Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049327 (Setd8)
Chromosomal location
Chr 5: 124889939 - 124912316 (+)
Description
SET domain containing (lysine methyltransferase) 8 Gene [Source:MGI (curated);Acc:Setd8-001]
RefSeq_dna
NM_030241 
RefSeq_peptide
NP_084517.2 
UniGene
Mm.137966 Mm.405213 Mm.465160 Mm.472072 
MGI
MGI:1915206 
Uniprot/SWISSPROT
Q2YDW7 
Uniprot/SPTREMBL
Q8C1L9 
Human Ortholog
ENSG00000183955 (SETD8)
Omim not available
UniTrap UNI5356
Vector Insertion
Chr 5: 124890025 - 124895547
Public Clones (sanger) YTA387 (baygenomics) D145B04 (ggtc) Ayu21-T330 (egtc) IST14206G12 (tigm)
IST12093E7 (tigm) IST14798G2 (tigm) IST13154D12 (tigm) IST12686G10 (tigm)
IST10930D12 (tigm) IST10665H11 (tigm) IST14869B6 (tigm) IST14585C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17985
Vector Insertion
Chr 5: 124896094 - 124897222
Public Clones D184G08 (ggtc) E123E10 (ggtc) CMHD-GT_475G12-3 (cmhd) CMHD-GT_524A4-3 (cmhd)
CMHD-GT_495G7-3 (cmhd) CMHD-GT_407B2-3 (cmhd) (cmhd) CMHD-GT_524B6-3 (cmhd)
CMHD-GT_493H11-3 (cmhd) CMHD-GT_509H8-3 (cmhd) CMHD-GT_483A8-3 (cmhd)
Private Clones OST432450 (lexicon) OST419800 (lexicon) OST379254 (lexicon) OST319488 (lexicon)
OST301678 (lexicon) OST288251 (lexicon) OST280585 (lexicon) OST268906 (lexicon)
OST268329 (lexicon) OST240062 (lexicon) OST238482 (lexicon) OST205362 (lexicon)
OST68796 (lexicon) OST60824 (lexicon) OST56810 (lexicon) OST54547 (lexicon)
OST40086 (lexicon) OST36714 (lexicon) OST33480 (lexicon) OST1973 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5463
Vector Insertion
Chr 5: 124897380 - 124900669
Public Clones RRB075 (baygenomics) CSJ210 (baygenomics) F062C06 (ggtc) CMHD-GT_305D01-3 (cmhd)
CMHD-GT_481E10-3 (cmhd)
Private Clones OST399065 (lexicon) OST82993 (lexicon) OST60642 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28369
Vector Insertion
Chr 5: 124900890 - 124901294
Public Clones not available
Private Clones OST32618 (lexicon)
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19831
Vector Insertion
Chr 5: 124901383 - 124907067
Public Clones not available
Private Clones OST379318 (lexicon) OST15657 (lexicon)
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27364
Vector Insertion
Chr 5: 124907128 - 124909783
Public Clones not available
Private Clones OST61653 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6760
Vector Insertion
Chr 5: 124909975 - 124910495
Public Clones HMA322 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000059580
Sequence
AGTTGGCTACAGTTGTTGCAACTTTTTTCGAAAGCTGGGTTTCCCGGGAGATTCCAGGCGGTGACAGAGCCCGGCCATGGCTAGAG - UNI5356 - G

