Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049336 (Odz2)
Chromosomal location
Chr 11: 35820158 - 37049384 (-)
Description
odd Oz/ten-m homolog 2 (Drosophila) Gene [Source:MGI (curated);Acc:Odz2-001]
RefSeq_dna
NM_011856 
RefSeq_peptide
NP_035986.3 
UniGene
Mm.439889 Mm.473033 
MGI
MGI:1345184 
Uniprot/SWISSPROT
Q9WTS5 
Human Ortholog
ENSG00000145934 (ODZ2)
Omim not available
UniTrap UNI31944
Vector Insertion
Chr 11: 36757442 - 36959143
Public Clones IST10978H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35267
Vector Insertion
Chr 11: 36198620 - 36678446
Public Clones IST13998D8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32602
Vector Insertion
Chr 11: 35862593 - 35865525
Public Clones (sanger) IST11061C10 (tigm) IST10833A9 (tigm) IST10867F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000057207
Sequence
ATGGATGTAAAGGACCGGCGACATCGCTCTTTGACCAGGGGACGGTGTGGCAAAGAGTGTCGCTACACCAGCTCCTCTCTGGACAGTGAGGACTGCCGTG

TGCCCACTCAGAAGTCCTACAGTTCCAGCGAGACCTTGAAGGCTTATGACCATGACAGCAGAATGCACTATGGAAACCGAGTCACAGACCTGGTGCACCG

GGAGTCGGATGAGTTTTCTAGACAAG - UNI31944 - - UNI35267 - GGACAAACTTCACCCTGGCAGAATTGGGAATCTGCGAGCCCTCCCCA

CACCGAAGTGGTTACTGTTCCGACATGGGTATCCTCCACCAGGGCTACTCCCTGAGCACTGGGTCTGATGCAGACTCGGACACCGAGGGAGGGATGTCTC

CAGAACATGCCATCAGACTGTGGGGACGAGGGATAAAATCCAGGCGCAGCTCTGGCTTGTCCAGCCGCGAGAACTCGGCCCTTACTCTGACTGACTCTGA

CAATGAAAATAAATCGGATGACGACAATG - UNI35267 - GTCGTCCCATTCCACCTACATCCTCGTCTAGCCTCCTCCCATCTGCTCAGCTGCCTA

GCTCCCATAATCCTCCACCAGTTAGCTGCCAGATGCCATTGCTAGACAGCAACACCTCCCATCAGATCATGGACACCAACCCTGATGAGGAATTCTCCCC

CAATTCATACCTGCTCAGAGCATGCTCAGGGCCCCAGCAAGCCTCCAGCAGTG - UNI35267 - GCCCTCCAAACCACCACAGCCAGTCAACACTGA

GGCCCCCTCTGCCACCCCCTCATAACCACACCCTGTCCCACCACCACTCCTCGGCCAACTCCCTCAACAGGAACTCACTGACCAATCGGCGGAGTCAAAT

CCACGCCCCAGCTCCTGCGCCCAACGACCTGGCCACCACCCCAGAGTCTGTTCAGCTCCAGGATAGCTGGGTGCTGAACAGTAACGTCCCACTGGAGACT

CG GCACTTCCTTTTCAAGACGTCGTCTGGAAGCACACCCCTGTTCAGCAGCTCTTCTCCGGGATACCCTTTGACCTCAGGGACCGTTTATACACCACCA

CCCCGCCTGCTGCCACGGAATACATTCTCCAGGAAGGCCTTCAAGCTGAAGAAACCCTCCAAATACTGCAGTTGGAAATGCGCTGCCCTGTCTGCCATCG

CCGCCGCCCTCCTCTTGGCCATTTTGCTGGCATATTTCATAG CAATGCATCTGCTCGGACTCAATTGGCAACTCCAGCCGGCAGATGGACACACCTTTA

ACAATGGCGTAAGGACCGGCTTACCAGGAAACGATGATGTGGCAACAGTGCCATCTGGAGGCAAAG TGCCCTGGTCATTGAAAAACAGCAGCATAGACA

GTGGCGAAGCAGAAGTTGGTCGGCGGGTGACACAGGAAGTCCCACCAGGGGTGTTTTGGAGGTCCCAGATTCACATCAGTCAGCCTCAATTCTTAAAGTT

CAACATCTCCCTGGGCAAGGATGCCCTCTTCGGTGTCTATATAAGGAGAGGACTACCACCGTCTCATGCCCAG TATGACTTCATGGAACGCCTGGATGG

AAAGGAGAAATGGAGCGTGGTCGAGTCGCCCAGGGAACGCCGGAGCATCCAGACTCTGGTGCAGAACGAGGCTGTGTTTGTGCAGTACTTGGATGTGGGC

CTGTGGCACCTGGCCTTCTACAATGACGGCAAGGACAAGGAGATGGTCTCCTTCAACACTGTTGTCTTAG ATTCAGTGCAGGACTGTCCACGGAACTGT

CACGGGAACGGCGAATGCGTGTCTGGACTGTGTCACTGTTTCCCAGGATTCCTAGGTGCAGACTGTGCTAAAG CTGCCTGCCCTGTACTGTGCAGCGGA

AATGGACAGTATTCTAAAGGAACGTGCCAGTGCTACAGCGGCTGGAAAGGTGCAGAGTGCGATGTGCCTATGAACCAATGTATCGATCCTTCCTGTGGGG

GCCATGGCTCCTGCATTGATGGGAACTGCGTGTGTGCTGCTGGCTACAAGGGCGAGCACTGTGAGGAAG TTGATTGCTTGGATCCTACCTGCTCCAGCC

ATGGTGTCTGTGTGAATGGAGAGTGTCTATGCAGCCCCGGCTGGGGTGGTCTCAACTGTGAGCTGGCGAGGGTCCAGTGCCCAGACCAGTGTAGTGGGCA

TGGCACTTACCTCCCTGACTCCGGCCTCTGCAGCTGTGATCCGAACTGGATGGGTCCCGACTGCTCTGTTG AAGTGTGCTCAGTAGACTGTGGCACTCA

CGGCGTCTGCATCGGGGGAGCCTGCCGCTGTGAAGAGGGCTGGACAGGCGCAGCTTGTGACCAGCGCGTGTGCCACCCCCGCTGCATTGAGCACGGGACC

TGTAAAGATGGCAAATGTGAATGCCGAGAGGGCTGGAATGGTGAACACTGCACCATTG ATGGCTGCCCTGATTTGTGCAACGGTAACGGGAGATGCACA

CTGGGTCAGAACAGCTGGCAGTGTGTCTGCCAGACCGGCTGGAGAGGGCCTGGATGCAACGTTGCCATGGAAACCTCCTGCGCTGATAACAAGGATAATG

AGGGAG ATGGCCTGGTGGACTGCCTGGACCCTGACTGCTGCCTACAGTCAGCCTGTCAGAACAGCCTGCTCTGCCGGGGGTCTCGGGACCCCTTGGACA

TCATTCAGCAAGGTCAGACAGACTGGCCTGCAGTGAAGTCCTTCTATGACCGCATCAAGCTCTTGGCAGGCAAGGACAGCACCCACATCATTCCTGGAGA

CAACCCCTTCAATAGCAG CCTGGTGTCTCTGATCCGAGGCCAAGTAGTAACCATGGATGGGACTCCCTTGGTGGGTGTGAATGTGTCTTTTGTCAAGTA

CCCAAAATATGGCTACACCATCACTCGCCAGGATGGCAC GTTTGATCTGATTGCCAATGGGGGTTCTGCCTTGACTCTTCACTTTGAGCGAGCCCCTTT

CATGAGCCAGGAGCGCACAGTGTGGCTGCCATGGAACAGCTTCTATGCCATGGACACCCTGGTAATGAAGACCGAGGAAAACTCCATCCCCAGCTGTGAC

CTCAGTGGCTTTGTCCGGCCAGATCCAATCATCATCTCCTCTCCTCTGTCTACCTTCTTCAGCGCTTCCCCTGCCTCGAACCCCATTGTGCCTGAGACCC

AG GTTCTTCATGAAGAAATTGAGCTCCCTGGTACCAATGTGAAGCTCCGTTATCTCAGCTCTAGAACTGCAGGGTACAAGTCGCTGCTGAAGATCACCA

TGACACAGTCCACAGTGCCCTTGAACCTCATCAGGGTTCACTTGATGGTTGCTGTAGAGGGGCATCTCTTCCAGAAGTCATTCCAGGCTTCTCCCAACCT

AGCCTACACATTCATCTGGGACAAGACAGATGCTTATGGCCAAAGGGTTTATGGCCTATCGGATGCTGTTG TGTCTGTTGGGTTTGAATATGAGACCTG

CCCCAGTCTCATCCTGTGGGAGAAAAGGACAGCCCTGCTTCAGGGATTCGAGCTGGACCCTTCCAACCTTGGAGGCTGGTCCCTGGACAAACACCACACC

CTCAATGTGAAAAGCG GAATACTACACAAAGGGACAGGGGAGAACCAGTTCCTGACCCAGCAGCCTGCCATCATCACGAGCATCATGGGCAACGGTCGC

CGCAGAAGCATCTCCTGTCCCAGCTGTAATGGCCTTGCTGAAGGCAACAAACTGTTAGCCCCTGTGGCCCTGGCTGTGGGGATCGATGGGAGCCTCTTTG

