Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049606 (Zfp644)
Chromosomal location
Chr 5: 107045758 - 107125849 (-)
Description
zinc finger protein 644 Gene [Source:MGI (curated);Acc:Zfp644-001]
RefSeq_dna
NM_026856 
RefSeq_peptide
NP_081132.2 
UniGene
Mm.401032 Mm.468571 
MGI
MGI:1277212 
Uniprot/SPTREMBL
Q3TSI7 Q3UMJ0 Q6PFV3 Q8BW98 Q9CT79 Q8K0R1 Q80TH4 
Human Ortholog
ENSG00000122482 (ZNF644)
Omim not available
UniTrap UNI29830
Vector Insertion
Chr 5: 107124816 - 107125617
Public Clones E054F12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22080
Vector Insertion
Chr 5: 107095865 - 107124816
Public Clones (sanger) IST14869H2 (tigm) IST11592A2 (tigm) IST14534E9 (tigm) IST14648C1 (tigm)
Private Clones OST309342 (lexicon) OST248767 (lexicon) OST38019 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9369
Vector Insertion
Chr 5: 107095803 - 107095865
Public Clones XE491 (baygenomics)
Private Clones OST42783 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22951
Vector Insertion
Chr 5: 107067655 - 107095803
Public Clones not available
Private Clones OST280466 (lexicon) OST208755 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000086790
Sequence
GTTTGGTTTTGGCACGGGAGAGCAGCGGTGCAGCGTTGCTGCCGCCCCCCGTGGGTCTGATTGGCACGGGAGCTCCGGCGGCCCGAGAGCACGGGCGCGC