CAGGAAGATGTGCAAGCCCCGCGCGGTGGAGGCGGCGGCGGCGGCGGTGGCGGCGACGGCCCCGGGCCCGGAGATGGTGGAGCAGAGGGGCCCGGGGAGG

CCCCGCAGCGACGGG - UNI17985 - GAGAACGTGTTTGCTGGGCAGTCAAAGATCTATGCCTACATGAGTCCGAACAAGTGCTCTGCAATGCGCTC

TCCACTTCAGGAAGAGAACTCGGTTGCCCATCATGAGGTCAAATGCCCGGGGAAACCATTAGCTGGAATCTACAGGAAGCGAGAAG - UNI5463 - A

GAAAAGGAACACCGGGAACGTTATACGAAGCGCTGTGAAGTCAGATGAACAGAAGAGCAAAGACACCAGGAGAGGTCCCCTGGCGCCTTTTCCAAACCAA

AAATCCGAAGCAGCAGAACCTCCAAAAACTCCACCCCCATCATGTGATTCTACCAATGTAGCAGTCGCTAAGCAAGCCCTGAAAAAGTCCCTCAAGGGCA

AACAGGCCCCTCGGAAAAA - UNI28369 - GTCTCAAGGGAAAACCCAGCAGAATAGAAAACTCACAGATTTCTACCCTGTGCGGAGGAGTTCCCGG

AAGAGCAAAGCTGAGCTGCAG - UNI19831 - TCTGAAGAAAGGAAGAAAATAGATGAGCTGATTGAGAGCGGGAAGGAAGAAGGCATGAAG - UN

I27364 - ATTGATCTAATTGATGGCAAAGGCAGGGGTGTGATCGCTACCAAGCAGTTCTCCAGGGGAGACTTTGTGGTAGAATACCATGGGGACCTCA

TTGAAATCACTGATGCCAAGAAGCGGGAGGCTCTGTACGCACAGGACCCCTCCACTGGCTGCTACATGTACTATTTTCAGTATCTGAGCAAAACCTACTG

 - UNI6760 - CGTGGATGCCACTCAAGAAACGAACCGCCTAGGGAGACTCATCAATCACAGTAAGTGTGGGAACTGCCAGACCAAACTGCACGACAT

CGACGGCGTGCCTCACCTCATCCTCATCGCCTCCCGAGACATCGCAGCTGGGGAGGAGCTCCTGTACGACTATGGGGACCGAAGCAAGGCCTCCATCGAA

GCCTACCCCTGGCTGAAGCACTAACCACGTGGCCTCCCTGCCTCCCTGCCACCCTGCCTCCTTCAAAGGACAAAGTGCCCTCAAAGGGAAATGAATTTTT

TTTTACACACACACACGCACACACACACACATACACACACACTCACACTCACTCTTAGCTAATTACTTCAAATGTTTTTAAAAAGTATATTAAAGATGCC

TTTTCATGTAGTATTTAAATATCTGTTACAGGTTTCCAAGGTGGACTTGAACAGATGGCCTTATATTACCAAAACTTTTATATTCTAGTTGTTTTTGTAC

CTTTTTGCATACAAGCTGAACGTTTGTGCTTCCCGCGCAGTGTAAGACTCGGCACAGGTTTTAGAGAATGGAGTTGAACATGAACTAGGAAGCCGGGCTC

TGCCCAAGATGAAAGCCAGGACTCCCCCACACCCCACGTCCAAGGACAGGCCGGTGTGAGGGCGCTGCCCCCCCACGCACAGCCTGGACGGGATGTCTCC

AAGCTCTTGTTCTCCTCAGCATCCTGACAGGCGTACACACTGTCGTGTATGAATATTTTTTAGCAAAAGTTTCACAGTAAGCTAGTCTTCCCCTCTGCTT

TCTCCAAAGCTTACTGAGCCCGGGGCTGGGAGGCCCGGCCAGGAACAGACCTCTTCCACAGGCTTACGGCTTTTCCAGGCACCTTGAAGCATCAGGGTGG

ACAGTCAGATTAGAGGCGGGCCGGGAAAAGCACTGTTCTCCTGCTCAAGAAGGGCAGGTCTCCTGAAACTGCATTAATTCTTTATAGAAATGTGAACACT

GAATTTATTTTAAAAAATAATAAAAACAAAACATTTTAAAAAAATCAAAAAAAGAAAAAATGGAAAAAAAAACCCACAGAAAACAACTTAACGTGTATAT

AGGTTTTGAAGGGAGTGAAATGAATGCGGTTTTCTTTTCTTCTGGGGTTTATTTTTTTTCTTTTTGGCTTGGCTGGTTGGTTTGTGTAGAGAAGATTTGA

GATGGTACTCTATTCTAATCAAAAGTGAGGTTTTGTAGTGGGACCAGAAATTACTAAGCCCACACCCCCTCCCTAACCCCAATTCTGCTGCATGGGAAGT

TCTCCACCTGCTGCCAAGGCAGAGCTCCTGGTCTCCCATGAAGATGCTGTCAGCTGTCAGTCTAGCACCCCGGAGCATCAGGCACCAGACGTGCTTGGCA

