Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049565 (4921525H12Rik)
Chromosomal location
Chr 3: 108542576 - 108585214 (+)
Description
RIKEN cDNA 4921525H12 gene Gene [Source:MGI Symbol;Acc:MGI:3584453]
MGI
MGI:3584453 
Uniprot/SPTREMBL
A2AEL9 Q3TPF6 Q3UXF3 A2AEL8 Q8BI23 
Human Ortholog
ENSG00000162641 (C1orf62)
Omim not available
UniTrap UNI13898
Vector Insertion
Chr 3: 108568156 - 108574827
Public Clones CMHD-GT_202.1G4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000062935
Sequence
AGTGTGACCTCTTCCTTAGAGGGATGCAGGAGGAGACGCACACCACAACTTTAAAGGGTTATTTCTGTTCTGCCATTCAATTGCAACCAACTTCCCAGTG

ATTGAAAGAAATAAAATGATTTTCAGTTAACGGCTGGCTCATTTGCGGTGCAAGACTCTTTCTTCACTGTGTGATGTCGGGACCCTAAGATGCAG CATA

GAACACACAGTGCAGACATTTAATGAATGAAATGCAATGAAAACCAGACAACACATTTTGAGCATTAAGAACACCAAGACCAGGCAGCAGAGGACCACGG

ACATCAGCCCACACCATCATGGACGAAACCGACTTTTCAGAAGATATGACTTATAAACAACAGGAGGACCTGCCTTATGATGGGGACTTCTCCCAGATGA

AGATGTGCACTTCTTACAACTTTACCATAACAAATGACACCTCTCCTGTCTCAGCAGAAGTTGTTCTGGCAGGAGAAGACCCTCAGGAAGTGGCTTCTAA

CTGTGAGGTGCGCCAGGACACAGCTCTGCTGGCAACTTGGGATAAGATGACTGAACTTGTCGGCAATAGGCATGATAAAGATAAGCAATGCGCCCTGGCT

TCTCCTGTTCCAGCTGATAAAGAAGATACCTCAAAGTCCCACGTCTCAGATATTTTACTCCATCATCTCTCCGGAGAGCAATTCTTCAGGGGTCCAGGTG

CTGGCTATGAAACTCTCCCAGAGACCTCGAATGCTGACAGTCTTGAAGGCTCAGATACTCTTATAAATATCATTTCATGTTATGCAAAAAAGTATTACCC

CAAAGAACAAATCCCAGAATTCACTGGCCAGCCCAGTCCCCAAAATGGTTCAATAAATAGCAGCAAGCCCTGTTGCTCCCCTGGCACAGAAGAAGAAAAC

GCCTCTCCCTTAGAAGAAGCAGTGGCTGCTGGGAAGAGCACCCATCAGGAAGATCCAAGCTTTCTAACCAGGACTAAAGGTCCAGGTGATAAATATAAAA

GCTGCCTGAGGCAGACACCCCAGAGACAGCTGCCAGACAAAGCAAATTCAGGCGACTGGCTCAGATACAGCCAGGCTCAAGTGCACTACCAGTTTCCAGA

TTTTCCTAAGGTTTCTCCCAAAGGGAAACTCTCTAGCAAACCACTTACCACAGCTAACGAAGGCGGCCATTCTCCGAGGTTGACGAATAAATCAACAGTT

GTGCAAGATAATTTAGGAACCACGTCTGGGTCAAATCGTGTTGAAAAACAACCGGAGCAGAAATGGAAATTTCCTGAACCTTCGCAACAAATACAG GTG

