Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049488 (Tmem67)
Chromosomal location
Chr 4: 11966792 - 12016575 (-)
Description
transmembrane protein 67 Gene [Source:MGI (curated);Acc:Tmem67-001]
RefSeq_dna
NM_177861 
RefSeq_peptide
NP_808529.1 
MGI
MGI:1923928 
Uniprot/SWISSPROT
Q8BR76 
Uniprot/SPTREMBL
Q8BT65 A2AJP5 
Human Ortholog
ENSG00000164953 (TMEM67)
Omim 607361 - MECKEL SYNDROME, TYPE 3  610688 - JOUBERT SYNDROME 6  
UniTrap UNI27705
Vector Insertion
Chr 4: 12007116 - 12013058
Public Clones not available
Private Clones OST52563 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29095
Vector Insertion
Chr 4: 11990978 - 11996014
Public Clones not available
Private Clones OST8885 (lexicon)
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29100
Vector Insertion
Chr 4: 11989008 - 11990181
Public Clones not available
Private Clones OST8804 (lexicon)
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108291
Sequence
GTACAAGGCCTGTGGCGGCCATGGCGGTCAGATCTCGTTCTTCATCCCGGACTGGCACCGCCTACCTTCTCTTAGTTCTCTGCGAAGTCTCATGGGCACA