CTCGCTGGCTTCCCCCGGCGGCCGGCGGCCAGGCAGAGGCGGGAAAGCCGCGCGCCTGCGCCGTGGGAACCGAGGCCGGAGGCGAGAAGCGGGGAGCGGA

GGGGGCCGTTGGAGCCGAGTAGCGTACAGAGCGGCGTGTGACGCGGGGACGCCGCGCGCTCCCAACGTCGCCCCGGTTTGACGCACACGGCACCAAACT 

- UNI9369 - - UNI22080 - - UNI29830 - GCTTGATTTAAATTTGGATGAGATTATTCTTGCATCAAGATGTTAATAAGCCAAAATTTAG 

- UNI9369 - - UNI22951 - ACTAAAGGTGTTAAATGATCTTGCCAACAATATGGATGATTTGAAGATAAACACCGACATTACTGGTGCTAAAGA

AGAACTCCAAGATGACAACAATTTTATCTCTGAGAAAGACAGTGGAGTTCATAAACCAAAAGATTGTCAGACATCATTTCAGAAAAACAGTTCATTGACT

CGATCTGAGGAATTGTCAGAGGATCAATCAGAACAAGCCTTAAGTGGAGGCCAGTCTGCTTTGTTTCTCCCTGCCAGCACTCCTGCTGTTCCTACTGAAA

ACTTTCCCTTGCCCACAGGAGCTGTTGTTAATGGACCAGTCTCATGCTCCTCCTCCACAAAGACTTCCAATATGAATGAAGGTAGTGTTTCATTAACCCC

TGGACAGCCTGCAGATCAGCTAGCAGCAGAGTCTTGCTCCACTTTGAAGGCAGCAGCTGATCATCAGCTGTCTACACCACAAAAAGCAAGTCAACACCAA

GTTCTGTTTTTGTTATCAGATGTAGCACATGCTAAGAATCCAACCCATTCCATTAAAAAAGTACCTACCTCTGCTTTAGTTGGTTGTGATGTTCAGAATT

CAGTAGGGAATAACATGAAGTCAGAGAGCACTTTACTAAGTCAAGCAGAGGTGGGTCAGGGCGACGCCTCCACAGTGGTCAGAGACGACTGTGTCAGCGC

GTTAGCAGTGATTTCCTCAGGTACAGACGAATTTAGGTCAGAAAATGATACAAACTGGGATCCCCAAAAAGAGTTCATTCAGTTTCTTATGACTAGTGAA

GAGACGGTGGATAAGCCCCCAGCTCATTCTAAAGTAGTAGGTCTAGAAAAAAAGAGAAAGAGAAAAATGGATGTGAGCAAGATCACTCGCTACACAGAGG

ACTGCTACAGTGACTCAGGCCGTGCACCTGGAAAATCAAAAATTCTTCAGGTTGACTTTCTAGGGCAAAACGAGGAGATGCAAGCAATAGACTCACAGAA

CTACACATTATCAAAAGTGAAACCCGAGTCAGCTGGTGGAGACTTGGAGTCTGTGGACACTTTTCAGCATCTAGTTTATAACTCAGATAAATGTGGAGAG

GATAATTCACCTGTTCATACTCGCACTTTAATTTCAAATACCTTAAAAAAGAAATGTGAAGAGAGTGATCCTGAGTCACCTGTTGCTTTCAGTACTGAAG

AGCCATCATTCTACCCCTGTACAAAGTGCAATGTGAATTTTAGGGAGAAAAAGCATCTCCACAGGCATATGATGTATCATTTAGATGGGAATAGTCACTT

TCGCCACCTTAATGTCCCCAGGCCATATGCTTGTAGAGAATGTGGACGGACATTTCGAGATCGTAATTCACTACTAAAGCATATGATCATTCACCAAGAA

