGACAGAGAGAACGACTGTGGGGACTGGTCTGATGAGAAGGATTGTGGAG ATTCACATGTTCTACC

CTCCCCGACCCCCGGGCCCTCCACGTGTCTGCCCAATTACTTCCACTGCAGCAGCGGGGCCTGTGTGATGGGCACCTGGGTGTGCGACGGCTACAGGGAC

TGTGCAGATGGCTCTGATGAGGAGGCCTGCCCCTCTCTAG CAAACTCCACTGCCGCCTCCACTCCCACCCAGTTCGGGCAGTGCGACCGATTTGAGTTC

GAGTGTCACCAACCAAAGAAATGTATCCCCAACTGGAAGCGCTGTGACGGCCACCAAGATTGCCAAGACGGCCAGGATGAAGCCAACTGCC CCACTCAC

AGCACCTTGACCTGTACGAGCAGGGAGTTCAAGTGTGAGGACGGCGAGGCATGCATCGTGCTCTCGGAGCGCTGTGATGGCTTCCTGGATTGCTCTGATG

AGAGCGATGAGAAGGCCTGCAGCG ATGAGTTAACTGTATACAAAGTGCAGAATCTCCAGTGGACAGCTGATTTCTCCGGAGATGTGACTTTGACCTGGA

TGCGGCCAAAGAAAATGCCATCTGCTTCTTGTGTATACAATGTCTACTACAG GGTGGTTGGAGAGAGCATATGGAAGACCCTGGAAACCCACAGCAATA

AAACAAGCACTGTGCTCAAGGTCCTGAAGCCAGACACCACGTACCAGGTTAAGGTCCAGGTGCACTGCCTCAACAAGGTGCACAACACCAATGACTTTGT

GACCCTCAGGACTCCAGAAGGGT TGCCAGATGCCCCTCGGAATCTCCAGCTCTCCCTGAACAGTGAAGAGGAAGGTGTGATTCTCGGGCACTGGGCTCC

TCCCGTCCACACCCATGGCCTCATCCGTGAGTACATT GTGGAATACAGCAGGAGTGGGTCCAAGATGTGGGCCTCCCAGAGAGCTGCTAGCAACTCTAC

AGAAATAAAGAACTTACTGCTCAATGCCCTCTACACTGTCAGA GTGGCTGCGGTGACTAGTCGTGGGATAGGAAACTGGAGCGATTCTAAGTCCATCAC

CACCATAAAAGGAAAAG TGATCCAAGCACCAAATATCCACATTGACAGCTACGATGAAAATTCTCTGAGCTTTACCCTGACCATGGATGGTGACATCAA

G GTCAATGGCTACGTGGTGAACCTTTTCTGGTCATTTGATGCCCACAAACAAGAAAAGAAAACCCTGAGCTTCCGCGGAGGGAGTGCACTGTCACACAG

AG TTAGCAACCTGACAGCTCATACATCCTATGAGATTTCTGCCTGGGCCAAGACAGACTTGGGAGATAGCCCACTGGCCTTTGAGCACATCTTGACCAG

AGGCAGCAGTCCACCAGCTCCTAGTCTCAAAGCCAAGGCCATCAATCAGACTGCAGTGGAGTGCATCTGGACTGGCCCCAAGAATGTG - UNI10946 

- GTGTATGGTATTTTCTATGCCACATCCTTCCTTGACCTCTACCGAAACCCTAAGAGCGTAACTACTTCGCTCCACAATAAGACAGTCATCGTCAGCAA

GGATGAGCAGTATCTGTTTCTG GTCCGGGTGTTGATCCCTTACCAAGGGCCGTCTTCTGACTACGTTGTAGTGAAGATGATCCCAGACAGCAGGCTCCC

GCCTCGGCATCTGCACGCGGTCCACATAGGCAAAACCTCAGCACTCATCAAATGGGAATCGCCCTATGACTCTCCTGACCAGGACTTG TTCTACGCCAT

TGCAGTGAAAGATCTGATCAGGAAGACGGACAGAAGCTACAAAGTCAGATCCCGCAACAGTACTGTGGAGTACAGCCTAAGCAAGCTGGAACCTGGAGGG

AAATACCACATCATTGTCCAGCTGGGAAACATGAGCAAGGATTCCAGCATAAAAATCACCACAG TTTCGTTATCAGCACCTGATGCCTTAAAAATCATA

ACGGAAAACGACCACGTTCTCCTCTTTTGGAAAAGCCTAGCACTGAAGGAAAAGCAGTTCAATGAAACCAGG GGCTATGAGATCCACATGTCTGACAGC

GCTGTGAATCTCACCGCTTACCTCGGGAATACTACGGACAATTTCTTTAAAGTGTCCAACCTGAAGATGGGTCATAACTACACTTTCACGGTCCAAGCGC

GGTGTCTCTTTGGTAGCCAGATCTGTGGGGAGCCCGCCGTGCTGCTGTACGATGAACTGAGCTCAG - UNI10318 - GTGCAGATGCGGCAGTGATC

CAGGCTGCCCGGTCTACTGATGTTGCAGCTGTGGTGGTTCCCATCCTGTTCCTGATCCTGCTGAGCCTGGGTGTCGGCTTCGCCATCCTCTACACGAAGC

ACCGTCGCTTACAAAGCAGCTTCAGCGCTTTCGCCAACAGCCACTACAGCTCCAGGCTGGGCTCGGCCATCTTCTCCTCAGGGGATGACCTAG GAGAGG

ACGATGAAGATGCTCCCATGATTACTGGATTCTCAGACGATGTCCCCATGGTGATAGCGTGAAGAGCTTTTCTCATTAGAAACCAAATGGTGTAAATATT

TTATTTGATAAAGATAGTTGATGGTTTATTTTAAAAGATGCACTTTGAGTTGCAATATGTTATTTTTATATGGGCC
Translation
MATRSSRRESRLPFLFALVALLPRGALGGGWTQRLHGGPAPLPQDRGFFVVQGDPRDLRLGTHGDAPGASPAARKPLRTRRSAALQPQPIQVYGQ VSLN