AATCTTCTCCTTCCCTTTCCGGCGGCCTGAGACCTGCGACTTCAACCAGTACTTTGACATCTCGGCGCTCTCCTGTGCCCCCTGTGGCGCCAACCAGCGG

CGGGATGCACTAG GAACTTCCTGTGTATGTCTACCAGGATATCATATGATCTCTAATAATGGAGGACCTTCTATTATTTGTAAAAAGTGTCCAGAAAAC

ATG - UNI27705 - AAAGGCGTTACTAAAGATGGCTGGGACTGCATTTCTTGTCCTAGTGGCTTAACTGCTGAGGGGAAGTGCCACTGTCCCACTGG

CCATATATTAG TGGAAAGAAATGTTAGTGGGTCTTTGTTAGCCCAAGCAACTTGCGAGCTTTGTGATGAAAGTGAAAACTCATTTACAAAAGCCAATGC

TTTAGGAACCAG GTGTGTCCGCTGCGAACCAACATTTGTGAATACAAGCAGGTCCTGTTCATGTTCAGAGCCTCACACTTTA ACAGGTGGATTATGTT

TCAGCAACACAGGGAATTTTCATCAACGTGTAATTTCCACTGCACGTTATGGAGAGCTT GGCATGTCATTAAATTCAGAATGGTTTGCCAAGTATTTGC

AGGCAACAGCAGCTGCATGCTGG ACTCACGCCAACCTGACATCGTGCCAAGCTCTTGGAAATATGTGCGTGATGAACATGAACTCTTACGACTCGACCA

CACTCGATGCTTGTCGACTGTTCCATTACATCTTTGAAAGCACTGCTGGATTGATCAGTGTGCATTCTGTTCCATTCTG GAGACAGAACCTTCCTTGGC

TGTTCTATGGAGACCAGCCAGGATTGGCTCCTCAAGTTCTCAGTACTACACCTCTTCCTACAAATTTCAGTTTTAAAGGACAAAACCAG CTGAAGTTTG

TTGCTGCTTCCTATGATATACGAGGAAACTTCATCAAATGGCAACCTTTAGAAGGTGGTGTTTTACAG CTTTGTCCAGACACTGAGAGAAGGCTGGATG

CAGCGTATGCTTTTGGAACAACGTACCAGCAAAAT - UNI29095 - TGTGAAATCTCTCTCTCTAAACTCCTGGTTGACTTCAGCAGCCCTGTATTT

TATGATGTTTACCTCGAATACACTGATGAAGAGCAGCACCGTTACCTTTGGCCTATCCCAGTGTTAAACCTAAATCTTCAACACAACAAACTGTTTGTGA

ACCAAG ACAGTAGCTCCAGCAAGTGGCTTCTGACTCGGCGCATTTTCTTAGTGGATGCAGTAAGTGGGCGAGAAAATGACCTAGGAAATCAGCCAAGAG

TAATTCGAGTTGCTACCCAGATTTCACTGAG - UNI29100 - CATACGCCTTGTACCCAACACAAAAAATGGAAACATATACACTCCCCTACTTACC

ATTGCCTACAGTGACATTGACATCAAAAATGCTCATAGCCAGTCTGCGAAGGTGAGTTCTTCATTATTCAGTGCCCTTGTATTTATAAATACTACTTAAA

TGTTGTTGTAGCTTATCCTGGTCAAAAGGTAATATTTTTTAAAGTTTTAAACAAATCCCTTTGCTTATATATTCAAATCTTAATTATTGGTGTCTAATAA

AAGAGAGAAGCTGAGCTCTTAAGGATGTTGAATATTAAAAAACAATAGTGAATGACATTTTTTTTTATTAGTAGTATATGTGTAGTGGGGGAGGGGCGGC

AAGTGATGGCAGGCTCCCATGCAGACCAGAGCCATTAGGTTCCCCTGTAACTGAGCTGCAGTGAGGTGGAATTGACGATGGCTCACTCAGCCTGGGAACT

GGGAATTGAACTCAGGTCGTCCTCTGCAGGAGCAGTATGCACTCTTGACCACTGAGCCATTCTTTCCGTGTCTCGGTGGAAGGATTATCAGCAGCTGATA

GAGATGATTCAACAGACAGACAGATGAAAATCATCAGCTTTGTAACTAGCAGGATAAAGTTGAACCAGAAAATGAAGTTTGGACCTGCAGCCCTGATTCA

CTAAAGAGTGAAGGCCCTCAGTGTCCAAGAGGGCCCACCTATGAAGGACAGAGAGCTCGTACACCCAAAAGGCAGGCTGTACCAAAGAATAACCCTGGAA

AACCCTGGTCACACATGGCCAGTGCCTCCCTCGGTCCGTCCCTCGGAGAGAGCATTCCTGCTCGGAGGACAGATGAGCGAGAGAGGGACAGAGTGAAACA

GGAAATTCTGGGTGCTTTATTTTCTTCTGGAGATTTGTAGATCACCTGTCCTCTGGGACATGGGAAGAAGGAAACAAGCTTTCCTTATCACCAGCACTCA

CTAATAACTTTTCATGTCTGTCATTCTGCTTTTTATTATTATCTATATTAATAGTCTTCTGTGTTGCTTAGCAGGTGTGGTGCTCTTGCCCTGCTTGTGA

CCAGGCTCTCATAAAAGAGCCATGGTTCTTGACCTTCCTAACGCTGCGACCCTTTAATACACTTCCTCATGTTGTGTGAGTGTATGTGAGTGTATGAGCC

CCCTCTCTGCCATAGGTAGGGCTCAAAGACACACATAAATCATTCTTGTTGCTACTTCATAACTAATTTTGCTATTGTTATGAATTGGAAATAAATAAAC

TGATATGAGACCCCTGCGGTGGTAATGGCCCACAGGCTGAGAACCACTGCAAAAAGAGGGACATAATACAACGTACATGAGACCTTTTCCTCATTTGTAG

TACTAAAAACAATTAGGTCAGATCAGTTTCTGTTCACTGGATTTACATACACTAGTACTGGAGAAGACAATACAGAAACATGCCAAGTTACAGGATCCTG

CATTAAAATTTCCTAGTGAGTACATTTATTTTAACACAAGCACTCTTTCTTTAAATATTATTATTGCCCATAGTTTACAAACTAAGTCTTGAGAAACTGT

AATATAAGAAATAAAAGAGGAGCGCCAGCTGGTTCCTCAGTGGGTTAGGGTGCTCCGCAGACACCGGACAGCACAGCTCCAAAACCAGAAGAGCCTAATG

GTGGAAGGAGAGAACTGACCACCCAGAGTGGTCCTCTCTGACCTTCACATATGTGACATGGCATGCATGTGCCCCTACACACACACACACACACACACAC

ACACACACACACGCACATGCACGTGCACGCAATCAATCAATAAATATTAAAGAT
Translation
MAVRSRSSSRTGTAYLLLVLCEVSWAQIFSFPFRRPETCDFNQYFDISALSCAPCGANQRRDALG GTSCVCLPGYHMISNNGGPSIICKKCPENM - U