TTGGTGACTTCAACTATATCCGGCGCATCTTTCCCTCTCGAAATGTGACCAGTATCTTGGAGTTACG AAATAAAGAGTTTAAACATAG - UNI32602

 - CAACAGCCCAGGACACAAGTATTACTTGGCTGTGGACCCCGTGACCGGCTCACTCTACGTCTCTGACACCAACAGTCGCCGAATCTACCGAGTCAAG

TCTCTGAGCGGAGCCAAAGACCTGGCTGGAAATTCGGAAGTTGTGGCAGGGACTGGCGAACAATGTCTACCCTTTGATGAAGCCCGCTGTGGGGATGGAG

GGAAGGCTGTGGACGCCACCCTCATGAGCCCCAGAG - UNI32602 - GTATTGCAGTAGACAAGAATGGGCTTATGTACTTTGTTGATGCCACCATG

ATCCGGAAGGTGGACCAAAACGGAATCATCTCCACCCTGCTGGGCTCCAATGACCTCACAGCTGTCCGACCACTGAGCTGTGACTCGAGCATGGACGTGG

CCCAG - UNI32602 - GTCCGTCTAGAATGGCCGACAGACCTCGCCGTCAACCCCATGGACAACTCCCTGTACGTTCTGGAGAACAACGTCATCCTG

CGGATCACGGAGAACCACCAGGTCAGCATCATCGCGGGACGGCCTATGCACTGCCAGGTTCCCGGCATCGACTACTCGCTCAGCAAACTCGCCATCCATT

CTGCGCTGGAATCAGCCAGCGCCATTGCTATTTCTCACACTGGGGTGCTCTACATCACTGAGACGGACGAGAAGAAGATCAACCGCCTACGCCAAGTCAC

CACCAATGGAGAGATCTGCCTCTTAGCCGGGGCGGCCTCAGACTGTGACTGCAAAAACGATGTCAACTGCATCTGCTACTCGGGAGATGACGCTTACGCC

ACGGACGCCATCCTAAACTCGCCGTCCTCCTTAGCCGTGGCTCCAGATGGCACCATCTACATTGCAGACCTTGGGAATATCCGGATCAGGGCGGTCAGCA

AAAATAAACCCGTTCTTAACGCATTCAACCAGTATGAGGCTGCATCTCCGGGAGAACAGGAATTGTACGTGTTCAACGCTGATGGTATCCATCAGTACAC

TGTGAGTCTGGTGACTGGGGAGTACTTGTACAATTTCACATACAGCGCTGACAATGACGTCACCGAGTTGATTGACAACAACGGGAATTCCCTAAAGATC

CGCCGGGACAGCAGTGGCATGCCCCGCCACCTGCTCATGCCTGATAATCAGATTATCACCCTTACCGTGGGCACCAATGGAGGCCTCAAAGCCGTGTCCA

CTCAGAACCTGGAGCTGGGCCTCATGACTTATGATGGGAACACTGGACTCCTAGCCACCAAGAGTGATGAAACTGGATGGACAACTTTTTATGA CTATG

ACCACGAGGGCCGTCTGACCAATGTGACCCGCCCCACGGGCGTAGTGACCAGTCTGCACCGGGAAATGGAGAAATCTATCACCATTGACATTGAGAACTC

CAACCGGGATGATGACGTCACTGTGATCACCAACCTCTCCTCCGTGGAGGCCTCCTATACAGTGGTACAAG ATCAAGTGCGAAACAGCTACCAGCTCTG

CAATAATGGAACCCTGCGGGTGATGTACGCCAACGGCATGGCTGTCAGCTTCCACAGTGAGCCCCACGTCCTCGCAGGCACCATCACCCCCACCATTGGG

CGCTGCAACATCTCTCTGCCCATGGAGAATGGCCTGAACTCCATCGAGTGGCGCCTGAGGAAGGAACAGATCAAAGGCAAAGTCACCATCTTTGGGAGGA

AGCTTCGG GTCCACGGAAGGAATCTCCTGTCCATTGATTATGACCGAAATATCCGAACGGAGAAGATCTACGATGACCACCGGAAATTCACCCTGAGGA

TCATCTATGACCAGGTGGGCCGCCCCTTCCTGTGGCTCCCGAGCAGTGGGCTGGCAGCCGTCAATGTCTCCTACTTCTTCAATGGGCGCTTGGCCGGCCT

CCAGCGAGGGGCCATGAGCGAGAGGACAGACATTGACAAGCAAGGCCGGATCGTGTCCCGCATGTTCGCCGACGGGAAAGTCTGGAGCTATTCCTATCTT

GACAAG TCCATGGTCCTTCTGCTACAGAGCCAACGTCAGTACATATTTGAATATGACTCCTCCGATCGCCTCCACGCAGTCACTATGCCCAGTGTCGCC

CGGCACAGCATGTCCACGCACACCTCCATTGGTTACATCCGAAACATTTACAACCCACCCGAAAGCAATGCATCAGTCATCTTTGACTACAGTGATGACG

GCCGCATCCTAAAGACATCTTTCTTGGGCACTGGGCGCCAGGTGTTCTACAAGTATGGAAAACTCTCCAAGTTATCAGAGATAGTCTACGACAGCACAGC

CGTCACCTTTGGGTATGACGAGACCACCGGTGTCCTGAAGATGGTCAATCTCCAAAGTGGGGGTTTCTCCTGTACCATCAGGTACCGAAAGGTTGGGCCC

CTTGTGGACAAGCAGATTTACAGGTTCTCTGAGGAAGGAATGATCAACGCCAGGTTTGATTATACCTATCACGACAATAGCTTCCGCATTGCCAGCATCA

AACCCGTCATTAGCGAGACTCCCCTTCCTGTTGACCTCTACCGCTATGATGAGATTTCCGGCAAGGTGGAACACTTCGGCAAGTTTGGGGTCATCTACTA

CGACATCAACCAGATCATCACCACTGCCGTCATGACGCTTAGCAAGCACTTTGACACCCATGGGCGCATCAAGGAAGTGCAATATGAGATGTTCCGGTCC

CTCATGTACTGGATGACTGTGCAATATGACAGTATGGGTAGGGTCATCAAGAGGGAACTGAAACTAGGGCCCTATGCCAACACCACAAAGTACACCTATG

ACTATGACGGGGACGGCCAGCTCCAGAGTGTGGCCGTCAATGACCGGCCTACCTGGCGCTATAGCTATGACCTCAATGGGAACCTGCACCTTCTAAACCC

AGGAAACAGTGCTCGCCTCATGCCCTTACGCTATGACCTCCGTGACCGGATAACCAGGCTAGGGGACGTGCAGTACAAAATCGATGACGATGGCTATTTG

TGCCAGAGAGGGTCAGACATCTTTGAATACAACTCCAAGGGCCTTCTGACAAGAGCATACAACAAGGCCAGCGGATGGAGCGTGCAGTACCGCTATGACG

GAGTGGGCCGCCGGGCTTCCTACAAGACCAACCTGGGCCACCACCTACAGTACTTCTACTCCGACCTCCACAACCCCACACGTATCACCCATGTTTACAA

CCACTCCAACTCTGAGATCACCTCGCTCTACTATGACCTCCAGGGCCACCTATTTGCCATGGAGAGCAGTAGTGGTGAAGAATACTATGTCGCCTCAGAC

AACACGGGGACCCCTCTGGCTGTGTTCAGTATCAATGGCCTCATGATCAAGCAACTGCAGTACACAGCCTATGGGGAGATCTACTATGACTCCAATCCAG

ACTTCCAGATGGTCATTGGCTTCCACGGAGGCCTCTATGACCCCCTCACCAAGCTCGTCCACTTTACTCAACGTGATTATGACGTGCTGGCAGGACGGTG

GACGTCCCCCGACTACACCATGTGGAGGAACGTGGGCAAGGAGCCAGCCCCCTTCAACCTGTACATGTTCAAGAACAACAATCCTCTGAGCAATGAGCTG

GACTTAAAGAACTACGTGACAG ACGTGAAGAGCTGGCTTGTGATGTTTGGATTTCAGCTCAGCAACATCATTCCTGGATTCCCGAGAGCCAAAATGTAT

TTTGTGCCTCCCCCCTATGAACTGTCAGAGAGTCAAGCAAGCGAGAACGGACAG CTCATTACAGGTGTCCAGCAGACAACTGAGAGGCATAACCAGGCC

TTCCTGGCTCTGGAAGGACAGGTCATCACTAAAAAGCTCCATGCCAGCATCCGAGAGAAAGCAGGCCACTGGTTTGCTACCACCACACCCATCATCGGCA

AAGGCATCATGTTTGCCATCAAAGAAGGGCGGGTGACCACAGGAGTGTCTAGCATCGCCAGTGAGGACAGCCGCAAGGTAGCATCCGTGTTGAACAATGC

CTACTACTTAGACAAGATGCACTACAGCATCGAGGGCAAGGACACACACTACTTTGTGAAGATCGGCGCCGCGGATGGTGACCTGGTCACGCTAGGAACC

ACCATTGGGCGCAAGGTGCTGGAGAGTGGGGTGAACGTGACGGTGTCACAGCCCACGCTGCTGGTGAATGGCAGGACTCGAAGGTTCACCAACATTGAGT

TCCAGTACTCCACGCTGCTGCTCAGTATCCGCTACGGCCTCACCCCCGACACGCTGGACGAAGAAAAGGCCCGCGTCCTGGACCAAGCGAGACAGAGAGC

CCTGGGTACTGCCTGGGCCAAGGAGCAGCAGAAAGCCAGGGACGGGAGAGAGGGCAGCCGCCTGTGGACGGAGGGCGAGAAGCAGCAACTCCTGAGCACG

GGACGGGTACAAGGTTATGAGGGCTATTACGTACTTCCGGTGGAACAGTACCCGGAGCTGGCAGACAGTAGCAGCAACATCCAGTTCTTAAGACAGAATG

AGATGGGAAAGAGGTAA
Translation
MDVKDRRHRSLTRGRCGKECRYTSSSLDSEDCRVPTQKSYSSSETLKAYDHDSRMHYGNRVTDLVHRESDEFSRQG - UNI31944 - - UNI35267