AGACGGCAGAAGCTGATGGAAGAGATTCGTGAGCTGAAAGAGCTCCAGGATGAAGGCAGAAGTGCTCGACTCCAGTGCCCTCAGTGTGTGTTTGGTACCA

ATTGCCCTAAGACGTTTGTGCAACATGCAAAAACCCATGAGAAAGACAAACGGTACTACTGCTGTGAGGAGTGTAACTTCATGGCAGTGACGGAGAATGA

GCTGGAATGCCATAGGGGCATCGCCCACGGAGCAGCAGTGAAGTGTCCTGTTGTGAGTTCAGAAGTAACTCAGAGAAAAACACAAAAGAAGACTTCAGTG

AAAGACTCTGTTATAGGATCATCCAAAAAACCTGCTACTTACCTATGTAAGATGTGTCCCTTCACTACTTCAGCCAGAAGTATTCTGAAGAAGCACACGG

AGTATTTGCATTCCTCGGCGTGTGTTGACTCCTTTGGTAATCCACTGGGACTTGACAAAAGAAAAAATGACAGCCTCGAGGAGTCTGTAGATGTCGATAG

CACCAAGTCATTAGCTAAGCAGCAGCCAAGTACATTTCCAAAGAACTCTGCTTTAAAACAGGATGCTAAACGGACATTTGGATCAAGCTCACAGTCAAGT

AATTTTTCAAAATTTCATAAGCGGCCACATAGAATACAAAAAGCCCGGAAAAGCATTGCCCAATCTGGTGTAAATTCGTGCAGTCAAAACAAGTCTCCTC

ACAAGAACGTTATG TTAAGAGCAGCACTGACCAACAACCAAAGTATTTCCATCAGGCCCCAAGAGAAAAACCTAACGCCAGGGCAGACAGCAGTTATTT

ATATAGACACAAGTATAACAACTACCGGACGATCAGAAAATCAG ACCCTCATAATGCAGACACCAAAAGGCCAGAAAACGAGAAAGACCACAAGCGTGT

AGCTGTGAAAAGAGTAGCTAAGGCCTCAAAGAAGGAAAGCTCTGCTGGAGAGGACTTGGATAGCTATCCCGACTTTCTGCATAAAATGACTGTTGTTGTT

TTGCAAAAGCTTCATTCTGATAAGAAAGATAGTTACGAAACAGAAGATGACAGCTCCTGGGATAACGTTGAGTTAGGTGACTACACTACACAGGCCATGG

AAGAAGAAGCCTACAGTGACCTTAGTCAAGAACATGTAAACTTATTGCCCCTGTTTAAAAGCAAGATAGAGGGCCAGGGCCCTGGAGACAGTGCTGCCCT

GAGTTACGATCAGAATGATGGCTTCTACTTTGAATATTATGAAGACGGTGGCACTAACAGCTTTTTACAGGATATACATGATCCTCAGCATTTGGAAAAC

CCAGAAACGCCTTTGTCAAAGCATAGTTCTGTTTTTCATTGGACTGATTTGTCTCTTGAGAAGAAGTCATGTCCTTATTGCCCAGCAACATTTGAAACAG

GTGTTGGGTTGTCAAATCATGTCCGAGGACATCTTCACAGAGCAGGATTGAGCTATGAAGCCCGTCATGTTGTATCACCAGAACAAATAGCCACAAGTGA

CAAGATGCAGCACTTCAAAAGAACTGGCAACGGGACGCCTGTGAAACGAGTTAGAAAAG CTATAGAGAAGTCTGAAACTACTTCCGAACATACTTGTCA