CAGCCTGCCACACACACCTGCCAAGAACCTCTCACAG GACTTGAACCTGAGAAATGTTGCTTGAATTTGACACCAACACCTCAAAAAGATCCTTTCTCA

AATTCTTACATATTTCAAAAGATCTCCCATGGAAAACAGATGTGCCAGAAACTGAAAGAACAGACTGACCAACTGAAGAATAAG GTACAAGAATTTTCC

AAAAGAATAAAACAGGACTCTTTCTGCCATTTGCAAGACATAAGACTG ATGAACAAGGAACATGCTGGCAGTCTTCCAGGGCCCTGGGGCTCCCGAGGA

AGTGAGGTGACAGGGCTGCCGAGGGGAGGGCCACAGGAGGCCACCTCCAAGGAGCTCAGTGAACTGGCCCTGAAGAT - UNI13898 - GAAACAGAA

AATGGAGAAAAGGGGCCACAGAAGAACTAACTGTGGGAAGTTTTCCAGTAGCATCCATGAAAAAACACTGCCCCAAGACTCGGCTCTCG GTACTGATCC

AGGACCCGACTTTTGTCCTGATCCTGGTACTGGGCTCCAGAGTAACAAATGTGAAGCCTACGGAAGCAAGACTCAGAACTCCCAGAGAGTCTGTGAGGAA

GACCCACCAAAAG AATTTTATTATAGATATAACACTCCAGGACAAGATGACTTAAATCATGGTGGAGGATATATCTTTGTCCAGCCTCACTTCTTATAT

GAAAATAAAATCTCTGCATCTT CTTGGTCAAAAGCAAAATGGATCTGGTCCTGGAGAGTGAACTCAGAACCCGTTCAAGATGAGCCCGATCCTGCGGCA

GG AAAATATCCCAAGACTTATATGATCTCTACCTCAGACCTTGCAACACCCTCACCCCACCTCTGCTGCCTGGGAATTCCTAGAATCCAGTCCTTATGT

CCCAGTGATAACATGGAAGAAATGGAATCTAAG ATTTTAAACTCGCCCTTGGAGCATGCCTTAAGGACAGCAACCATATTGAAAAAAAACACCGACCAA

ATGATTAGATCCATTGCAGAAGACCTCGCCAAGGCACAAGGATGGAGACACCAGCTAAGATACTACTAACTCAGTCCCGGGCAGCCAAGGGTTAAAATGT

TTGGTCCTCTCCAAAATATTTTACTTATGAGATAATGTAGGAAGATAGTTTTCTAGAGAAAACACTAAAACTTTAAGAAATGAGTTATACGAAGTGCTTA

AATGGAGAAAAAAAAGCAAAACAAGCCCTCTGGCATTTATATCTTTATGTGAAAATAAATCTATGTTCTTCCTAATTCATAATAAAATAAAAACAATAAA

ACAAATACTTTATT
Translation
   MCQKLKEQTDQLKNK VQEFSKRIKQDSFCHLQDIRL MNKEHAGSLPGPWGSRGSEVTGLPRGGPQEATSKELSELALKM - UNI13898 - MK

QKMEKRGHRRTNCGKFSSSIHEKTLPQDSALG GTDPGPDFCPDPGTGLQSNKCEAYGSKTQNSQRVCEEDPPKE EFYYRYNTPGQDDLNHGGGYIFVQ

PHFLYENKISASS SWSKAKWIWSWRVNSEPVQDEPDPAAG GKYPKTYMISTSDLATPSPHLCCLGIPRIQSLCPSDNMEEMESK ILNSPLEHALRTA

TILKKNTDQMIRSIAEDLAKAQGWRHQLRYY
Transcript ENSMUST00000106606
Sequence
AGTGTGACCTCTTCCTTAGAGGGATGCAGGAGGAGACGCACACCACAACTTTAAAGGGTTATTTCTGTTCTGCCATTCAATTGCAACCAACTTCCCAGTG