 - GTNFTLAELGICEPSPHRSGYCSDMGILHQGYSLSTGSDADSDTEGGMSPEHAIRLWGRGIKSRRSSGLSSRENSALTLTDSDNENKSDDDNG - U

NI35267 - GRPIPPTSSSSLLPSAQLPSSHNPPPVSCQMPLLDSNTSHQIMDTNPDEEFSPNSYLLRACSGPQQASSSG - UNI35267 - GPPNH

HSQSTLRPPLPPPHNHTLSHHHSSANSLNRNSLTNRRSQIHAPAPAPNDLATTPESVQLQDSWVLNSNVPLETR RHFLFKTSSGSTPLFSSSSPGYPLT

SGTVYTPPPRLLPRNTFSRKAFKLKKPSKYCSWKCAALSAIAAALLLAILLAYFIA AMHLLGLNWQLQPADGHTFNNGVRTGLPGNDDVATVPSGGKV 

VPWSLKNSSIDSGEAEVGRRVTQEVPPGVFWRSQIHISQPQFLKFNISLGKDALFGVYIRRGLPPSHAQ YDFMERLDGKEKWSVVESPRERRSIQTLVQ

NEAVFVQYLDVGLWHLAFYNDGKDKEMVSFNTVVLD DSVQDCPRNCHGNGECVSGLCHCFPGFLGADCAKA AACPVLCSGNGQYSKGTCQCYSGWKGA

ECDVPMNQCIDPSCGGHGSCIDGNCVCAAGYKGEHCEEV VDCLDPTCSSHGVCVNGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDSGLCSCDPNW

MGPDCSVE EVCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCTID DGCPDLCNGNGRCTLGQNSWQCVCQTG

WRGPGCNVAMETSCADNKDNEGD DGLVDCLDPDCCLQSACQNSLLCRGSRDPLDIIQQGQTDWPAVKSFYDRIKLLAGKDSTHIIPGDNPFNSS SLVS

LIRGQVVTMDGTPLVGVNVSFVKYPKYGYTITRQDGT TFDLIANGGSALTLHFERAPFMSQERTVWLPWNSFYAMDTLVMKTEENSIPSCDLSGFVRPD

PIIISSPLSTFFSASPASNPIVPETQ VLHEEIELPGTNVKLRYLSSRTAGYKSLLKITMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWD

KTDAYGQRVYGLSDAVV VSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHTLNVKSG GILHKGTGENQFLTQQPAIITSIMGNGRRRSI

SCPSCNGLAEGNKLLAPVALAVGIDGSLFVGDFNYIRRIFPSRNVTSILELR RNKEFKHS - UNI32602 - SNSPGHKYYLAVDPVTGSLYVSDTN

SRRIYRVKSLSGAKDLAGNSEVVAGTGEQCLPFDEARCGDGGKAVDATLMSPRG - UNI32602 - GIAVDKNGLMYFVDATMIRKVDQNGIISTLLG

SNDLTAVRPLSCDSSMDVAQ - UNI32602 - VRLEWPTDLAVNPMDNSLYVLENNVILRITENHQVSIIAGRPMHCQVPGIDYSLSKLAIHSALESA

SAIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCICYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSKNKPVL

NAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTYSADNDVTELIDNNGNSLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKAVSTQNLEL

GLMTYDGNTGLLATKSDETGWTTFYD DYDHEGRLTNVTRPTGVVTSLHREMEKSITIDIENSNRDDDVTVITNLSSVEASYTVVQD DQVRNSYQLCNN

GTLRVMYANGMAVSFHSEPHVLAGTITPTIGRCNISLPMENGLNSIEWRLRKEQIKGKVTIFGRKLR VHGRNLLSIDYDRNIRTEKIYDDHRKFTLRII

YDQVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFADGKVWSYSYLDK SMVLLLQSQRQYIFEYDSSDRLHAVTMPSVAR

HSMSTHTSIGYIRNIYNPPESNASVIFDYSDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDETTGVLKMVNLQSGGFSCTIRYRKVGPL

VDKQIYRFSEEGMINARFDYTYHDNSFRIASIKPVISETPLPVDLYRYDEISGKVEHFGKFGVIYYDINQIITTAVMTLSKHFDTHGRIKEVQYEMFRSL

MYWMTVQYDSMGRVIKRELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSARLMPLRYDLRDRITRLGDVQYKIDDDGYLC

QRGSDIFEYNSKGLLTRAYNKASGWSVQYRYDGVGRRASYKTNLGHHLQYFYSDLHNPTRITHVYNHSNSEITSLYYDLQGHLFAMESSSGEEYYVASDN

TGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDVLAGRWTSPDYTMWRNVGKEPAPFNLYMFKNNNPLSNELD

LKNYVTD DVKSWLVMFGFQLSNIIPGFPRAKMYFVPPPYELSESQASENGQ LITGVQQTTERHNQAFLALEGQVITKKLHASIREKAGHWFATTTPII

GKGIMFAIKEGRVTTGVSSIASEDSRKVASVLNNAYYLDKMHYSIEGKDTHYFVKIGAADGDLVTLGTTIGRKVLESGVNVTVSQPTLLVNGRTRRFTNI

EFQYSTLLLSIRYGLTPDTLDEEKARVLDQARQRALGTAWAKEQQKARDGREGSRLWTEGEKQQLLSTGRVQGYEGYYVLPVEQYPELADSSSNIQFLRQ

NEMGKR
Transcript ENSMUST00000102801
Sequence
TCTATGTAGATGGTGTCAGGGAGCGAAGCTACTGACCGAGCTGCTG - UNI31944 - TTACACCTGCTCTTTATTGCTGAAACCCACCGGAACTTGC