CTAGGGTACCTGGCAGCCGGCAGAGAACCAGGATGATGCTTCGGTTTTGACCTGTGAGAGCAAGAGTAGGTGGCTTCCTTCTCCCTCCCTGGGGAGGACT

CACCATTCACCTTCAGTCCAGGGGCCTGGGGTTCAGGAGCCAGGTATAAGACCCTACCCTCGTCCCCTACACCCCCATCTCCCAGGCTCATGATGGTGCT

ACCTACGAAAGTCTCCCCCGCACCCTCTGCTAGCCCAGTCAGTGGTCAGACTTGGAGGAGGATCCGACAGGAGGGTGTAACTGTGAGATAAAAATGTCTT

GGTTGTACCTGTTTGTGGCTTAGCTTTGTATTTAAATAGCAAACAAACAAAAAAAAAGGAAATAAACTTGAAACTTATTTGTCATCTTAAGAATAAAGCA

AAAAAATTAAAATATTTATTGCCAGGCAAGGCC
Translation
MARG - UNI5356 - GRKMCKPRAVEAAAAAVAATAPGPEMVEQRGPGRPRSDG - UNI17985 - ENVFAGQSKIYAYMSPNKCSAMRSPLQEEN

SVAHHEVKCPGKPLAGIYRKREE - UNI5463 - EKRNTGNVIRSAVKSDEQKSKDTRRGPLAPFPNQKSEAAEPPKTPPPSCDSTNVAVAKQALKKS

LKGKQAPRKK - UNI28369 - KSQGKTQQNRKLTDFYPVRRSSRKSKAELQ - UNI19831 - SEERKKIDELIESGKEEGMK - UNI27364 

- IDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYC - UNI6760 - CVDATQETNRLGRLINHSKCG

NCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAYPWLKH
Transcript ENSMUST00000111458
Sequence
GGCGCCCGGCCTGCTACGGGCCATGGGCGAAGCGGG CCGTGGGGCGCCGCCGGCCCTTTCCCGGAGCGCCGCGGCGGCGCTGGTGGCGTCGGCAGCAGC

AGCAGCAGCGGCGGCGGCAGCGCT TGGCCCGGCCGCGGCGAGGGCGAGGGTGCCGGCCGCGCCGCCATGGGCCTAGCCGGGCTGCAG - UNI17985 

- GAGAACGTGTTTGCTGGGCAGTCAAAGATCTATGCCTACATGAGTCCGAACAAGTGCTCTGCAATGCGCTCTCCACTTCAGGAAGAGAACTCGGTTGC

CCATCATGAGGTCAAATGCCCGGGGAAACCATTAGCTGGAATCTACAGGAAGCGAGAAG - UNI5463 - AGAAAAGGAACACCGGGAACGTTATACG

AAGCGCTGTGAAGTCAGATGAACAGAAGAGCAAAGACACCAGGAGAGGTCCCCTGGCGCCTTTTCCAAACCAAAAATCCGAAGCAGCAGAACCTCCAAAA

ACTCCACCCCCATCATGTGATTCTACCAATGTAGCAGTCGCTAAGCAAGCCCTGAAAAAGTCCCTCAAGGGCAAACAGGCCCCTCGGAAAAA - UNI28

369 - GTCTCAAGGGAAAACCCAGCAGAATAGAAAACTCACAGATTTCTACCCTGTGCGGAGGAGTTCCCGGAAGAGCAAAGCTGAGCTGCAG - UNI

19831 - TCTGAAGAAAGGAAGAAAATAGATGAGCTGATTGAGAGCGGGAAGGAAGAAGGCATGAAG - UNI27364 - ATTGATCTAATTGATGGC

AAAGGCAGGGGTGTGATCGCTACCAAGCAGTTCTCCAGGGGAGACTTTGTGGTAGAATACCATGGGGACCTCATTGAAATCACTGATGCCAAGAAGCGGG

AGGCTCTGTACGCACAGGACCCCTCCACTGGCTGCTACATGTACTATTTTCAGTATCTGAGCAAAACCTACTG - UNI6760 - GCGTGGATGCCACT

CAAGAAACGAACCGCCTAGGGAGACTCATCAATCACAGTAA
Translation
GARPATGHGRSG PWGAAGPFPERRGGAGGVGSSSSSGGGSA WPGRGEGEGAGRAAMGLAGLQ - UNI17985 - ENVFAGQSKIYAYMSPNKCSAM

RSPLQEENSVAHHEVKCPGKPLAGIYRKREE - UNI5463 - EKRNTGNVIRSAVKSDEQKSKDTRRGPLAPFPNQKSEAAEPPKTPPPSCDSTNVAV

AKQALKKSLKGKQAPRKK - UNI28369 - KSQGKTQQNRKLTDFYPVRRSSRKSKAELQ - UNI19831 - SEERKKIDELIESGKEEGMK - U

NI27364 - IDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYW - UNI6760 - WRGCHSRNEPPRE