NI27705 - KGVTKDGWDCISCPSGLTAEGKCHCPTGHILV VERNVSGSLLAQATCELCDESENSFTKANALGTR RCVRCEPTFVNTSRSCSCSEPH

TL TGGLCFSNTGNFHQRVISTARYGEL GMSLNSEWFAKYLQATAAACW THANLTSCQALGNMCVMNMNSYDSTTLDACRLFHYIFESTAGLISVHSV

PFW WRQNLPWLFYGDQPGLAPQVLSTTPLPTNFSFKGQNQ LKFVAASYDIRGNFIKWQPLEGGVLQ LCPDTERRLDAAYAFGTTYQQN - UNI290

95 - CEISLSKLLVDFSSPVFYDVYLEYTDEEQHRYLWPIPVLNLNLQHNKLFVNQD DSSSSKWLLTRRIFLVDAVSGRENDLGNQPRVIRVATQISL

S - UNI29100 - SIRLVPNTKNGNIYTPLLTIAYSDIDIKNAHSQSAKVSSSLFSALVFINTT
Transcript ENSMUST00000050686
Sequence
GGACCCAGGATATGGGTACCATGGTGACGCGTACAAGGCCTGTGGCGGCCATGGCGGTCAGATCTCGTTCTTCATCCCGGACTGGCACCGCCTACCTTCT