TCTGCTTCTTGGGTTGGCCAGTGAGCACTCCCAGAAACGCAGCTGAGTTCTCCATCAGACATCCACCCACTTG - UNI31944 - GTGGGTGAGTGAC

AGGTGCCACAACTCCAGCCTCCCCTTTTCTAAAAGTCGCGGAGTTCTGTTTCATCTGGAATAATGGATGTAAAGGACCGGCGACATCGCTCTTTGACCAG

GGGACGGTGTGGCAAAGAGTGTCGCTACACCAGCTCCTCTCTGGACAGTGAGGACTGCCGTGTGCCCACTCAGAAGTCCTACAGTTCCAGCGAGACCTTG

AAGGCTTATGACCATGACAGCAGAATGCACTATGGAAACCGAGTCACAGACCTGGTGCACCGGGAGTCGGATGAGTTTTCTAGACAAG - UNI31944 

- - UNI35267 - GGACAAACTTCACCCTGGCAGAATTGGGAATCTGCGAGCCCTCCCCACACCGAAGTGGTTACTGTTCCGACATGGGTATCCTCCA

CCAGGGCTACTCCCTGAGCACTGGGTCTGATGCAGACTCGGACACCGAGGGAGGGATGTCTCCAGAACATGCCATCAGACTGTGGGGACGAGGGATAAAA

TCCAGGCGCAGCTCTGGCTTGTCCAGCCGCGAGAACTCGGCCCTTACTCTGACTGACTCTGACAATGAAAATAAATCGGATGACGACAATG - UNI352

67 - GTCGTCCCATTCCACCTACATCCTCGTCTAGCCTCCTCCCATCTGCTCAGCTGCCTAGCTCCCATAATCCTCCACCAGTTAGCTGCCAGATGCCA

TTGCTAGACAGCAACACCTCCCATCAGATCATGGACACCAACCCTGATGAGGAATTCTCCCCCAATTCATACCTGCTCAGAGCATGCTCAGGGCCCCAGC

AAGCCTCCAGCAGTG - UNI35267 - GCCCTCCAAACCACCACAGCCAGTCAACACTGAGGCCCCCTCTGCCACCCCCTCATAACCACACCCTGTCC

CACCACCACTCCTCGGCCAACTCCCTCAACAGGAACTCACTGACCAATCGGCGGAGTCAAATCCACGCCCCAGCTCCTGCGCCCAACGACCTGGCCACCA

CCCCAGAGTCTGTTCAGCTCCAGGATAGCTGGGTGCTGAACAGTAACGTCCCACTGGAGACTCG GCACTTCCTTTTCAAGACGTCGTCTGGAAGCACAC

CCCTGTTCAGCAGCTCTTCTCCGGGATACCCTTTGACCTCAGGGACCGTTTATACACCACCACCCCGCCTGCTGCCACGGAATACATTCTCCAGGAAGGC

CTTCAAGCTGAAGAAACCCTCCAAATACTGCAGTTGGAAATGCGCTGCCCTGTCTGCCATCGCCGCCGCCCTCCTCTTGGCCATTTTGCTGGCATATTTC

ATAG CAATGCATCTGCTCGGACTCAATTGGCAACTCCAGCCGGCAGATGGACACACCTTTAACAATGGCGTAAGGACCGGCTTACCAGGAAACGATGAT

GTGGCAACAGTGCCATCTGGAGGCAAAG TGCCCTGGTCATTGAAAAACAGCAGCATAGACAGTGGCGAAGCAGAAGTTGGTCGGCGGGTGACACAGGAA

GTCCCACCAGGGGTGTTTTGGAGGTCCCAGATTCACATCAGTCAGCCTCAATTCTTAAAGTTCAACATCTCCCTGGGCAAGGATGCCCTCTTCGGTGTCT

ATATAAGGAGAGGACTACCACCGTCTCATGCCCAG TATGACTTCATGGAACGCCTGGATGGAAAGGAGAAATGGAGCGTGGTCGAGTCGCCCAGGGAAC

GCCGGAGCATCCAGACTCTGGTGCAGAACGAGGCTGTGTTTGTGCAGTACTTGGATGTGGGCCTGTGGCACCTGGCCTTCTACAATGACGGCAAGGACAA

GGAGATGGTCTCCTTCAACACTGTTGTCTTAG ATTCAGTGCAGGACTGTCCACGGAACTGTCACGGGAACGGCGAATGCGTGTCTGGACTGTGTCACTG

TTTCCCAGGATTCCTAGGTGCAGACTGTGCTAAAG CTGCCTGCCCTGTACTGTGCAGCGGAAATGGACAGTATTCTAAAGGAACGTGCCAGTGCTACAG

CGGCTGGAAAGGTGCAGAGTGCGATGTGCCTATGAACCAATGTATCGATCCTTCCTGTGGGGGCCATGGCTCCTGCATTGATGGGAACTGCGTGTGTGCT

GCTGGCTACAAGGGCGAGCACTGTGAGGAAG TTGATTGCTTGGATCCTACCTGCTCCAGCCATGGTGTCTGTGTGAATGGAGAGTGTCTATGCAGCCCC

GGCTGGGGTGGTCTCAACTGTGAGCTGGCGAGGGTCCAGTGCCCAGACCAGTGTAGTGGGCATGGCACTTACCTCCCTGACTCCGGCCTCTGCAGCTGTG

ATCCGAACTGGATGGGTCCCGACTGCTCTGTTG TGTGCTCAGTAGACTGTGGCACTCACGGCGTCTGCATCGGGGGAGCCTGCCGCTGTGAAGAGGGCT

GGACAGGCGCAGCTTGTGACCAGCGCGTGTGCCACCCCCGCTGCATTGAGCACGGGACCTGTAAAGATGGCAAATGTGAATGCCGAGAGGGCTGGAATGG

TGAACACTGCACCATTG ATGGCTGCCCTGATTTGTGCAACGGTAACGGGAGATGCACACTGGGTCAGAACAGCTGGCAGTGTGTCTGCCAGACCGGCTG

GAGAGGGCCTGGATGCAACGTTGCCATGGAAACCTCCTGCGCTGATAACAAGGATAATGAGGGAG ATGGCCTGGTGGACTGCCTGGACCCTGACTGCTG

CCTACAGTCAGCCTGTCAGAACAGCCTGCTCTGCCGGGGGTCTCGGGACCCCTTGGACATCATTCAGCAAGGTCAGACAGACTGGCCTGCAGTGAAGTCC

TTCTATGACCGCATCAAGCTCTTGGCAGGCAAGGACAGCACCCACATCATTCCTGGAGACAACCCCTTCAATAGCAG CCTGGTGTCTCTGATCCGAGGC

CAAGTAGTAACCATGGATGGGACTCCCTTGGTGGGTGTGAATGTGTCTTTTGTCAAGTACCCAAAATATGGCTACACCATCACTCGCCAGGATGGCAC G

TTTGATCTGATTGCCAATGGGGGTTCTGCCTTGACTCTTCACTTTGAGCGAGCCCCTTTCATGAGCCAGGAGCGCACAGTGTGGCTGCCATGGAACAGCT

TCTATGCCATGGACACCCTGGTAATGAAGACCGAGGAAAACTCCATCCCCAGCTGTGACCTCAGTGGCTTTGTCCGGCCAGATCCAATCATCATCTCCTC

TCCTCTGTCTACCTTCTTCAGCGCTTCCCCTGCCTCGAACCCCATTGTGCCTGAGACCCAG GTTCTTCATGAAGAAATTGAGCTCCCTGGTACCAATGT

GAAGCTCCGTTATCTCAGCTCTAGAACTGCAGGGTACAAGTCGCTGCTGAAGATCACCATGACACAGTCCACAGTGCCCTTGAACCTCATCAGGGTTCAC

TTGATGGTTGCTGTAGAGGGGCATCTCTTCCAGAAGTCATTCCAGGCTTCTCCCAACCTAGCCTACACATTCATCTGGGACAAGACAGATGCTTATGGCC

AAAGGGTTTATGGCCTATCGGATGCTGTTG TGTCTGTTGGGTTTGAATATGAGACCTGCCCCAGTCTCATCCTGTGGGAGAAAAGGACAGCCCTGCTTC

AGGGATTCGAGCTGGACCCTTCCAACCTTGGAGGCTGGTCCCTGGACAAACACCACACCCTCAATGTGAAAAGCG GAATACTACACAAAGGGACAGGGG

AGAACCAGTTCCTGACCCAGCAGCCTGCCATCATCACGAGCATCATGGGCAACGGTCGCCGCAGAAGCATCTCCTGTCCCAGCTGTAATGGCCTTGCTGA

AGGCAACAAACTGTTAGCCCCTGTGGCCCTGGCTGTGGGGATCGATGGGAGCCTCTTTGTTGGTGACTTCAACTATATCCGGCGCATCTTTCCCTCTCGA

AATGTGACCAGTATCTTGGAGTTACG AAATAAAGAGTTTAAACATAG - UNI32602 - CAACAGCCCAGGACACAAGTATTACTTGGCTGTGGACC

CCGTGACCGGCTCACTCTACGTCTCTGACACCAACAGTCGCCGAATCTACCGAGTCAAGTCTCTGAGCGGAGCCAAAGACCTGGCTGGAAATTCGGAAGT

TGTGGCAGGGACTGGCGAACAATGTCTACCCTTTGATGAAGCCCGCTGTGGGGATGGAGGGAAGGCTGTGGACGCCACCCTCATGAGCCCCAGAG - UN

I32602 - GTATTGCAGTAGACAAGAATGGGCTTATGTACTTTGTTGATGCCACCATGATCCGGAAGGTGGACCAAAACGGAATCATCTCCACCCTGCT

GGGCTCCAATGACCTCACAGCTGTCCGACCACTGAGCTGTGACTCGAGCATGGACGTGGCCCAG - UNI32602 - GTCCGTCTAGAATGGCCGACAG

ACCTCGCCGTCAACCCCATGGACAACTCCCTGTACGTTCTGGAGAACAACGTCATCCTGCGGATCACGGAGAACCACCAGGTCAGCATCATCGCGGGACG

GCCTATGCACTGCCAGGTTCCCGGCATCGACTACTCGCTCAGCAAACTCGCCATCCATTCTGCGCTGGAATCAGCCAGCGCCATTGCTATTTCTCACACT

GGGGTGCTCTACATCACTGAGACGGACGAGAAGAAGATCAACCGCCTACGCCAAGTCACCACCAATGGAGAGATCTGCCTCTTAGCCGGGGCGGCCTCAG

ACTGTGACTGCAAAAACGATGTCAACTGCATCTGCTACTCGGGAGATGACGCTTACGCCACGGACGCCATCCTAAACTCGCCGTCCTCCTTAGCCGTGGC

TCCAGATGGCACCATCTACATTGCAGACCTTGGGAATATCCGGATCAGGGCGGTCAGCAAAAATAAACCCGTTCTTAACGCATTCAACCAGTATGAGGCT