ATTGAAAGAAATAAAATGATTTTCAGTTAACGGCTGGCTCATTTGCGGTGCAAGACTCTTTCTTCACTGTGTGATGTCGGGACCCTAAGATGCAG CATA

GAACACACAGTGCAGACATTTAATGAATGAAATGCAATGAAAACCAGACAACACATTTTGAGCATTAAGAACACCAAGACCAGGCAGCAGAGGACCACGG

ACATCAGCCCACACCATCATGGACGAAACCGACTTTTCAGAAGATATGACTTATAAACAACAGGAGGACCTGCCTTATGATGGGGACTTCTCCCAGATGA

AGATGTGCACTTCTTACAACTTTACCATAACAAATGACACCTCTCCTGTCTCAGCAGAAGTTGTTCTGGCAGGAGAAGACCCTCAGGAAGTGGCTTCTAA

CTGTGAGGTGCGCCAGGACACAGCTCTGCTGGCAACTTGGGATAAGATGACTGAACTTGTCGGCAATAGGCATGATAAAGATAAGCAATGCGCCCTGGCT

TCTCCTGTTCCAGCTGATAAAGAAGATACCTCAAAGTCCCACGTCTCAGATATTTTACTCCATCATCTCTCCGGAGAGCAATTCTTCAGGGGTCCAGGTG

CTGGCTATGAAACTCTCCCAGAGACCTCGAATGCTGACAGTCTTGAAGGCTCAGATACTCTTATAAATATCATTTCATGTTATGCAAAAAAGTATTACCC

CAAAGAACAAATCCCAGAATTCACTGGCCAGCCCAGTCCCCAAAATGGTTCAATAAATAGCAGCAAGCCCTGTTGCTCCCCTGGCACAGAAGAAGAAAAC

GCCTCTCCCTTAGAAGAAGCAGTGGCTGCTGGGAAGAGCACCCATCAGGAAGATCCAAGCTTTCTAACCAGGACTAAAGGTCCAGGTGATAAATATAAAA

GCTGCCTGAGGCAGACACCCCAGAGACAGCTGCCAGACAAAGCAAATTCAGGCGACTGGCTCAGATACAGCCAGGCTCAAGTGCACTACCAGTTTCCAGA

TTTTCCTAAGGTTTCTCCCAAAGGGAAACTCTCTAGCAAACCACTTACCACAGCTAACGAAGGCGGCCATTCTCCGAGGTTGACGAATAAATCAACAGTT

GTGCAAGATAATTTAGGAACCACGTCTGGGTCAAATCGTGTTGAAAAACAACCGGAGCAGAAATGGAAATTTCCTGAACCTTCGCAACAAATACAG GTG

CAGCCTGCCACACACACCTGCCAAGAACCTCTCACAG GACTTGAACCTGAGAAATGTTGCTTGAATTTGACACCAACACCTCAAAAAGATCCTTTCTCA

AATTCTTACATATTTCAAAAGATCTCCCATGGAAAACAGATGTGCCAGAAACTGAAAGAACAGACTGACCAACTGAAGAATAAG GTACAAGAATTTTCC

AAAAGAATAAAACAGGACTCTTTCTGCCATTTGCAAGACATAAGACTGGTAATGAACTTAATCTGGTTTTTTAATCTTTATTTGGAAATTCCAGTGGGTA

AATGCAGAGAGGCTTTCCATAGCCATGAATAG
Translation
 MTELVGNRHDKDKQCALASPVPADKEDTSKSHVSDILLHHLSGEQFFRGPGAGYETLPETSNADSLEGSDTLINIISCYAKKYYPKEQIPEFTGQPSPQ

NGSINSSKPCCSPGTEEENASPLEEAVAAGKSTHQEDPSFLTRTKGPGDKYKSCLRQTPQRQLPDKANSGDWLRYSQAQVHYQFPDFPKVSPKGKLSSKP

LTTANEGGHSPRLTNKSTVVQDNLGTTSGSNRVEKQPEQKWKFPEPSQQIQ VQPATHTCQEPLTG GLEPEKCCLNLTPTPQKDPFSNSYIFQKISHGK

QMCQKLKEQTDQLKNK VQEFSKRIKQDSFCHLQDIRLVMNLIWFFNLYLEIPVGKCREAFHSHE
Transcript ENSMUST00000094007
Sequence
AGTGTGACCTCTTCCTTAGAGGGATGCAGGAGGAGACGCACACCACAACTTTAAAGGGTTATTTCTGTTCTGCCATTCAATTGCAACCAACTTCCCAGTG