DSHNQMVVHWAGEKSNVIVALARDSLALARPKSSD - UNI21931 - VYVSYDYGKSFSKISEKLNFGVGNNSEAVISQFYHSPADNKR - UNI182

72 - YIFVDAYAQYLWITFDFCSTIHGFSIPFRAADLLLHSKASNLLLGFDRSHPNKQ LWKSDDFGQTWIMIQEHVKSFSW - UNI11644 - WGI

DPYDQPNAIYIERHEPFGFSTVLRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVV - UNI11633 - HLPGSQQQSSVQLWVSFGRKPMRAAQFV

TKHPIN EYYIADAAEDQVFVCVSHSNNSTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVR RYFANEPFADFHRVEGLQGVYIATLINGSMNEENM

RSVITFDKGGTWEFLQAPAFTGYGEKINCE LSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLIIATG GSVGKNLASKTNVYISSSAGARWRE AL

PGPHYYTWGDHGGIIMAIAQGMETNELK KYSTNEGETWKTFVFSEKPVFVYGLLTEPGEKSTVFTIFGSNKESVHSWLILQVNATDALG GVPCTENDY

KLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYEC CDFGFKMSEDLSLEVCVPDPEFSGKPYSPPVPCPVGSSYRRTRG 

GYRKISGDTCSGGDVEARLEGELVPCPLAE EENEFILYAMRKSIYRYDLASGATEQLPLSGLRAAVALDFDYERNCLYWSDLALDTIQ RLCLNGSTGQ

EVIINSGLETVEALAFEPLSQLLYWVDAGFKKIE VANPDGDFRLTIVNSSVLDRPRALVLVPQEG GVMFWTDWGDLKPGIYRSYMDGSAAYRLVSEDV

KWPNGISVDSQWIYWTDAYLDCIERITFSGQQRSVILDSLPHPYAIAVFK NEIYWDDWSQLSIFRASKHSRSQVEILASQLTGLMDMKVFYKGKNAG -

 UNI11254 - GSNACVPQPCSLLCLPKANNSKSCRCPEGVASSVLPSGDLMCDCPQGYQRKNNTCVKEE ENTCLRNQYRCSNGNCINSIWWCDFDND

CGDMSDERNCP PTTVCDADTQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCE EMHQCRSDEFNCSSGMCIRSSWVCDGDNDCRDWSDEANCTA AIY

HTCEASNFQCHNGHCIPQRWACDGDADCQDGSDEDPVSCE EKKCNGFHCPNGTCIPSSKHCDGLRDCPDGSDEQHCE EPFCTRFMDFVCKNRQQCLFH

SMVCDGIVQCRDGSDEDAAFAGCS SQDPEFHKECDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANCE ENPTEAPNCSRYFQFHCENGHCIPNRWKC

DRENDCGDWSDEKDCGD DSHVLPSPTPGPSTCLPNYFHCSSGACVMGTWVCDGYRDCADGSDEEACPSLA ANSTAASTPTQFGQCDRFEFECHQPKKC

IPNWKRCDGHQDCQDGQDEANCP PTHSTLTCTSREFKCEDGEACIVLSERCDGFLDCSDESDEKACSD DELTVYKVQNLQWTADFSGDVTLTWMRPKK

MPSASCVYNVYYR RVVGESIWKTLETHSNKTSTVLKVLKPDTTYQVKVQVHCLNKVHNTNDFVTLRTPEGL LPDAPRNLQLSLNSEEEGVILGHWAPP

VHTHGLIREYI VEYSRSGSKMWASQRAASNSTEIKNLLLNALYTVR VAAVTSRGIGNWSDSKSITTIKGKV VIQAPNIHIDSYDENSLSFTLTMDGD

IK VNGYVVNLFWSFDAHKQEKKTLSFRGGSALSHRV VSNLTAHTSYEISAWAKTDLGDSPLAFEHILTRGSSPPAPSLKAKAINQTAVECIWTGPKNV

 - UNI10946 - VYGIFYATSFLDLYRNPKSVTTSLHNKTVIVSKDEQYLFL VRVLIPYQGPSSDYVVVKMIPDSRLPPRHLHAVHIGKTSALIKWE

SPYDSPDQDL FYAIAVKDLIRKTDRSYKVRSRNSTVEYSLSKLEPGGKYHIIVQLGNMSKDSSIKITTV VSLSAPDALKIITENDHVLLFWKSLALKE

KQFNETR GYEIHMSDSAVNLTAYLGNTTDNFFKVSNLKMGHNYTFTVQARCLFGSQICGEPAVLLYDELSSG - UNI10318 - GADAAVIQAARST

DVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFSAFANSHYSSRLGSAIFSSGDDLG GEDDEDAPMITGFSDDVPMVIA

For any suggestions or comments, please send an email to unitrap@crg.es