GCATCTCCGGGAGAACAGGAATTGTACGTGTTCAACGCTGATGGTATCCATCAGTACACTGTGAGTCTGGTGACTGGGGAGTACTTGTACAATTTCACAT

ACAGCGCTGACAATGACGTCACCGAGTTGATTGACAACAACGGGAATTCCCTAAAGATCCGCCGGGACAGCAGTGGCATGCCCCGCCACCTGCTCATGCC

TGATAATCAGATTATCACCCTTACCGTGGGCACCAATGGAGGCCTCAAAGCCGTGTCCACTCAGAACCTGGAGCTGGGCCTCATGACTTATGATGGGAAC

ACTGGACTCCTAGCCACCAAGAGTGATGAAACTGGATGGACAACTTTTTATGA CTATGACCACGAGGGCCGTCTGACCAATGTGACCCGCCCCACGGGC

GTAGTGACCAGTCTGCACCGGGAAATGGAGAAATCTATCACCATTGACATTGAGAACTCCAACCGGGATGATGACGTCACTGTGATCACCAACCTCTCCT

CCGTGGAGGCCTCCTATACAGTGGTACAAG ATCAAGTGCGAAACAGCTACCAGCTCTGCAATAATGGAACCCTGCGGGTGATGTACGCCAACGGCATGG

CTGTCAGCTTCCACAGTGAGCCCCACGTCCTCGCAGGCACCATCACCCCCACCATTGGGCGCTGCAACATCTCTCTGCCCATGGAGAATGGCCTGAACTC

CATCGAGTGGCGCCTGAGGAAGGAACAGATCAAAGGCAAAGTCACCATCTTTGGGAGGAAGCTTCGG GTCCACGGAAGGAATCTCCTGTCCATTGATTA

TGACCGAAATATCCGAACGGAGAAGATCTACGATGACCACCGGAAATTCACCCTGAGGATCATCTATGACCAGGTGGGCCGCCCCTTCCTGTGGCTCCCG

AGCAGTGGGCTGGCAGCCGTCAATGTCTCCTACTTCTTCAATGGGCGCTTGGCCGGCCTCCAGCGAGGGGCCATGAGCGAGAGGACAGACATTGACAAGC

AAGGCCGGATCGTGTCCCGCATGTTCGCCGACGGGAAAGTCTGGAGCTATTCCTATCTTGACAAG TCCATGGTCCTTCTGCTACAGAGCCAACGTCAGT

ACATATTTGAATATGACTCCTCCGATCGCCTCCACGCAGTCACTATGCCCAGTGTCGCCCGGCACAGCATGTCCACGCACACCTCCATTGGTTACATCCG

AAACATTTACAACCCACCCGAAAGCAATGCATCAGTCATCTTTGACTACAGTGATGACGGCCGCATCCTAAAGACATCTTTCTTGGGCACTGGGCGCCAG

GTGTTCTACAAGTATGGAAAACTCTCCAAGTTATCAGAGATAGTCTACGACAGCACAGCCGTCACCTTTGGGTATGACGAGACCACCGGTGTCCTGAAGA

TGGTCAATCTCCAAAGTGGGGGTTTCTCCTGTACCATCAGGTACCGAAAGGTTGGGCCCCTTGTGGACAAGCAGATTTACAGGTTCTCTGAGGAAGGAAT

GATCAACGCCAGGTTTGATTATACCTATCACGACAATAGCTTCCGCATTGCCAGCATCAAACCCGTCATTAGCGAGACTCCCCTTCCTGTTGACCTCTAC

CGCTATGATGAGATTTCCGGCAAGGTGGAACACTTCGGCAAGTTTGGGGTCATCTACTACGACATCAACCAGATCATCACCACTGCCGTCATGACGCTTA

GCAAGCACTTTGACACCCATGGGCGCATCAAGGAAGTGCAATATGAGATGTTCCGGTCCCTCATGTACTGGATGACTGTGCAATATGACAGTATGGGTAG

GGTCATCAAGAGGGAACTGAAACTAGGGCCCTATGCCAACACCACAAAGTACACCTATGACTATGACGGGGACGGCCAGCTCCAGAGTGTGGCCGTCAAT

GACCGGCCTACCTGGCGCTATAGCTATGACCTCAATGGGAACCTGCACCTTCTAAACCCAGGAAACAGTGCTCGCCTCATGCCCTTACGCTATGACCTCC

GTGACCGGATAACCAGGCTAGGGGACGTGCAGTACAAAATCGATGACGATGGCTATTTGTGCCAGAGAGGGTCAGACATCTTTGAATACAACTCCAAGGG

CCTTCTGACAAGAGCATACAACAAGGCCAGCGGATGGAGCGTGCAGTACCGCTATGACGGAGTGGGCCGCCGGGCTTCCTACAAGACCAACCTGGGCCAC

CACCTACAGTACTTCTACTCCGACCTCCACAACCCCACACGTATCACCCATGTTTACAACCACTCCAACTCTGAGATCACCTCGCTCTACTATGACCTCC

AGGGCCACCTATTTGCCATGGAGAGCAGTAGTGGTGAAGAATACTATGTCGCCTCAGACAACACGGGGACCCCTCTGGCTGTGTTCAGTATCAATGGCCT

CATGATCAAGCAACTGCAGTACACAGCCTATGGGGAGATCTACTATGACTCCAATCCAGACTTCCAGATGGTCATTGGCTTCCACGGAGGCCTCTATGAC

CCCCTCACCAAGCTCGTCCACTTTACTCAACGTGATTATGACGTGCTGGCAGGACGGTGGACGTCCCCCGACTACACCATGTGGAGGAACGTGGGCAAGG

AGCCAGCCCCCTTCAACCTGTACATGTTCAAGAACAACAATCCTCTGAGCAATGAGCTGGACTTAAAGAACTACGTGACAG ACGTGAAGAGCTGGCTTG

TGATGTTTGGATTTCAGCTCAGCAACATCATTCCTGGATTCCCGAGAGCCAAAATGTATTTTGTGCCTCCCCCCTATGAACTGTCAGAGAGTCAAGCAAG

CGAGAACGGACAG CTCATTACAGGTGTCCAGCAGACAACTGAGAGGCATAACCAGGCCTTCCTGGCTCTGGAAGGACAGGTCATCACTAAAAAGCTCCA

TGCCAGCATCCGAGAGAAAGCAGGCCACTGGTTTGCTACCACCACACCCATCATCGGCAAAGGCATCATGTTTGCCATCAAAGAAGGGCGGGTGACCACA

GGAGTGTCTAGCATCGCCAGTGAGGACAGCCGCAAGGTAGCATCCGTGTTGAACAATGCCTACTACTTAGACAAGATGCACTACAGCATCGAGGGCAAGG

ACACACACTACTTTGTGAAGATCGGCGCCGCGGATGGTGACCTGGTCACGCTAGGAACCACCATTGGGCGCAAGGTGCTGGAGAGTGGGGTGAACGTGAC

GGTGTCACAGCCCACGCTGCTGGTGAATGGCAGGACTCGAAGGTTCACCAACATTGAGTTCCAGTACTCCACGCTGCTGCTCAGTATCCGCTACGGCCTC

ACCCCCGACACGCTGGACGAAGAAAAGGCCCGCGTCCTGGACCAAGCGAGACAGAGAGCCCTGGGTACTGCCTGGGCCAAGGAGCAGCAGAAAGCCAGGG

ACGGGAGAGAGGGCAGCCGCCTGTGGACGGAGGGCGAGAAGCAGCAACTCCTGAGCACGGGACGGGTACAAGGTTATGAGGGCTATTACGTACTTCCGGT

GGAACAGTACCCGGAGCTGGCAGACAGTAGCAGCAACATCCAGTTCTTAAGACAGAATGAGATGGGAAAGAGGTAACAAAATAACCTGCTGCCACCTCTT

CTCTGGGTGGCTCAGCAGGAGCAACTGTGACCTCCTCTCCTAAGGAGACGAAGACCTAACGGGGCACTGAGGCCGGGCTGCTTTAGGATCCCAAGTGGCA

AGAAAGCTCACATTTTTTGAGTTCAAATGCTACTGTCTAAGCGCAAAGTCCCTCATCCTGAAGTAGACTAGAGCCCGGCCACAAATTCTGAGGAAAAACA

AAAACTAAAGGATGAACGAACGAACGAACGAATGAAAACACACACAAAATGTTTCAAGTTCCCCTAAAATATGACCCACTTGTTCCGGGTCTAAGGCAGA

AAAGAGACGCAGAATAGCCAAAAGGAAAGGAACAGAAAAGAAACAAATTAAAAAAAAAAAAAAGCAAACAAAAAGACAAAGACACCGACCATACAAACGA

AGAAATGAAGACGAGAAGGCCTCATATTCTAATACCTCACTCATTGACACGTGAGCAACACAAAGACATTCACAAGGGCCGGCATCACCAGACCAGCTGA

GGACAACTCAGACTGACAGTTGGACAAACATTGCGACGTTTTCGTTTAAGCAAATACAGGTGCATTTAAAAAACACGACTTTGGGGGTGATTTGTGTGTA

GCGCCTGGGGAGGGAGGGGGCACAAAAGCGGAGGATCGAGCACTGGAAATACTTTTTAAAGAAAAAGAAAAACACAAGAAAAAAATCAGTATCAGAAGTC

AAAGCGAAACAATACCGTCTGGCACTTAACTCTCAGGTCCCCCACTTAGTCAGGCCTGAGCTAATTTATTTGAGCGCAGAGTGTAAAATTTTAATTCAAA

ATGGTGGCTATACTCACTACACATAAATCTCATAATCTTTTTGTCTTTGGAGATTCCATTGTGGACAGTAATACGCAGTTACAGGGTGTAGTCTGTTTAG

AATCCGTAGTTTGTGGGTATCAGTTGCGGTAGAGATGCAACATTTGTGACTCTGTTGCTAACGGTTACCACTTCCGATCGCCCTGTACATACATATGCCG

TAAGGCGCAATCACTGTTTCAGACTTAAAATTATTAGTGTGTTTGTTTGGTCCAGAAACTGAGACAATCACATGACAGTCACCACGAGGAGAGAAAAATA

AAAAAATAAATAAATAAATAAAAACAAAAAAAAATTTTAAAAAGTGAAGAAAAAAAACACACAAAAAAAAAGTCTAATAAGAACTTTGGTACAGGAACTT

TTTTGTAATATACATGTATGAATTGTTCATCGAGTTTTTATATTAATTTTAATTTGCTGCTAAGCAAAGACTAGGGACAGGCAAAGATAATTTATGGCAA

AGTGTTTAAATTGTTTATACATAAATAAAGTCTCTAAAACTCCTGTGGACACTGA
Translation
 - UNI31944 -  - UNI31944 - MDVKDRRHRSLTRGRCGKECRYTSSSLDSEDCRVPTQKSYSSSETLKAYDHDSRMHYGNRVTDLVHRESDEF