GCTCTGTGGTGGTTGGTTTGACACAAAGATTGGGTTATCAAATCATGTCAGAGGCCATCTGAAAAGACTTGGGAAAACTAAATGGGATGCTCACAAATCT

CCAATCTGTGTTCTGAATGAGATGATGCAAAACGAAGAGAAGTATGAAAAGATCCTGAAGGCGCTCAACAGTCGCCGCATTATCCCCAGACCGTTTGTAG

CTCAGAAACTCTCCTCAGGCGATGACTTCCTATCTCACAATGTCTTACCTCTTGATGAATACCACAATGGCCTAAAGACAGAGGCTCTCTCAGTGTCTGC

ATCAGAGGAAGAAGGGCTGCATTTCTTAAGTGAGTGTGGTGAAAGAAAGCCTGAACTGCCCAGTGGGAGAAAGAACCAGTCTCTTACACTGATAGAACTT

CTTAAAAGTAGAAGGCTAGGCGAAGAAAGGAATTCTGCAGTCTCTCCTCACAAGACCCATAACCAGACAGCAAGAAAGAGATTTGTTCAGAAATGTGTTC

TTCCATTAAACGAAGACAGTCCGTTGATCTATCAGCCACAAAAAATGGACTTGACTGTGCACTCAG CCATAGATTGTAAGCAGAAGAAATCAAGGTCAA

GATCTGGAAGCAAGAAGAAAATGCTAACGTTGCCTCATGGTGCTGACGAGGTTTACATTCTCCGATGCAG GTTTTGTGGCCTAGTCTTTCGGGGACCAT

TGTCTGTTCAGGAAGACTGGATTAAGCACTTACAGCGTCACATTGTAAACGCTAATCTTCCACGGACTGGAGCTGGCATGGTGGAAGTCACATCACTACT

TAAAAAGCCTGCCTCTATCACAGAAACGTCGTTTTCTTTACTAATGGCAGAAGCAGCATCATAGAACCAGGAATCCTTTTCAATAGCAAATTTAATTGGA

TGTAAATTTAAAATTTGTGTCTTTTTTTTGTAAGCCACATGAAAGTATCCATTATAAATACTAAAGTAGGAAGAATGAGGGACCGTAAATTAGAGTGGCA

TCGGAGCAAACAATACTTCAGACAAGACAGTAAGTAGTCATATATTTTATATAGGGTGGAGATGTGTTCTTAAGGTTTACTAAGTTTTGTTGGCTGAGTT

TACTCAACTAAAGGTCCTACATCTGAGAGCCATTTGTAAAGTGTTGCACATGAATCCTTACAGACAGACTTACTGAAAGATTATGTTCTCTACAGTGTTA

CCAGAATCAAGGCTCTGGTTTTTCCCCACACATAGAAAAATAAGAAATTATATTTTGTTGGTATGTATTTAGTGTTTTGTATAATACCAGGAACTGCTAA

CTAAATTTACTCAACTTAGGGCATTAAATATCATGTACTTCATAGTTTGAGACTGTTCCCTCAAATAGGGCAGAGTACTATTCTATCTAGATGTGTTAAG

TGTTTTTTTAAAATCATAATGGAACGGTTTTTTTTTATATATATATACATATATATATATATATACTAAAAAGTTGGAGCGAGATTTGTTTAAACAAGTA

TTTCTAAAAGAAATATTGTACATAGTCCTGGAAATTATTTGTGGTAAGGAAATATTCTTTAATCCAGTTGCATTTCTCAGACAATGAAGTGGTGCGTCCA

TGCTACCTCCTGCTTTGTCAACAAAGATGCTATTTACCCTTTCCATTTGTATCATAATAGATTTTAAAAATCTAATGTTCTTTATTGCAAGACATACTTT