THQSQ
Transcript ENSMUST00000100709
Sequence
CGCGCCGTCCCCGGCCTCGCTCCGGGCCCCGGCTGCGGCGCGCGCGGGCGCCCGGCCTGCTACGGGCCATGGGCGAAGCGGGCGCCGTGGGGCGCCGCCG

GCCCTTTCCCGGAGCGCCGCGGCGGCGCTGGTGGCGTCGGCAGCAGCAGCAGCAGCGGCGGCGGCAGCGCTGGTGGCCCGGCCGCGGCGAGGGCGAGGGT

GCCGGCCGCGCCGCCATGGGCCTAGCCGGGCTGCAG - UNI17985 - GAGAACGTGTTTGCTGGGCAGTCAAAGATCTATGCCTACATGAGTCCGAA

CAAGTGCTCTGCAATGCGCTCTCCACTTCAGGAAGAGAACTCGGTTGCCCATCATGAGGTCAAATGCCCGGGGAAACCATTAGCTGGAATCTACAGGAAG

CGAGAAG - UNI5463 - AGAAAAGGAACACCGGGAACGTTATACGAAGCGCTGTGAAGTCAGATGAACAGAAGAGCAAAGACACCAGGAGAGGTCCC

CTGGCGCCTTTTCCAAACCAAAAATCCGAAGCAGCAGAACCTCCAAAAACTCCACCCCCATCATGTGATTCTACCAATGTAGCAGTCGCTAAGCAAGCCC

TGAAAAAGTCCCTCAAGGGCAAACAGGCCCCTCGGAAAAA - UNI28369 - GTCTCAAGGGAAAACCCAGCAGAATAGAAAACTCACAGATTTCTAC

CCTGTGCGGAGGAGTTCCCGGAAGAGCAAAGCTGAGCTGCAG - UNI19831 - TCTGAAGAAAGGAAGAAAATAGATGAGCTGATTGAGAGCGGGAA

GGAAGAAGGCATGAAG - UNI27364 - ATTGATCTAATTGATGGCAAAGGCAGGGGTGTGATCGCTACCAAGCAGTTCTCCAGGGGAGACTTTGTGG

TAGAATACCATGGGGACCTCATTGAAATCACTGATGCCAAGAAGCGGGAGGCTCTGTACGCACAGGACCCCTCCACTGGCTGCTACATGTACTATTTTCA

GTATCTGAGCAAAACCTACTG - UNI6760 - CGTGGATGCCACTCAAGAAACGAACCGCCTAGGGAGACTCATCAATCACAGTAAGTGTGGGAACTG

CCAGACCAAACTGCACGACATCGACGGCGTGCCTCACCTCATCCTCATCGCCTCCCGAGACATCGCAGCTGGGGAGGAGCTCCTGTACGACTATGGGGAC

CGAAGCAAGGCCTCCATCGAAGCCTACCCCTGGCTGAAGCACTAACCACGTGGCCTCCCTGCCTCCCTGCCACCCTGCCTCCTTCAAAGGACAAAGTGCC

CTCAAAGGGAAATGAATTTTTTTTTACACACACACACGCACACACACACACATACACACACACTCACACTCACTCTTAGCTAATTACTTCAAATGTTTTT

AAAAAGTATATTAAAGATGCCTTTTCATGT
Translation
MGEAGAVGRRRPFPGAPRRRWWRRQQQQQRRRQRWWPGRGEGEGAGRAAMGLAGLQ - UNI17985 - ENVFAGQSKIYAYMSPNKCSAMRSPLQEEN

SVAHHEVKCPGKPLAGIYRKREE - UNI5463 - EKRNTGNVIRSAVKSDEQKSKDTRRGPLAPFPNQKSEAAEPPKTPPPSCDSTNVAVAKQALKKS

LKGKQAPRKK - UNI28369 - KSQGKTQQNRKLTDFYPVRRSSRKSKAELQ - UNI19831 - SEERKKIDELIESGKEEGMK - UNI27364 

- IDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYC - UNI6760 - CVDATQETNRLGRLINHSKCG

NCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAYPWLKH

For any suggestions or comments, please send an email to unitrap@crg.es