CTTAGTTCTCTGCGAAGTCTCATGGGCACAAATCTTCTCCTTCCCTTTCCGGCGGCCTGAGACCTGCGACTTCAACCAGTACTTTGACATCTCGGCGCTC

TCCTGTGCCCCCTGTGGCGCCAACCAGCGGCGGGATGCACTAG GAACTTCCTGTGTATGTCTACCAGGATATCATATGATCTCTAATAATGGAGGACCT

TCTATTATTTGTAAAAAGTGTCCAGAAAACATG - UNI27705 - AAAGGCGTTACTAAAGATGGCTGGGACTGCATTTCTTGTCCTAGTGGCTTAAC

TGCTGAGGGGAAGTGCCACTGTCCCACTGGCCATATATTAG TGGAAAGAAATGTTAGTGGGTCTTTGTTAGCCCAAGCAACTTGCGAGCTTTGTGATGA

AAGTGAAAACTCATTTACAAAAGCCAATGCTTTAGGAACCAG GTGTGTCCGCTGCGAACCAACATTTGTGAATACAAGCAGGTCCTGTTCATGTTCAGA

GCCTCACACTTTA ACAGGTGGATTATGTTTCAGCAACACAGGGAATTTTCATCAACGTGTAATTTCCACTGCACGTTATGGAGAGCTT GGCATGTCAT

TAAATTCAGAATGGTTTGCCAAGTATTTGCAGGCAACAGCAGCTGCATGCTGG ACTCACGCCAACCTGACATCGTGCCAAGCTCTTGGAAATATGTGCG

TGATGAACATGAACTCTTACGACTCGACCACACTCGATGCTTGTCGACTGTTCCATTACATCTTTGAAAGCACTGCTGGATTGATCAGTGTGCATTCTGT

TCCATTCTG GAGACAGAACCTTCCTTGGCTGTTCTATGGAGACCAGCCAGGATTGGCTCCTCAAGTTCTCAGTACTACACCTCTTCCTACAAATTTCAG

TTTTAAAGGACAAAACCAG CTGAAGTTTGTTGCTGCTTCCTATGATATACGAGGAAACTTCATCAAATGGCAACCTTTAGAAGGTGGTGTTTTACAG C

TTTGTCCAGACACTGAGAGAAGGCTGGATGCAGCGTATGCTTTTGGAACAACGTACCAGCAAAAT - UNI29095 - TGTGAAATCTCTCTCTCTAAA

CTCCTGGTTGACTTCAGCAGCCCTGTATTTTATGATGTTTACCTCGAATACACTGATGAAGAGCAGCACCGTTACCTTTGGCCTATCCCAGTGTTAAACC

TAAATCTTCAACACAACAAACTGTTTGTGAACCAAG ACAGTAGCTCCAGCAAGTGGCTTCTGACTCGGCGCATTTTCTTAGTGGATGCAGTAAGTGGGC

GAGAAAATGACCTAGGAAATCAGCCAAGAGTAATTCGAGTTGCTACCCAGATTTCACTGAG - UNI29100 - CATACGCCTTGTACCCAACACAAAA

AATGGAAACATATACACTCCCCTACTTACCATTGCCTACAGTGACATTGACATCAAAAATGCTCATAGCCAGTCTGCGAAG ATTTCCTTCTCAGTGAAG

TATGAGATGAATCAAGGAGACGCATCTGTGCACACAGAT ATTGCGTTGGGTGTGTTGGGTGGGCTGGCTGTGCTATCATCTCTTTTGAAGACAGCGGGA

TGGAAGAGGCGCATCGGGAGCCCCATGATTGATTTACAG ACAGTTATGAAATTCCTGCTGTACTATGCTGGTGATCTGGCCAATGTGTTTTTTATCATC

ACAGTGGGAACAGGTCTTTATTGGCTTATTTTCTTCAAA GCACAGAAGTCAGTCTCTGTTTTGCTGCCGATGCCAGTTCAGGAAGAACGTTTCGTTACT

TATGTGGGGTGCGCCTTTGCTATGAAG GCTCTCCAGTTTTTACATAAGTTCATATCCCAGATTTCCATAGATATATTCTTTATTGATTGGGAACGGCCG

AAAGGAAAAGTTCTTAAAGCTGTTGAAG GTGAGGGTGGTGTGCGGAGTGCCACTGTTCCTGTGAGCATATGGAGAACGTATTTCGTGGCAAATGAATGG

AATGAGATTCAGACTGTGAGAAAAATTAATCCACTCTTTCAAGTGCTTACCACACTCTTCTTCTTGGAG GTTGTGGGATTCAAAAATTTAGCGTTAATG

GATTCATCCTCCAGCCTTTCTAGAAACCCATCAGACTACACAGCTCCTTACAGCCGCATTCTGAGATATGCCGTGGCTACTGCTATCTGGCTGGTGATTG

GAATAATACAG GTTGTTTTCTTTGCTGCCTTTTATGAGAGATTCATAGAAGACAAAATCCGGCAGTTTGTTGACCTGTGCTCCATGAGTAAT GTGTCA

GTGTTCCTGCTGTCCCACAGATGTTTTGGATATTACATTCATGGGAGGTCAGTCCACGGCCATGCAGACACTAACATGGAGGAAATGAATATGAACCTTA

AGAGAGAGGCG GAAAATTTGTGCAGCCAAAGAGGTTTGGTGCCCAACACGGATGGGCAGACGTTTCAGATTGCAGTTTCTAGTCAGATGAGACAACACT

ATGACAGGATTCATGAGACTTTAACAAGG AGAAATGGCCCTGCCAGACTGCTGAGTTCGTCGGGGAGTACTTTTGAACAAAGCATCAAAGCATACCACG

CAATGAATAAGTTCCTTGGCTCTTTCATTGACCAC GTTCATAAGGAAATGGATTACTTTATAAAAGATAAGTTGCTTCTTGAAAGAATCCTTGGGATGG

AATTCATGGAGCCCATGGAGAAGAGCATCTTCTATAATG ATGAAGGCCATTCTTTCAGCAGTGTGCTGTATTATGGGAACGAGGCCACGCTCCTCATCT

TTGATCTGTTGTTCTTCTGTGTTGTGGATTTGGCTTGCCAGGACTTTGTTTTAGCATCCTTCCTCACATACCTGCAACAAGAG ATTTTCCGATTTATCC

GAAATACAGTAGGACAAAAGAATTTGGCAACCAAAACACTAGTGGATGAAAGATTTCTGATCTAATCTGTGAATACAGAACTTAAGGACTCAGTATAATA

TGGCCAAGACTTGATGTTGCTATATTTTTTAAAACTTGTAATACATATTATTCTCCCATTTTTTATCTACAGAAAGATTTATTTTTATAGCTTGTGAAAT

ATGAAATATAGTAAAAACACTCTTTCCCCATT
Translation
MGTMVTRTRPVAAMAVRSRSSSRTGTAYLLLVLCEVSWAQIFSFPFRRPETCDFNQYFDISALSCAPCGANQRRDALG GTSCVCLPGYHMISNNGGPSI