TGTTAACAGATTTGTTTCTTTGTAACGTTTTCCATACGTTTGACATGCTTACAGGACAGGGTTGTCTTTATTTAACATTGTAGAAATGTAATTAATAAAC

AAGGCTCACTACACAATTTAGAATAGGCTTTCTCATTTATATTCCAAATTTGATCATTTAGCAAAACTATTGATACACAAAATATTTCTACATATGAGAA

TGTTTACAATTTGAATTTTAGAAGTTGTTTTTGGATGTGATTCTATGTATGAAAATTGTGTAACACTATGCTCATGCTAAGAACCGACTTAACAGAATTA

CTGAAATAAATGTGCTGTGAGGAATGGACAGTACGGTGCAGGTGTCTTGGTCATGATAAACTGTGATGATTCTTTTAAACACTTTCCAAAAACAACTTAG

TTCCTTTCATCCTGAATGAGCGTCGTTTACAAACAGCAGTTTGTATGCAAGCACCATTCCGCTTCATTTCATGGTGTTGCTAATATAGTTGAACCAAGGA

TATGCATTGATACTTTTCATAATTTGTAAATAAAGTTAAAAACAGTTAAAGGAGTGTTTGGTAGAGGTATATGTATATATACCTCACTGCCAGTGAAATT

ACTTTCCTATGGTATATCTCCTTGCCAGAAATCACTAAATAAAAAGACTTCAAGAATT
Translation
 - UNI9369 - - UNI22080 - - UNI29830 - MRLFLHQDVNKPKFR - UNI9369 - - UNI22951 - RLKVLNDLANNMDDLKINTD

ITGAKEELQDDNNFISEKDSGVHKPKDCQTSFQKNSSLTRSEELSEDQSEQALSGGQSALFLPASTPAVPTENFPLPTGAVVNGPVSCSSSTKTSNMNEG

SVSLTPGQPADQLAAESCSTLKAAADHQLSTPQKASQHQVLFLLSDVAHAKNPTHSIKKVPTSALVGCDVQNSVGNNMKSESTLLSQAEVGQGDASTVVR

DDCVSALAVISSGTDEFRSENDTNWDPQKEFIQFLMTSEETVDKPPAHSKVVGLEKKRKRKMDVSKITRYTEDCYSDSGRAPGKSKILQVDFLGQNEEMQ

AIDSQNYTLSKVKPESAGGDLESVDTFQHLVYNSDKCGEDNSPVHTRTLISNTLKKKCEESDPESPVAFSTEEPSFYPCTKCNVNFREKKHLHRHMMYHL

DGNSHFRHLNVPRPYACRECGRTFRDRNSLLKHMIIHQERRQKLMEEIRELKELQDEGRSARLQCPQCVFGTNCPKTFVQHAKTHEKDKRYYCCEECNFM

AVTENELECHRGIAHGAAVKCPVVSSEVTQRKTQKKTSVKDSVIGSSKKPATYLCKMCPFTTSARSILKKHTEYLHSSACVDSFGNPLGLDKRKNDSLEE

SVDVDSTKSLAKQQPSTFPKNSALKQDAKRTFGSSSQSSNFSKFHKRPHRIQKARKSIAQSGVNSCSQNKSPHKNVM LRAALTNNQSISIRPQEKNLTP

GQTAVIYIDTSITTTGRSENQ TLIMQTPKGQKTRKTTSV   
Transcript ENSMUST00000112694
Sequence
GAACATTGGTAGAAATATGGACAGAAAAAGTCATTGTGTTGAAGGCTCAAACAAAAATGAGAAAGGAGGTATTGGAAGCTAAGTGTAGAGCTCATCTTGG