SRQG - UNI31944 - - UNI35267 - GTNFTLAELGICEPSPHRSGYCSDMGILHQGYSLSTGSDADSDTEGGMSPEHAIRLWGRGIKSRRSSGL

SSRENSALTLTDSDNENKSDDDNG - UNI35267 - GRPIPPTSSSSLLPSAQLPSSHNPPPVSCQMPLLDSNTSHQIMDTNPDEEFSPNSYLLRACS

GPQQASSSG - UNI35267 - GPPNHHSQSTLRPPLPPPHNHTLSHHHSSANSLNRNSLTNRRSQIHAPAPAPNDLATTPESVQLQDSWVLNSNVPLE

TR RHFLFKTSSGSTPLFSSSSPGYPLTSGTVYTPPPRLLPRNTFSRKAFKLKKPSKYCSWKCAALSAIAAALLLAILLAYFIA AMHLLGLNWQLQPAD

GHTFNNGVRTGLPGNDDVATVPSGGKV VPWSLKNSSIDSGEAEVGRRVTQEVPPGVFWRSQIHISQPQFLKFNISLGKDALFGVYIRRGLPPSHAQ YD

FMERLDGKEKWSVVESPRERRSIQTLVQNEAVFVQYLDVGLWHLAFYNDGKDKEMVSFNTVVLD DSVQDCPRNCHGNGECVSGLCHCFPGFLGADCAKA

 AACPVLCSGNGQYSKGTCQCYSGWKGAECDVPMNQCIDPSCGGHGSCIDGNCVCAAGYKGEHCEEV VDCLDPTCSSHGVCVNGECLCSPGWGGLNCEL

ARVQCPDQCSGHGTYLPDSGLCSCDPNWMGPDCSVV VCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCTID 

DGCPDLCNGNGRCTLGQNSWQCVCQTGWRGPGCNVAMETSCADNKDNEGD DGLVDCLDPDCCLQSACQNSLLCRGSRDPLDIIQQGQTDWPAVKSFYDR

IKLLAGKDSTHIIPGDNPFNSS SLVSLIRGQVVTMDGTPLVGVNVSFVKYPKYGYTITRQDGT TFDLIANGGSALTLHFERAPFMSQERTVWLPWNSF

YAMDTLVMKTEENSIPSCDLSGFVRPDPIIISSPLSTFFSASPASNPIVPETQ VLHEEIELPGTNVKLRYLSSRTAGYKSLLKITMTQSTVPLNLIRVH

LMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVV VSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHTLNVKSG GILHK

GTGENQFLTQQPAIITSIMGNGRRRSISCPSCNGLAEGNKLLAPVALAVGIDGSLFVGDFNYIRRIFPSRNVTSILELR RNKEFKHS - UNI32602 

- SNSPGHKYYLAVDPVTGSLYVSDTNSRRIYRVKSLSGAKDLAGNSEVVAGTGEQCLPFDEARCGDGGKAVDATLMSPRG - UNI32602 - GIAVD

KNGLMYFVDATMIRKVDQNGIISTLLGSNDLTAVRPLSCDSSMDVAQ - UNI32602 - VRLEWPTDLAVNPMDNSLYVLENNVILRITENHQVSIIA

GRPMHCQVPGIDYSLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCICYSGDDAYATDAILNSPSSLA

VAPDGTIYIADLGNIRIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTYSADNDVTELIDNNGNSLKIRRDSSGMPRHLL

MPDNQIITLTVGTNGGLKAVSTQNLELGLMTYDGNTGLLATKSDETGWTTFYD DYDHEGRLTNVTRPTGVVTSLHREMEKSITIDIENSNRDDDVTVIT

NLSSVEASYTVVQD DQVRNSYQLCNNGTLRVMYANGMAVSFHSEPHVLAGTITPTIGRCNISLPMENGLNSIEWRLRKEQIKGKVTIFGRKLR VHGRN

LLSIDYDRNIRTEKIYDDHRKFTLRIIYDQVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFADGKVWSYSYLDK SMVLL

LQSQRQYIFEYDSSDRLHAVTMPSVARHSMSTHTSIGYIRNIYNPPESNASVIFDYSDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDE

TTGVLKMVNLQSGGFSCTIRYRKVGPLVDKQIYRFSEEGMINARFDYTYHDNSFRIASIKPVISETPLPVDLYRYDEISGKVEHFGKFGVIYYDINQIIT

TAVMTLSKHFDTHGRIKEVQYEMFRSLMYWMTVQYDSMGRVIKRELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSARLM

PLRYDLRDRITRLGDVQYKIDDDGYLCQRGSDIFEYNSKGLLTRAYNKASGWSVQYRYDGVGRRASYKTNLGHHLQYFYSDLHNPTRITHVYNHSNSEIT

SLYYDLQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDVLAGRWTSPDYTM

WRNVGKEPAPFNLYMFKNNNPLSNELDLKNYVTD DVKSWLVMFGFQLSNIIPGFPRAKMYFVPPPYELSESQASENGQ LITGVQQTTERHNQAFLALE

GQVITKKLHASIREKAGHWFATTTPIIGKGIMFAIKEGRVTTGVSSIASEDSRKVASVLNNAYYLDKMHYSIEGKDTHYFVKIGAADGDLVTLGTTIGRK

VLESGVNVTVSQPTLLVNGRTRRFTNIEFQYSTLLLSIRYGLTPDTLDEEKARVLDQARQRALGTAWAKEQQKARDGREGSRLWTEGEKQQLLSTGRVQG

YEGYYVLPVEQYPELADSSSNIQFLRQNEMGKR
Transcript ENSMUST00000109310
Sequence
ATGGATGTAAAGGACCGGCGACATCGCTCTTTGACCAGGGGACGGTGTGGCAAAGAGTGTCGCTACACCAGCTCCTCTCTGGACAGTGAGGACTGCCGTG