ICKKCPENM - UNI27705 - KGVTKDGWDCISCPSGLTAEGKCHCPTGHILV VERNVSGSLLAQATCELCDESENSFTKANALGTR RCVRCEPTF

VNTSRSCSCSEPHTL TGGLCFSNTGNFHQRVISTARYGEL GMSLNSEWFAKYLQATAAACW THANLTSCQALGNMCVMNMNSYDSTTLDACRLFHYI

FESTAGLISVHSVPFW WRQNLPWLFYGDQPGLAPQVLSTTPLPTNFSFKGQNQ LKFVAASYDIRGNFIKWQPLEGGVLQ LCPDTERRLDAAYAFGTT

YQQN - UNI29095 - CEISLSKLLVDFSSPVFYDVYLEYTDEEQHRYLWPIPVLNLNLQHNKLFVNQD DSSSSKWLLTRRIFLVDAVSGRENDLGN

QPRVIRVATQISLS - UNI29100 - SIRLVPNTKNGNIYTPLLTIAYSDIDIKNAHSQSAK ISFSVKYEMNQGDASVHTD IALGVLGGLAVLSSL

LKTAGWKRRIGSPMIDLQ TVMKFLLYYAGDLANVFFIITVGTGLYWLIFFK AQKSVSVLLPMPVQEERFVTYVGCAFAMK ALQFLHKFISQISIDIF

FIDWERPKGKVLKAVEG GEGGVRSATVPVSIWRTYFVANEWNEIQTVRKINPLFQVLTTLFFLE VVGFKNLALMDSSSSLSRNPSDYTAPYSRILRYA

VATAIWLVIGIIQ VVFFAAFYERFIEDKIRQFVDLCSMSN VSVFLLSHRCFGYYIHGRSVHGHADTNMEEMNMNLKREA ENLCSQRGLVPNTDGQTF

QIAVSSQMRQHYDRIHETLTR RNGPARLLSSSGSTFEQSIKAYHAMNKFLGSFIDH VHKEMDYFIKDKLLLERILGMEFMEPMEKSIFYND DEGHSF

SSVLYYGNEATLLIFDLLFFCVVDLACQDFVLASFLTYLQQE IFRFIRNTVGQKNLATKTLVDERFLI
Transcript ENSMUST00000108293
Sequence
ATGGAGACCACACTCCCCTCCGGTCCGGACAAACCGATGCACCGTCTCTCTGCTCATGCGCAATCCAGGCCCAACCAGCCACCCCTTGGCGCTCTGAACG

