Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049493 (Pls1)
Chromosomal location
Chr 9: 95654458 - 95745679 (-)
Description
plastin 1 (I-isoform) Gene [Source:MGI Symbol;Acc:MGI:104809]
RefSeq_dna
NM_001033210 
RefSeq_peptide
NP_001028382.1 
MGI
MGI:104809 
Uniprot/SPTREMBL
Q3V0K9 Q3V3X1 Q8R0U6 
Human Ortholog
ENSG00000120756 (PLS1)
Omim not available
UniTrap UNI36065
Vector Insertion
Chr 9: 95715664 - 95745680
Public Clones IST13021A6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21142
Vector Insertion
Chr 9: 95696286 - 95715664
Public Clones not available
Private Clones OST340101 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000119760
Sequence
GGCAGAACATTTATTTCAGCATAGAGCAAGCTGCGTGTCCGACTTTTGCACATGACCATCCAAGGACAGGCACGGCTCAAGACAGGTTGGATTTTCAAGT

TTCTGAGTTTGTTTCTCAGGACCCCTGACTGCCAGGCGCTAAGTAAGACCTGAGGAAGCAG - UNI21142 - - UNI36065 - ATATAAAGACTT

GAAGTAGCCCTTCCAGTCTAAAGATGGAAAACAGTACCACCACCATTTCTCGGGAGGAGCTTGAAGAGCTACAAGAAGCGTTTAATAAAATAG ATATTG

ACAACAGTGGATATGTTAGTGACTATGAACTTCAGGACCTATTTAAGGAGGCAAGCCTTCCCCTTCCTGGGTACAAGGTGCGCGAGATTGTGGAGAAAAT

ATTAGTAGTTGCCGACAACAACAAAGATGGTAAAATCAGTTTTGAGGAGTTCGTGTCG CTGATGCAAGAGCTAAAAAGCAAAGATATCAGCAAAACGTT

TCGAAAAATAATTAACAAAAGGGAAGGGATCACTGCCATCGGGGGGACGTCATCCATCTCCAGCGAGGGCACCCAGCATTCGTACTCAG AGGAAGAAAA

AGTGGCTTTTGTGAACTGGATAAACAAAGCTCTGGAGAATGA
Translation
 - UNI21142 - - UNI36065 - MENSTTTISREELEELQEAFNKID DIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILVVADNNKDGKI

SFEEFVS LMQELKSKDISKTFRKIINKREGITAIGGTSSISSEGTQHSYSE EEEKVAFVNWINKALEN
Transcript ENSMUST00000093800
Sequence
AAGGAGGCGGGTGAGTGGCAGCCGCAGCGGAGCGGACCAGACCAGCGGGCGCGGGGATCCCGGGCAGGAGCTGCCGAACGGCCGCCGCAG - UNI2114