TGCCCACTCAGAAGTCCTACAGTTCCAGCGAGACCTTGAAGGCTTATGACCATGACAGCAGAATGCACTATGGAAACCGAGTCACAGACCTGGTGCACCG

GGAGTCGGATGAGTTTTCTAGACAAG - UNI31944 - - UNI35267 - GGACAAACTTCACCCTGGCAGAATTGGGAATCTGCGAGCCCTCCCCA

CACCGAAGTGGTTACTGTTCCGACATGGGTATCCTCCACCAGGGCTACTCCCTGAGCACTGGGTCTGATGCAGACTCGGACACCGAGGGAGGGATGTCTC

CAGAACATGCCATCAGACTGTGGGGACGAGGGATAAAATCCAGGCGCAGCTCTGGCTTGTCCAGCCGCGAGAACTCGGCCCTTACTCTGACTGACTCTGA

CAATGAAAATAAATCGGATGACGACAATG - UNI35267 - GTCGTCCCATTCCACCTACATCCTCGTCTAGCCTCCTCCCATCTGCTCAGCTGCCTA

GCTCCCATAATCCTCCACCAGTTAGCTGCCAGATGCCATTGCTAGACAGCAACACCTCCCATCAGATCATGGACACCAACCCTGATGAGGAATTCTCCCC

CAATTCATACCTGCTCAGAGCATGCTCAGGGCCCCAGCAAGCCTCCAGCAGTG - UNI35267 - GCCCTCCAAACCACCACAGCCAGTCAACACTGA

GGCCCCCTCTGCCACCCCCTCATAACCACACCCTGTCCCACCACCACTCCTCGGCCAACTCCCTCAACAGGAACTCACTGACCAATCGGCGGAGTCAAAT

CCACGCCCCAGCTCCTGCGCCCAACGACCTGGCCACCACCCCAGAGTCTGTTCAGCTCCAGGATAGCTGGGTGCTGAACAGTAACGTCCCACTGGAGACT

CG GCACTTCCTTTTCAAGACGTCGTCTGGAAGCACACCCCTGTTCAGCAGCTCTTCTCCGGGATACCCTTTGACCTCAGGGACCGTTTATACACCACCA

CCCCGCCTGCTGCCACGGAATACATTCTCCAGGAAGGCCTTCAAGCTGAAGAAACCCTCCAAATACTGCAGTTGGAAATGCGCTGCCCTGTCTGCCATCG

CCGCCGCCCTCCTCTTGGCCATTTTGCTGGCATATTTCATAG CAATGCATCTGCTCGGACTCAATTGGCAACTCCAGCCGGCAGATGGACACACCTTTA

ACAATGGCGTAAGGACCGGCTTACCAGGAAACGATGATGTGGCAACAGTGCCATCTGGAGGCAAAG TGCCCTGGTCATTGAAAAACAGCAGCATAGACA

GTGGCGAAGCAGAAGTTGGTCGGCGGGTGACACAGGAAGTCCCACCAGGGGTGTTTTGGAGGTCCCAGATTCACATCAGTCAGCCTCAATTCTTAAAGTT

CAACATCTCCCTGGGCAAGGATGCCCTCTTCGGTGTCTATATAAGGAGAGGACTACCACCGTCTCATGCCCAG TATGACTTCATGGAACGCCTGGATGG

AAAGGAGAAATGGAGCGTGGTCGAGTCGCCCAGGGAACGCCGGAGCATCCAGACTCTGGTGCAGAACGAGGCTGTGTTTGTGCAGTACTTGGATGTGGGC

CTGTGGCACCTGGCCTTCTACAATGACGGCAAGGACAAGGAGATGGTCTCCTTCAACACTGTTGTCTTAG ATTCAGTGCAGGACTGTCCACGGAACTGT

CACGGGAACGGCGAATGCGTGTCTGGACTGTGTCACTGTTTCCCAGGATTCCTAGGTGCAGACTGTGCTAAAG CTGCCTGCCCTGTACTGTGCAGCGGA

AATGGACAGTATTCTAAAGGAACGTGCCAGTGCTACAGCGGCTGGAAAGGTGCAGAGTGCGATGTGCCTATGAACCAATGTATCGATCCTTCCTGTGGGG

GCCATGGCTCCTGCATTGATGGGAACTGCGTGTGTGCTGCTGGCTACAAGGGCGAGCACTGTGAGGAAG TTGATTGCTTGGATCCTACCTGCTCCAGCC

ATGGTGTCTGTGTGAATGGAGAGTGTCTATGCAGCCCCGGCTGGGGTGGTCTCAACTGTGAGCTGGCGAGGGTCCAGTGCCCAGACCAGTGTAGTGGGCA

TGGCACTTACCTCCCTGACTCCGGCCTCTGCAGCTGTGATCCGAACTGGATGGGTCCCGACTGCTCTGTTG TGTGCTCAGTAGACTGTGGCACTCACGG

CGTCTGCATCGGGGGAGCCTGCCGCTGTGAAGAGGGCTGGACAGGCGCAGCTTGTGACCAGCGCGTGTGCCACCCCCGCTGCATTGAGCACGGGACCTGT

AAAGATGGCAAATGTGAATGCCGAGAGGGCTGGAATGGTGAACACTGCACCATTG ATGGCTGCCCTGATTTGTGCAACGGTAACGGGAGATGCACACTG

GGTCAGAACAGCTGGCAGTGTGTCTGCCAGACCGGCTGGAGAGGGCCTGGATGCAACGTTGCCATGGAAACCTCCTGCGCTGATAACAAGGATAATGAGG

GAG ATGGCCTGGTGGACTGCCTGGACCCTGACTGCTGCCTACAGTCAGCCTGTCAGAACAGCCTGCTCTGCCGGGGGTCTCGGGACCCCTTGGACATCA

TTCAGCAAGGTCAGACAGACTGGCCTGCAGTGAAGTCCTTCTATGACCGCATCAAGCTCTTGGCAGGCAAGGACAGCACCCACATCATTCCTGGAGACAA

CCCCTTCAATAGCAG CCTGGTGTCTCTGATCCGAGGCCAAGTAGTAACCATGGATGGGACTCCCTTGGTGGGTGTGAATGTGTCTTTTGTCAAGTACCC

AAAATATGGCTACACCATCACTCGCCAGGATGGCAC GTTTGATCTGATTGCCAATGGGGGTTCTGCCTTGACTCTTCACTTTGAGCGAGCCCCTTTCAT

GAGCCAGGAGCGCACAGTGTGGCTGCCATGGAACAGCTTCTATGCCATGGACACCCTGGTAATGAAGACCGAGGAAAACTCCATCCCCAGCTGTGACCTC

AGTGGCTTTGTCCGGCCAGATCCAATCATCATCTCCTCTCCTCTGTCTACCTTCTTCAGCGCTTCCCCTGCCTCGAACCCCATTGTGCCTGAGACCCAG 

GTTCTTCATGAAGAAATTGAGCTCCCTGGTACCAATGTGAAGCTCCGTTATCTCAGCTCTAGAACTGCAGGGTACAAGTCGCTGCTGAAGATCACCATGA

CACAGTCCACAGTGCCCTTGAACCTCATCAGGGTTCACTTGATGGTTGCTGTAGAGGGGCATCTCTTCCAGAAGTCATTCCAGGCTTCTCCCAACCTAGC

CTACACATTCATCTGGGACAAGACAGATGCTTATGGCCAAAGGGTTTATGGCCTATCGGATGCTGTTG TGTCTGTTGGGTTTGAATATGAGACCTGCCC

CAGTCTCATCCTGTGGGAGAAAAGGACAGCCCTGCTTCAGGGATTCGAGCTGGACCCTTCCAACCTTGGAGGCTGGTCCCTGGACAAACACCACACCCTC

AATGTGAAAAGCG GAATACTACACAAAGGGACAGGGGAGAACCAGTTCCTGACCCAGCAGCCTGCCATCATCACGAGCATCATGGGCAACGGTCGCCGC

AGAAGCATCTCCTGTCCCAGCTGTAATGGCCTTGCTGAAGGCAACAAACTGTTAGCCCCTGTGGCCCTGGCTGTGGGGATCGATGGGAGCCTCTTTGTTG

GTGACTTCAACTATATCCGGCGCATCTTTCCCTCTCGAAATGTGACCAGTATCTTGGAGTTACG AAATAAAGAGTTTAAACATAG - UNI32602 - 

CAACAGCCCAGGACACAAGTATTACTTGGCTGTGGACCCCGTGACCGGCTCACTCTACGTCTCTGACACCAACAGTCGCCGAATCTACCGAGTCAAGTCT

CTGAGCGGAGCCAAAGACCTGGCTGGAAATTCGGAAGTTGTGGCAGGGACTGGCGAACAATGTCTACCCTTTGATGAAGCCCGCTGTGGGGATGGAGGGA

AGGCTGTGGACGCCACCCTCATGAGCCCCAGAG - UNI32602 - GTATTGCAGTAGACAAGAATGGGCTTATGTACTTTGTTGATGCCACCATGATC

CGGAAGGTGGACCAAAACGGAATCATCTCCACCCTGCTGGGCTCCAATGACCTCACAGCTGTCCGACCACTGAGCTGTGACTCGAGCATGGACGTGGCCC

AG - UNI32602 - GTCCGTCTAGAATGGCCGACAGACCTCGCCGTCAACCCCATGGACAACTCCCTGTACGTTCTGGAGAACAACGTCATCCTGCGG

ATCACGGAGAACCACCAGGTCAGCATCATCGCGGGACGGCCTATGCACTGCCAGGTTCCCGGCATCGACTACTCGCTCAGCAAACTCGCCATCCATTCTG

CGCTGGAATCAGCCAGCGCCATTGCTATTTCTCACACTGGGGTGCTCTACATCACTGAGACGGACGAGAAGAAGATCAACCGCCTACGCCAAGTCACCAC

CAATGGAGAGATCTGCCTCTTAGCCGGGGCGGCCTCAGACTGTGACTGCAAAAACGATGTCAACTGCATCTGCTACTCGGGAGATGACGCTTACGCCACG

GACGCCATCCTAAACTCGCCGTCCTCCTTAGCCGTGGCTCCAGATGGCACCATCTACATTGCAGACCTTGGGAATATCCGGATCAGGGCGGTCAGCAAAA

ATAAACCCGTTCTTAACGCATTCAACCAGTATGAGGCTGCATCTCCGGGAGAACAGGAATTGTACGTGTTCAACGCTGATGGTATCCATCAGTACACTGT

GAGTCTGGTGACTGGGGAGTACTTGTACAATTTCACATACAGCGCTGACAATGACGTCACCGAGTTGATTGACAACAACGGGAATTCCCTAAAGATCCGC

CGGGACAGCAGTGGCATGCCCCGCCACCTGCTCATGCCTGATAATCAGATTATCACCCTTACCGTGGGCACCAATGGAGGCCTCAAAGCCGTGTCCACTC

AGAACCTGGAGCTGGGCCTCATGACTTATGATGGGAACACTGGACTCCTAGCCACCAAGAGTGATGAAACTGGATGGACAACTTTTTATGA CTATGACC

ACGAGGGCCGTCTGACCAATGTGACCCGCCCCACGGGCGTAGTGACCAGTCTGCACCGGGAAATGGAGAAATCTATCACCATTGACATTGAGAACTCCAA

CCGGGATGATGACGTCACTGTGATCACCAACCTCTCCTCCGTGGAGGCCTCCTATACAGTGGTACAAG ATCAAGTGCGAAACAGCTACCAGCTCTGCAA

TAATGGAACCCTGCGGGTGATGTACGCCAACGGCATGGCTGTCAGCTTCCACAGTGAGCCCCACGTCCTCGCAGGCACCATCACCCCCACCATTGGGCGC

TGCAACATCTCTCTGCCCATGGAGAATGGCCTGAACTCCATCGAGTGGCGCCTGAGGAAGGAACAGATCAAAGGCAAAGTCACCATCTTTGGGAGGAAGC

TTCGG GTCCACGGAAGGAATCTCCTGTCCATTGATTATGACCGAAATATCCGAACGGAGAAGATCTACGATGACCACCGGAAATTCACCCTGAGGATCA

TCTATGACCAGGTGGGCCGCCCCTTCCTGTGGCTCCCGAGCAGTGGGCTGGCAGCCGTCAATGTCTCCTACTTCTTCAATGGGCGCTTGGCCGGCCTCCA