TTACACTGCTGCGAAGAATTGGCTGGAAGTCTGCGCTGTTGGACTTTGTAGAACACAGAACGGAGGACTGGGCTGTCTGTCTGGTGCCTTACAGTTCCTG

ACAGCAGTGTTAGGCAGCGGAGTATCCACCTCAGCTGCCATCATCTCTGAGAGGACCAACCACACTGCCTAGAGCTCCTTGAAATTAAAGTGAGGCTGGA

TGGCAG CCATAGATTGTAAGCAGAAGAAATCAAGGTCAAGATCTGGAAGCAAGAAGAAAATGCTAACGTTGCCTCATGGTGCTGACGAGGTTTACATTC

TCCGATGCAG GTTTTGTGGCCTAGTCTTTCGGGGACCATTGTCTGTTCAGGAAGACTGGATTAAGCACTTACAGCGTCACATTGTAAACGCTAATCTTC

CACGGACTGGAGCTGGCATGGTGGAAGTCACATCACTACTTAAAAAGCCTGCCTCTATCACAGAAACGTCGTTTTCTTTACTAATGGCAGAAGCAGCATC

ATAGAACCAGGAATCCTTTTCAATAGCAAATTTAATTGGATGTAAATTTAAAATTTGTGTCTTTTTTTTGTAAGCCACATGAAAGTATCCATTATAAATA

CTAAAGTAGGAAGAATGAGGGACCGTAAATTAGAGTGGCATCGGAGCAAACAATACTTCAGACAAGACAGTAAGTAGTCATATATTTTATATAGGGTGGA

GATGTGTTCTTAAGGTTTACTAAGTTTTGTTGGCTGAGTTTACTCAACTAAAGGTCCTACATCTGAGAGCCATTTGTAAAGTGTTGCACATGAATCCTTA

CAGACAGACTTACTGAAAGATTATGTTCTCTACAGTGTTACCAGAATCAAGGCTCTGGTTTTTCCCCACACATAGAAAAATAAGAAATTATATTTTGTTG

GTATGTATTTAGTGTTTTGTATAATACCAGGAACTGCTAACTAAATTTACTCAACTTAGGGCATTAAATATCATGTACTTCATAGTTTGAGACTGTTCCC

TCAAATAGGGCAGAGTACTATTCTATCTAGATGTGTTAAGTGTTTTTTTAAAATCATAATGGAACGGTTTTTTTTTATATATATATACATATATATATAT

ATATACTAAAAAGTTGGAGCGAGATTTGTTTAAACAAGTATTTCTAAAAGAAATATTGTACATAGTCCTGGAAATTATTTGTGGTAAGGAAATATTCTTT

AATCCAGTTGCATTTCTCAGACAATGAAGTGGTGCGTCCATGCTACCTCCTGCTTTGTCAACAAAGATGCTATTTACCCTTTCCATTTGTATCATAATAG

ATTTTAAAAATCTAATGTTCTTTATTGCAAGACATACTTTTGTTAACAGATTTGTTTCTTTGTAACGTTTTCCATACGTTTGACATGCTTACAGGACAGG

GTTGTCTTTATTTAACATTGTAGAAATGTAATTAATAAACAAGGCTCACTACACAATTTAGAATAGGCTTTCTCATTTATATTCCAAATTTGATCATTTA

GCAAAACTATTGATACACAAAATATTTCTACATATGAGAATGTTTACAATTTGAATTTTAGAAGTTGTTTTTGGATGTGATTCTATGTATGAAAATTGTG

TAACACTATGCTCATGCTAAGAACCGACTTAACAGAATTACTGAAATAAATGTGCTGTGAGGAATGG
Translation
MAA AIDCKQKKSRSRSGSKKKMLTLPHGADEVYILRCR RFCGLVFRGPLSVQEDWIKHLQRHIVNANLPRTGAGMVEVTSLLKKPASITETSFSLLMA