ATTGAAAGAAATAAAATGATTTTCAGTTAACGGCTGGCTCATTTGCGGTGCAAGACTCTTTCTTCACTGTGTGATGTCGGGACCCTAAGATGCAG CATA

GAACACACAGTGCAGACATTTAATGAATGAAATGCAATGAAAACCAGACAACACATTTTGAGCATTAAGAACACCAAGACCAGGCAGCAGAGGACCACGG

ACATCAGCCCACACCATCATGGACGAAACCGACTTTTCAGAAGATATGACTTATAAACAACAGGAGGACCTGCCTTATGATGGGGACTTCTCCCAGATGA

AGATGTGCACTTCTTACAACTTTACCATAACAAATGACACCTCTCCTGTCTCAGCAGAAGTTGTTCTGGCAGGAGAAGACCCTCAGGAAGTGGCTTCTAA

CTGTGAGGTGCGCCAGGACACAGCTCTGCTGGCAACTTGGGATAAGATGACTGAACTTGTCGGCAATAGGCATGATAAAGATAAGCAATGCGCCCTGGCT

TCTCCTGTTCCAGCTGATAAAGAAGATACCTCAAAGTCCCACGTCTCAGATATTTTACTCCATCATCTCTCCGGAGAGCAATTCTTCAGGGGTCCAGGTG

CTGGCTATGAAACTCTCCCAGAGACCTCGAATGCTGACAGTCTTGAAGGCTCAGATACTCTTATAAATATCATTTCATGTTATGCAAAAAAGTATTACCC

CAAAGAACAAATCCCAGAATTCACTGGCCAGCCCAGTCCCCAAAATGGTTCAATAAATAGCAGCAAGCCCTGTTGCTCCCCTGGCACAGAAGAAGAAAAC

GCCTCTCCCTTAGAAGAAGCAGTGGCTGCTGGGAAGAGCACCCATCAGGAAGATCCAAGCTTTCTAACCAGGACTAAAGGTCCAGGTGATAAATATAAAA

GCTGCCTGAGGCAGACACCCCAGAGACAGCTGCCAGACAAAGCAAATTCAGGCGACTGGCTCAGATACAGCCAGGCTCAAGTGCACTACCAGTTTCCAGA

TTTTCCTAAGGTTTCTCCCAAAGGGAAACTCTCTAGCAAACCACTTACCACAGCTAACGAAGGCGGCCATTCTCCGAGGTTGACGAATAAATCAACAGTT

GTGCAAGATAATTTAGGAACCACGTCTGGGTCAAATCGTGTTGAAAAACAACCGGAGCAGAAATGGAAATTTCCTGAACCTTCGCAACAAATACAG GTG

CAGCCTGCCACACACACCTGCCAAGAACCTCTCACAG GACTTGAACCTGAGAAATGTTGCTTGAATTTGACACCAACACCTCAAAAAGATCCTTTCTCA

AATTCTTACATATTTCAAAAGATCTCCCATGGAAAACAGATGTGCCAGAAACTGAAAGAACAGACTGACCAACTGAAGAATAAG GTACAAGAATTTTCC

AAAAGAATAAAACAGGACTCTTTCTGCCATTTGCAAGACATAAGACTG CAGATGCGCCTTCATTGA
Translation
 MDETDFSEDMTYKQQEDLPYDGDFSQMKMCTSYNFTITNDTSPVSAEVVLAGEDPQEVASNCEVRQDTALLATWDKMTELVGNRHDKDKQCALASPVPA

DKEDTSKSHVSDILLHHLSGEQFFRGPGAGYETLPETSNADSLEGSDTLINIISCYAKKYYPKEQIPEFTGQPSPQNGSINSSKPCCSPGTEEENASPLE

EAVAAGKSTHQEDPSFLTRTKGPGDKYKSCLRQTPQRQLPDKANSGDWLRYSQAQVHYQFPDFPKVSPKGKLSSKPLTTANEGGHSPRLTNKSTVVQDNL

GTTSGSNRVEKQPEQKWKFPEPSQQIQ VQPATHTCQEPLTG GLEPEKCCLNLTPTPQKDPFSNSYIFQKISHGKQMCQKLKEQTDQLKNK VQEFSKR

IKQDSFCHLQDIRL QMRLH

For any suggestions or comments, please send an email to unitrap@crg.es