GCGAGGGGCCATGAGCGAGAGGACAGACATTGACAAGCAAGGCCGGATCGTGTCCCGCATGTTCGCCGACGGGAAAGTCTGGAGCTATTCCTATCTTGAC

AAG TCCATGGTCCTTCTGCTACAGAGCCAACGTCAGTACATATTTGAATATGACTCCTCCGATCGCCTCCACGCAGTCACTATGCCCAGTGTCGCCCGG

CACAGCATGTCCACGCACACCTCCATTGGTTACATCCGAAACATTTACAACCCACCCGAAAGCAATGCATCAGTCATCTTTGACTACAGTGATGACGGCC

GCATCCTAAAGACATCTTTCTTGGGCACTGGGCGCCAGGTGTTCTACAAGTATGGAAAACTCTCCAAGTTATCAGAGATAGTCTACGACAGCACAGCCGT

CACCTTTGGGTATGACGAGACCACCGGTGTCCTGAAGATGGTCAATCTCCAAAGTGGGGGTTTCTCCTGTACCATCAGGTACCGAAAGGTTGGGCCCCTT

GTGGACAAGCAGATTTACAGGTTCTCTGAGGAAGGAATGATCAACGCCAGGTTTGATTATACCTATCACGACAATAGCTTCCGCATTGCCAGCATCAAAC

CCGTCATTAGCGAGACTCCCCTTCCTGTTGACCTCTACCGCTATGATGAGATTTCCGGCAAGGTGGAACACTTCGGCAAGTTTGGGGTCATCTACTACGA

CATCAACCAGATCATCACCACTGCCGTCATGACGCTTAGCAAGCACTTTGACACCCATGGGCGCATCAAGGAAGTGCAATATGAGATGTTCCGGTCCCTC

ATGTACTGGATGACTGTGCAATATGACAGTATGGGTAGGGTCATCAAGAGGGAACTGAAACTAGGGCCCTATGCCAACACCACAAAGTACACCTATGACT

ATGACGGGGACGGCCAGCTCCAGAGTGTGGCCGTCAATGACCGGCCTACCTGGCGCTATAGCTATGACCTCAATGGGAACCTGCACCTTCTAAACCCAGG

AAACAGTGCTCGCCTCATGCCCTTACGCTATGACCTCCGTGACCGGATAACCAGGCTAGGGGACGTGCAGTACAAAATCGATGACGATGGCTATTTGTGC

CAGAGAGGGTCAGACATCTTTGAATACAACTCCAAGGGCCTTCTGACAAGAGCATACAACAAGGCCAGCGGATGGAGCGTGCAGTACCGCTATGACGGAG

TGGGCCGCCGGGCTTCCTACAAGACCAACCTGGGCCACCACCTACAGTACTTCTACTCCGACCTCCACAACCCCACACGTATCACCCATGTTTACAACCA

CTCCAACTCTGAGATCACCTCGCTCTACTATGACCTCCAGGGCCACCTATTTGCCATGGAGAGCAGTAGTGGTGAAGAATACTATGTCGCCTCAGACAAC

ACGGGGACCCCTCTGGCTGTGTTCAGTATCAATGGCCTCATGATCAAGCAACTGCAGTACACAGCCTATGGGGAGATCTACTATGACTCCAATCCAGACT

TCCAGATGGTCATTGGCTTCCACGGAGGCCTCTATGACCCCCTCACCAAGCTCGTCCACTTTACTCAACGTGATTATGACGTGCTGGCAGGACGGTGGAC

GTCCCCCGACTACACCATGTGGAGGAACGTGGGCAAGGAGCCAGCCCCCTTCAACCTGTACATGTTCAAGAACAACAATCCTCTGAGCAATGAGCTGGAC

TTAAAGAACTACGTGACAG ACGTGAAGAGCTGGCTTGTGATGTTTGGATTTCAGCTCAGCAACATCATTCCTGGATTCCCGAGAGCCAAAATGTATTTT

GTGCCTCCCCCCTATGAACTGTCAGAGAGTCAAGCAAGCGAGAACGGACAG CTCATTACAGGTGTCCAGCAGACAACTGAGAGGCATAACCAGGCCTTC

CTGGCTCTGGAAGGACAGGTCATCACTAAAAAGCTCCATGCCAGCATCCGAGAGAAAGCAGGCCACTGGTTTGCTACCACCACACCCATCATCGGCAAAG

GCATCATGTTTGCCATCAAAGAAGGGCGGGTGACCACAGGAGTGTCTAGCATCGCCAGTGAGGACAGCCGCAAGGTAGCATCCGTGTTGAACAATGCCTA

CTACTTAGACAAGATGCACTACAGCATCGAGGGCAAGGACACACACTACTTTGTGAAGATCGGCGCCGCGGATGGTGACCTGGTCACGCTAGGAACCACC

ATTGGGCGCAAGGTGCTGGAGAGTGGGGTGAACGTGACGGTGTCACAGCCCACGCTGCTGGTGAATGGCAGGACTCGAAGGTTCACCAACATTGAGTTCC

AGTACTCCACGCTGCTGCTCAGTATCCGCTACGGCCTCACCCCCGACACGCTGGACGAAGAAAAGGCCCGCGTCCTGGACCAAGCGAGACAGAGAGCCCT

GGGTACTGCCTGGGCCAAGGAGCAGCAGAAAGCCAGGGACGGGAGAGAGGGCAGCCGCCTGTGGACGGAGGGCGAGAAGCAGCAACTCCTGAGCACGGGA

CGGGTACAAGGTTATGAGGGCTATTACGTACTTCCGGTGGAACAGTACCCGGAGCTGGCAGACAGTAGCAGCAACATCCAGTTCTTAAGACAGAATGAGA

TGGGAAAGAGGTAA
Translation
MDVKDRRHRSLTRGRCGKECRYTSSSLDSEDCRVPTQKSYSSSETLKAYDHDSRMHYGNRVTDLVHRESDEFSRQG - UNI31944 - - UNI35267

 - GTNFTLAELGICEPSPHRSGYCSDMGILHQGYSLSTGSDADSDTEGGMSPEHAIRLWGRGIKSRRSSGLSSRENSALTLTDSDNENKSDDDNG - U

NI35267 - GRPIPPTSSSSLLPSAQLPSSHNPPPVSCQMPLLDSNTSHQIMDTNPDEEFSPNSYLLRACSGPQQASSSG - UNI35267 - GPPNH

HSQSTLRPPLPPPHNHTLSHHHSSANSLNRNSLTNRRSQIHAPAPAPNDLATTPESVQLQDSWVLNSNVPLETR RHFLFKTSSGSTPLFSSSSPGYPLT

SGTVYTPPPRLLPRNTFSRKAFKLKKPSKYCSWKCAALSAIAAALLLAILLAYFIA AMHLLGLNWQLQPADGHTFNNGVRTGLPGNDDVATVPSGGKV 

VPWSLKNSSIDSGEAEVGRRVTQEVPPGVFWRSQIHISQPQFLKFNISLGKDALFGVYIRRGLPPSHAQ YDFMERLDGKEKWSVVESPRERRSIQTLVQ

NEAVFVQYLDVGLWHLAFYNDGKDKEMVSFNTVVLD DSVQDCPRNCHGNGECVSGLCHCFPGFLGADCAKA AACPVLCSGNGQYSKGTCQCYSGWKGA

ECDVPMNQCIDPSCGGHGSCIDGNCVCAAGYKGEHCEEV VDCLDPTCSSHGVCVNGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDSGLCSCDPNW

MGPDCSVV VCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCTID DGCPDLCNGNGRCTLGQNSWQCVCQTGW

RGPGCNVAMETSCADNKDNEGD DGLVDCLDPDCCLQSACQNSLLCRGSRDPLDIIQQGQTDWPAVKSFYDRIKLLAGKDSTHIIPGDNPFNSS SLVSL

IRGQVVTMDGTPLVGVNVSFVKYPKYGYTITRQDGT TFDLIANGGSALTLHFERAPFMSQERTVWLPWNSFYAMDTLVMKTEENSIPSCDLSGFVRPDP

IIISSPLSTFFSASPASNPIVPETQ VLHEEIELPGTNVKLRYLSSRTAGYKSLLKITMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWDK

TDAYGQRVYGLSDAVV VSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHTLNVKSG GILHKGTGENQFLTQQPAIITSIMGNGRRRSIS

CPSCNGLAEGNKLLAPVALAVGIDGSLFVGDFNYIRRIFPSRNVTSILELR RNKEFKHS - UNI32602 - SNSPGHKYYLAVDPVTGSLYVSDTNS

RRIYRVKSLSGAKDLAGNSEVVAGTGEQCLPFDEARCGDGGKAVDATLMSPRG - UNI32602 - GIAVDKNGLMYFVDATMIRKVDQNGIISTLLGS

NDLTAVRPLSCDSSMDVAQ - UNI32602 - VRLEWPTDLAVNPMDNSLYVLENNVILRITENHQVSIIAGRPMHCQVPGIDYSLSKLAIHSALESAS

AIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCICYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSKNKPVLN

AFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTYSADNDVTELIDNNGNSLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKAVSTQNLELG

LMTYDGNTGLLATKSDETGWTTFYD DYDHEGRLTNVTRPTGVVTSLHREMEKSITIDIENSNRDDDVTVITNLSSVEASYTVVQD DQVRNSYQLCNNG

TLRVMYANGMAVSFHSEPHVLAGTITPTIGRCNISLPMENGLNSIEWRLRKEQIKGKVTIFGRKLR VHGRNLLSIDYDRNIRTEKIYDDHRKFTLRIIY

DQVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFADGKVWSYSYLDK SMVLLLQSQRQYIFEYDSSDRLHAVTMPSVARH

SMSTHTSIGYIRNIYNPPESNASVIFDYSDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDETTGVLKMVNLQSGGFSCTIRYRKVGPLV

DKQIYRFSEEGMINARFDYTYHDNSFRIASIKPVISETPLPVDLYRYDEISGKVEHFGKFGVIYYDINQIITTAVMTLSKHFDTHGRIKEVQYEMFRSLM

YWMTVQYDSMGRVIKRELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSARLMPLRYDLRDRITRLGDVQYKIDDDGYLCQ

RGSDIFEYNSKGLLTRAYNKASGWSVQYRYDGVGRRASYKTNLGHHLQYFYSDLHNPTRITHVYNHSNSEITSLYYDLQGHLFAMESSSGEEYYVASDNT

GTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDVLAGRWTSPDYTMWRNVGKEPAPFNLYMFKNNNPLSNELDL

KNYVTD DVKSWLVMFGFQLSNIIPGFPRAKMYFVPPPYELSESQASENGQ LITGVQQTTERHNQAFLALEGQVITKKLHASIREKAGHWFATTTPIIG

KGIMFAIKEGRVTTGVSSIASEDSRKVASVLNNAYYLDKMHYSIEGKDTHYFVKIGAADGDLVTLGTTIGRKVLESGVNVTVSQPTLLVNGRTRRFTNIE

FQYSTLLLSIRYGLTPDTLDEEKARVLDQARQRALGTAWAKEQQKARDGREGSRLWTEGEKQQLLSTGRVQGYEGYYVLPVEQYPELADSSSNIQFLRQN

EMGKR

For any suggestions or comments, please send an email to unitrap@crg.es