EAAS
Transcript ENSMUST00000112695
Sequence
GCGTGTGACGCGGGGACGCCGCGCGCTCCCAACGTCGCCCCGGTTTGACGCACACGGCACCAAACT - UNI9369 - - UNI22080 - - UNI298

30 - GCTTGATTTAAATTTGGATGAGATTATTCTTGCATCAAGATGTTAATAAGCCAAAATTTAG - UNI9369 - - UNI22951 - CCATAGAT

TGTAAGCAGAAGAAATCAAGGTCAAGATCTGGAAGCAAGAAGAAAATGCTAACGTTGCCTCATGGTGCTGACGAGGTTTACATTCTCCGATGCAG GTTT

TGTGGCCTAGTCTTTCGGGGACCATTGTCTGTTCAGGAAGACTGGATTAAGCACTTACAGCGTCACATTGTAAACGCTAATCTTCCACGGACTGGAGCTG

GCATGGTGGAAGTCACATCACTACTTAAAAAGCCTGCCTCTATCACAGAAACGTCGTTTTCTTTACTAATGGCAGAAGCAGCATCATAGAACCAGGAATC

CTTTTCAATAGCAAATTTAATTGGATGTAAATTTAAAATTTGTGTCTTTTTTTTGTAAGCCACATGAAAGTATCCATTATAAATACTAAAGTAGGAAGAA

TGAGGGACCGTAAATTAGAGTGGCATCGGAGCAAACAATACTTCAGACAAGACAGTAAGTAGTCATATATTTTATATAGGGTGGAGATGTGTTCTTAAGG

TTTACTAAGTTTTGTTGGCTGAGTTTACTCAACTAAAGGTCCTACATCTGAGAGCCATTTGTAAAGTGTTGCACATGAATCCTTACAGACAGACTTACTG

AAAGATTATGTTCTCTACAGTGTTACCAGAATCAAGGCTCTGGTTTTTCCCCACACATAGAAAAATAAGAAATTATATTTTGTTGGTATGTATTTAGTGT

TTTGTATAATACCAGGAACTGCTAACTAAATTTACTCAACTTAGGGCATTAAATATCATGTACTTCATAGTTTGAGACTGTTCCCTCAAATAGGGCAGAG

TACTATTCTATCTAGATGTGTTAAGTGTTTTTTTAAAATCATAATGGAACGGTTTTTTTTTATATATATATACATATATATATATATATACTAAAAAGTT

GGAGCGAGATTTGTTTAAACAAGTATTTCTAAAAGAAATATTGTACATAGTCCTGGAAATTATTTGTGGTAAGGAAATATTCTTTAATCCAGTTGCATTT

CTCAGACAATGAAGTGGTGCGTCCATGCTACCTCCTGCTTTGTCAACAAAGATGCTATTTACCCTTTCCATTTGTATCATAATAGATTTTAAAAATCTAA

TGTTCTTTATTGCAAGACATACTTTTGTTAACAGATTTGTTTCTTTGTAACGTTTTCCATACGTTTGACATGCTTACAGGACAGGGTTGTCTTTATTTAA

CATTGTAGAAATGTAATTAATAAACAAGGCTCACTACACAATTTAGAATAGGCTTTCTCATTTATATTCCAAATTTGATCATTTAGCAAAACTATTGATA

CACAAAATATTTCTACATATGAGAATGTTTACAATTTGAATTTTAGAAGTTGTTTTTGGATGTGATTCTATGTATGAAAATTGTGTAACACTATGCTCAT

GCTAAGAACCGACTTAACAGAATTACTGAAATAAATGTGCTGTGAGGAATGGACAGTACGGTGCAGGTGTCTTGGTCATGATAAACTGTGATGATTCTTT

TAAACACTTTCCAAAAACAACTTAGTTCCTTTCATCCTGAATGAGCGTCGTTTACAAACAGCAGTTTGTATGCAAGCACCATTCCGCTTCATTTCATGGT

GTTGCTAATATAGTTGAACCAAGGATATGCATTGATACTTTTCATAATTTGTAAATAAAGTTAAAAACAGTTAAAGGAGTGTTTGGTAGAGGTATATGTA

TATATACCTCACTGCCAGTGAAATTACTTTCCTATGGTATATCTCCTTGCCAGAAATCACTAAATAAAAAGACTTCAAGAA
Translation
 - UNI9369 - - UNI22080 - - UNI29830 - MLISQNLA - UNI9369 - - UNI22951 - AIDCKQKKSRSRSGSKKKMLTLPHGAD

EVYILRCR RFCGLVFRGPLSVQEDWIKHLQRHIVNANLPRTGAGMVEVTSLLKKPASITETSFSLLMAEAAS
Transcript ENSMUST00000045466
Sequence
AGTCAGGCGGCGCCCCGTGCGCGGCTAGGCTACTCTGTCCGGGCCTGTAGCCCCGGCCCTGGAGGTAACTGTCCACACCCCTCCCCTGACTTTGGGACCA