2 - - UNI36065 - ATATAAAGACTTGAAGTAGCCCTTCCAGTCTAAAGATGGAAAACAGTACCACCACCATTTCTCGGGAGGAGCTTGAAGAGCTA

CAAGAAGCGTTTAATAAAATAG ATATTGACAACAGTGGATATGTTAGTGACTATGAACTTCAGGACCTATTTAAGGAGGCAAGCCTTCCCCTTCCTGGG

TACAAGGTGCGCGAGATTGTGGAGAAAATATTAGTAGTTGCCGACAACAACAAAGATGGTAAAATCAGTTTTGAGGAGTTCGTGTCG CTGATGCAAGAG

CTAAAAAGCAAAGATATCAGCAAAACGTTTCGAAAAATAATTAACAAAAGGGAAGGGATCACTGCCATCGGGGGGACGTCATCCATCTCCAGCGAGGGCA

CCCAGCATTCGTACTCAG AGGAAGAAAAAGTGGCTTTTGTGAACTGGATAAACAAAGCTCTGGAGAATGATGCAGACTGTAGCCACCTCCTACCCATGA

ACCCCAACGACGGCAGCCTTTTCAAGTCGCTGGCAGATGGCATCCTTCTCTG CAAAATGATCAACTTATCCGAGCCAGATACGATTGACGAGAGAGCCA

TCAATAAGAAGAAGCTCACTCCGTTCACGGTGTCG GAAAATCTGAACCTAGCACTGAACTCTGCCTCGGCCATCGGTTGCACCGTGGTCAACATTGGTG

CTCAGGACCTCAAGGAAGGAAAGCCTCACTTGGTCTTGGGGCTTCTCTGGCAGATCATCAAAGTGGGTCTTTTTGCTGATATCGAGATTTCCAGGAATGA

AG CCTTGATCGCGTTGCTAAAAGATGGCGAGGACCTGGAGGAGCTGATGAAGCTCTCTCCTGAGGAACTGCTGCTCCGATGGGTGAACTACCATCTGAC

CAATGCGGGCTGGCGCACCATCAACAACTTCAGCCAGGACATCAAG GATTCAAAAGCCTATTTCCACCTTCTTAATCAGATTGCTCCTAAAGGCGACCG

AGATGATGGGCCTGCCGTAGCCATTGATCTTTCAGGATTTAAT GAGAAAAACGACCTGAAGCGTGCTGGATTTATGCTCCAGGAAGCGGATAAACTTGG

CTGCAGACAGTTTGTCACTCCTGCAGATGTGGTTTCAGGGAACCCTAAGCTAAACTTAGCCTTTGTAGCGAATCTTTTTAACACATACCCATGCCTACAC

AAGCCTGACAATAATGACATTGATCTCAACTTACTGGAAG GCGAGAGCAAGGAGGAGAGGACATTCCGCAACTGGATGAACTCGCTGGGCGTGAACCCG

TACATCAATCACCTGTACAG TGACCTTGCAGACGCTTTGGTGATCTTTCAGCTCTACGAGATGATCCGCGTGCCAGTCAACTGGAGCCAGGTGAACAAG

CCTCCGTACCCTGCTCTGGGAGGAAACATGAAGAAG ATTGAAAACTGTAACTACGCGGTGGAGCTTGGGAAGAATGAGGCCAAGTTCTCTTTGGTTGGC

ATCGCCGGGCAGGACTTAAATGAAGGGAACGCAACACTTACCCTGGCACTGGTGTGGCAGTTGATGAGAAG ATACACGCTGAAAGTGTTATCAGACCTT

GGAGAAGGTGAAAAAGTCACTGATGATATCATTATTAAATGGGTCAACCAGACCCTTAAAAGTGCAAACAAGAGCACTTCTATTTCCAGCTTCAAG GAT

AAATCTATTAGTACAAGTTTGCCTGTCTTAGATCTAATAGATGCCATTGCACCAAATGCAGTCCGTCAAGAAATGATCAAGAGAGAGCACTTGACTGATG

AGGACAAACTGAACAATGCTAA ATACGCCATTTCAGTTGCTCGGAAGATCGGTGCCCGGATATACGCGCTGCCTGACGACCTCGTGGAAGTGAAGCCGA

AGATGGTGATGACTGTGTTTGCCTGCTTAATGGGGAAAGGATTGAACAGACTGAAATAATGAAGCGTTTACTGTGATCTGCCACACTGTACGCACCAAAC

GTCTCAGTTTACAGAATTTTGAAATGTAGTGGGTATAAAATCCGAATATCTGTATGCTCAAAATAGTTCTGTATCCAGCAATGAAGAATATCTTGTCCAT

ACCAGTTAGAATTTGTCAATCTTTTTTTTTTTTTTTTGGATAACACAATTACCTTAACAATCAATACCAATGCAGGAATGTCTTATCAAGCTGCTATTTC

ATAATTAAATTATTTTATTTCC
Translation
 - UNI21142 - - UNI36065 - MENSTTTISREELEELQEAFNKID DIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILVVADNNKDGKI

SFEEFVS LMQELKSKDISKTFRKIINKREGITAIGGTSSISSEGTQHSYSE EEEKVAFVNWINKALENDADCSHLLPMNPNDGSLFKSLADGILLC C

KMINLSEPDTIDERAINKKKLTPFTVS ENLNLALNSASAIGCTVVNIGAQDLKEGKPHLVLGLLWQIIKVGLFADIEISRNEA ALIALLKDGEDLEEL

MKLSPEELLLRWVNYHLTNAGWRTINNFSQDIK DSKAYFHLLNQIAPKGDRDDGPAVAIDLSGFN EKNDLKRAGFMLQEADKLGCRQFVTPADVVSGN

PKLNLAFVANLFNTYPCLHKPDNNDIDLNLLEG GESKEERTFRNWMNSLGVNPYINHLYS SDLADALVIFQLYEMIRVPVNWSQVNKPPYPALGGNMK

K IENCNYAVELGKNEAKFSLVGIAGQDLNEGNATLTLALVWQLMRR RYTLKVLSDLGEGEKVTDDIIIKWVNQTLKSANKSTSISSFK DKSISTSLP

VLDLIDAIAPNAVRQEMIKREHLTDEDKLNNAK KYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLMGKGLNRLK

For any suggestions or comments, please send an email to unitrap@crg.es