CGCGTGCGCAGACGTACTGCTTCGGTTACAGTGATTGGCGGGT CTCAGCGGACTCACCGAGGAGGCTGCTGGGGAGCTGGAGACTGCGGACCCAGGATA

TGGGTACCATGGTGACGCGTACAAGGCCTGTGGCGGCCATGGCGGTCAGATCTCGTTCTTCATCCCGGACTGGCACCGCCTACCTTCTCTTAGTTCTCTG

CGAAGTCTCATGGGCACAAATCTTCTCCTTCCCTTTCCGGCGGCCTGAGACCTGCGACTTCAACCAGTACTTTGACATCTCGGCGCTCTCCTGTGCCCCC

TGTGGCGCCAACCAGCGGCGGGATGCACTAG GAACTTCCTGTGTATGTCTACCAGGATATCATATGATCTCTAATAATGGAGGACCTTCTATTATTTGT

AAAAAGTGTCCAGAAAACATG - UNI27705 - AAAGGCGTTACTAAAGATGGCTGGGACTGCATTTCTTGTCCTAGTGGCTTAACTGCTGAGGGGAA

GTGCCACTGTCCCACTGGCCATATATTAG TGGAAAGAAATGTTAGTGGGTCTTTGTTAGCCCAAGCAACTTGCGAGCTTTGTGATGAAAGTGAAAACTC

ATTTACAAAAGCCAATGCTTTAGGAACCAG GTGTGTCCGCTGCGAACCAACATTTGTGAATACAAGCAGGTCCTGTTCATGTTCAGAGCCTCACACTTT

A ACAGGTGGATTATGTTTCAGCAACACAGGGAATTTTCATCAACGTGTAATTTCCACTGCACGTTATGGAGAGCTT GGCATGTCATTAAATTCAGAAT

GGTTTGCCAAGTATTTGCAGGCAACAGCAGCTGCATGCTGG ACTCACGCCAACCTGACATCGTGCCAAGCTCTTGGAAATATGTGCGTGATGAACATGA

ACTCTTACGACTCGACCACACTCGATGCTTGTCGACTGTTCCATTACATCTTTGAAAGCACTGCTGGATTGATCAGTGTGCATTCTGTTCCATTCTG GA

GACAGAACCTTCCTTGGCTGTTCTATGGAGACCAGCCAGGATTGGCTCCTCAAGTTCTCAGTACTACACCTCTTCCTACAAATTTCAGTTTTAAAGGACA

AAACCAG CTGAAGTTTGTTGCTGCTTCCTATGATATACGAGGAAACTTCATCAAATGGCAACCTTTAGAAGGTGGTGTTTTACAG CTTTGTCCAGACA

CTGAGAGAAGGCTGGATGCAGCGTATGCTTTTGGAACAACGTACCAGCAAAAT - UNI29095 - TGTGAAATCTCTCTCTCTAAACTCCTGGTTGAC

TTCAGCAGCCCTGTATTTTATGATGTTTACCTCGAATACACTGATGAAGAGCAGCACCGTTACCTTTGGCCTATCCCAGTGTTAAACCTAAATCTTCAAC

ACAACAAACTGTTTGTGAACCAAG ACAGTAGCTCCAGCAAGTGGCTTCTGACTCGGCGCATTTTCTTAGTGGATGCAGTAAGTGGGCGAGAAAATGACC

TAGGAAATCAGCCAAGAGTAATTCGAGTTGCTACCCAGATTTCACTGAG - UNI29100 - CATACGCCTTGTACCCAACACAAAAAATGGAAACATA

TACACTCCCCTACTTACCATTGCCTACAGTGACATTGACATCAAAAATGCTCATAGCCAGTCTGCGAAG ATTTCCTTCTCAGTGAAGTATGAGATGAAT

CAAGGAGACGCATCTGTGCACACAGAT ATTGCGTTGGGTGTGTTGGGTGGGCTGGCTGTGCTATCATCTCTTTTGAAGACAGCGGGATGGAAGAGGCGC

ATCGGGAGCCCCATGATTGATTTACAG ACAGTTATGAAATTCCTGCTGTACTATGCTGGTGATCTGGCCAATGTGTTTTTTATCATCACAGTGGGAACA

GGTCTTTATTGGCTTATTTTCTTCAAA GCACAGAAGTCAGTCTCTGTTTTGCTGCCGATGCCAGTTCAGGAAGAACGTTTCGTTACTTATGTGGGGTGC

GCCTTTGCTATGAAG GCTCTCCAGTTTTTACATAAGTTCATATCCCAGATTTCCATAGATATATTCTTTATTGATTGGGAACGGCCGAAAGGAAAAGTT

CTTAAAGCTGTTGAAG GTGAGGGTGGTGTGCGGAGTGCCACTGTTCCTGTGAGCATATGGAGAACGTATTTCGTGGCAAATGAATGGAATGAGATTCAG

ACTGTGAGAAAAATTAATCCACTCTTTCAAGTGCTTACCACACTCTTCTTCTTGGAG GTTGTGGGATTCAAAAATTTAGCGTTAATGGATTCATCCTCC

AGCCTTTCTAGAAACCCATCAGACTACACAGCTCCTTACAGCCGCATTCTGAGATATGCCGTGGCTACTGCTATCTGGCTGGTGATTGGAATAATACAG 

GTTGTTTTCTTTGCTGCCTTTTATGAGAGATTCATAGAAGACAAAATCCGGCAGTTTGTTGACCTGTGCTCCATGAGTAAT GTGTCAGTGTTCCTGCTG

TCCCACAGATGTTTTGGATATTACATTCATGGGAGGTCAGTCCACGGCCATGCAGACACTAACATGGAGGAAATGAATATGAACCTTAAGAGAGAGGCG 

GAAAATTTGTGCAGCCAAAGAGGTTTGGTGCCCAACACGGATGGGCAGACGTTTCAGATTGCAGTTTCTAGTCAGATGAGACAACACTATGACAGGATTC

ATGAGACTTTAACAAGG AGAAATGGCCCTGCCAGACTGCTGAGTTCGTCGGGGAGTACTTTTGAACAAAGCATCAAAGCATACCACGCAATGAATAAGT

TCCTTGGCTCTTTCATTGACCAC GTTCATAAGGAAATGGATTACTTTATAAAAGATAAGTTGCTTCTTGAAAGAATCCTTGGGATGGAATTCATGGAGC

CCATGGAGAAGAGCATCTTCTATAATG ATGAAGGCCATTCTTTCAGCAGTGTGCTGTATTATGGGAACGAGGCCACGCTCCTCATCTTTGATCTGTTGT

TCTTCTGTGTTGTGGATTTGGCTTGCCAGGACTTTGTTTTAGCATCCTTCCTCACATACCTGCAACAAGAG ATTTTCCGATTTATCCGAAATACAGTAG

GACAAAAGAATTTGGCAACCAAAACACTAGTGGATGAAAGATTTCTGATCTAATCTGTGAATACAGAACTTAAGGACTCAGTATAATATGGCCAAGACTT

GATGTTGCTATATTTTTTAAAACTTGTAATACATATTATTCTCCCATTTTTTATCTACAGAAAGATTTATTTTTATAGCTTGTGAAATATGAAATATAGT

AAAAACACTCTTTCCCCATT
Translation
METTLPSGPDKPMHRLSAHAQSRPNQPPLGALNARAQTYCFGYSDWRV VSADSPRRLLGSWRLRTQDMGTMVTRTRPVAAMAVRSRSSSRTGTAYLLLV

LCEVSWAQIFSFPFRRPETCDFNQYFDISALSCAPCGANQRRDALG GTSCVCLPGYHMISNNGGPSIICKKCPENM - UNI27705 - KGVTKDGWD

CISCPSGLTAEGKCHCPTGHILV VERNVSGSLLAQATCELCDESENSFTKANALGTR RCVRCEPTFVNTSRSCSCSEPHTL TGGLCFSNTGNFHQRV

ISTARYGEL GMSLNSEWFAKYLQATAAACW THANLTSCQALGNMCVMNMNSYDSTTLDACRLFHYIFESTAGLISVHSVPFW WRQNLPWLFYGDQPG

LAPQVLSTTPLPTNFSFKGQNQ LKFVAASYDIRGNFIKWQPLEGGVLQ LCPDTERRLDAAYAFGTTYQQN - UNI29095 - CEISLSKLLVDFSS

PVFYDVYLEYTDEEQHRYLWPIPVLNLNLQHNKLFVNQD DSSSSKWLLTRRIFLVDAVSGRENDLGNQPRVIRVATQISLS - UNI29100 - SIRL

VPNTKNGNIYTPLLTIAYSDIDIKNAHSQSAK ISFSVKYEMNQGDASVHTD IALGVLGGLAVLSSLLKTAGWKRRIGSPMIDLQ TVMKFLLYYAGDL

ANVFFIITVGTGLYWLIFFK AQKSVSVLLPMPVQEERFVTYVGCAFAMK ALQFLHKFISQISIDIFFIDWERPKGKVLKAVEG GEGGVRSATVPVSI

WRTYFVANEWNEIQTVRKINPLFQVLTTLFFLE VVGFKNLALMDSSSSLSRNPSDYTAPYSRILRYAVATAIWLVIGIIQ VVFFAAFYERFIEDKIRQ

FVDLCSMSN VSVFLLSHRCFGYYIHGRSVHGHADTNMEEMNMNLKREA ENLCSQRGLVPNTDGQTFQIAVSSQMRQHYDRIHETLTR RNGPARLLSS

SGSTFEQSIKAYHAMNKFLGSFIDH VHKEMDYFIKDKLLLERILGMEFMEPMEKSIFYND DEGHSFSSVLYYGNEATLLIFDLLFFCVVDLACQDFVL

ASFLTYLQQE IFRFIRNTVGQKNLATKTLVDERFLI

For any suggestions or comments, please send an email to unitrap@crg.es