GAGCGCATAGCCTTCCCCTTCTTCCCACTGGTCTGCAACATCTTGTGCCGCTAAGTGCCTGAGAAGTAACTCCAAGAG - UNI9369 - - UNI2208

0 - - UNI29830 - GCTTGATTTAAATTTGGATGAGATTATTCTTGCATCAAGATGTTAATAAGCCAAAATTTAG - UNI9369 - - UNI2295

1 - ACTAAAGGTGTTAAATGATCTTGCCAACAATATGGATGATTTGAAGATAAACACCGACATTACTGGTGCTAAAGAAGAACTCCAAGATGACAACAA

TTTTATCTCTGAGAAAGACAGTGGAGTTCATAAACCAAAAGATTGTCAGACATCATTTCAGAAAAACAGTTCATTGACTCGATCTGAGGAATTGTCAGAG

GATCAATCAGAACAAGCCTTAAGTGGAGGCCAGTCTGCTTTGTTTCTCCCTGCCAGCACTCCTGCTGTTCCTACTGAAAACTTTCCCTTGCCCACAGGAG

CTGTTGTTAATGGACCAGTCTCATGCTCCTCCTCCACAAAGACTTCCAATATGAATGAAGGTAGTGTTTCATTAACCCCTGGACAGCCTGCAGATCAGCT

AGCAGCAGAGTCTTGCTCCACTTTGAAGGCAGCAGCTGATCATCAGCTGTCTACACCACAAAAAGCAAGTCAACACCAAGTTCTGTTTTTGTTATCAGAT

GTAGCACATGCTAAGAATCCAACCCATTCCATTAAAAAAGTACCTACCTCTGCTTTAGTTGGTTGTGATGTTCAGAATTCAGTAGGGAATAACATGAAGT

CAGAGAGCACTTTACTAAGTCAAGCAGAGGTGGGTCAGGGCGACGCCTCCACAGTGGTCAGAGACGACTGTGTCAGCGCGTTAGCAGTGATTTCCTCAGG

TACAGACGAATTTAGGTCAGAAAATGATACAAACTGGGATCCCCAAAAAGAGTTCATTCAGTTTCTTATGACTAGTGAAGAGACGGTGGATAAGCCCCCA

GCTCATTCTAAAGTAGTAGGTCTAGAAAAAAAGAGAAAGAGAAAAATGGATGTGAGCAAGATCACTCGCTACACAGAGGACTGCTACAGTGACTCAGGCC

GTGCACCTGGAAAATCAAAAATTCTTCAGGTTGACTTTCTAGGGCAAAACGAGGAGATGCAAGCAATAGACTCACAGAACTACACATTATCAAAAGTGAA

ACCCGAGTCAGCTGGTGGAGACTTGGAGTCTGTGGACACTTTTCAGCATCTAGTTTATAACTCAGATAAATGTGGAGAGGATAATTCACCTGTTCATACT

CGCACTTTAATTTCAAATACCTTAAAAAAGAAATGTGAAGAGAGTGATCCTGAGTCACCTGTTGCTTTCAGTACTGAAGAGCCATCATTCTACCCCTGTA

CAAAGTGCAATGTGAATTTTAGGGAGAAAAAGCATCTCCACAGGCATATGATGTATCATTTAGATGGGAATAGTCACTTTCGCCACCTTAATGTCCCCAG

GCCATATGCTTGTAGAGAATGTGGACGGACATTTCGAGATCGTAATTCACTACTAAAGCATATGATCATTCACCAAGAAAGACGGCAGAAGCTGATGGAA

GAGATTCGTGAGCTGAAAGAGCTCCAGGATGAAGGCAGAAGTGCTCGACTCCAGTGCCCTCAGTGTGTGTTTGGTACCAATTGCCCTAAGACGTTTGTGC

AACATGCAAAAACCCATGAGAAAGACAAACGGTACTACTGCTGTGAGGAGTGTAACTTCATGGCAGTGACGGAGAATGAGCTGGAATGCCATAGGGGCAT

CGCCCACGGAGCAGCAGTGAAGTGTCCTGTTGTGAGTTCAGAAGTAACTCAGAGAAAAACACAAAAGAAGACTTCAGTGAAAGACTCTGTTATAGGATCA

TCCAAAAAACCTGCTACTTACCTATGTAAGATGTGTCCCTTCACTACTTCAGCCAGAAGTATTCTGAAGAAGCACACGGAGTATTTGCATTCCTCGGCGT

GTGTTGACTCCTTTGGTAATCCACTGGGACTTGACAAAAGAAAAAATGACAGCCTCGAGGAGTCTGTAGATGTCGATAGCACCAAGTCATTAGCTAAGCA

GCAGCCAAGTACATTTCCAAAGAACTCTGCTTTAAAACAGGATGCTAAACGGACATTTGGATCAAGCTCACAGTCAAGTAATTTTTCAAAATTTCATAAG

CGGCCACATAGAATACAAAAAGCCCGGAAAAGCATTGCCCAATCTGGTGTAAATTCGTGCAGTCAAAACAAGTCTCCTCACAAGAACGTTATGGTTAAGA

GCAGCACTGACCAACAACCAAAGTATTTCCATCAGGCCCCAAGAGAAAAACCTAACGCCAGGGCAGACAGCAGTTATTTATATAGACACAAGTATAACAA

CTACCGGACGATCAGAAAATCAG ACCCTCATAATGCAGACACCAAAAGGCCAGAAAACGAGAAAGACCACAAGCGTGTAGCTGTGAAAAGAGTAGCTAA

GGCCTCAAAGAAGGAAAGCTCTGCTGGAGAGGACTTGGATAGCTATCCCGACTTTCTGCATAAAATGACTGTTGTTGTTTTGCAAAAGCTTCATTCTGAT

AAGAAAGATAGTTACGAAACAGAAGATGACAGCTCCTGGGATAACGTTGAGTTAGGTGACTACACTACACAGGCCATGGAAGAAGAAGCCTACAGTGACC

TTAGTCAAGAACATGTAAACTTATTGCCCCTGTTTAAAAGCAAGATAGAGGGCCAGGGCCCTGGAGACAGTGCTGCCCTGAGTTACGATCAGAATGATGG

CTTCTACTTTGAATATTATGAAGACGGTGGCACTAACAGCTTTTTACAGGATATACATGATCCTCAGCATTTGGAAAACCCAGAAACGCCTTTGTCAAAG

CATAGTTCTGTTTTTCATTGGACTGATTTGTCTCTTGAGAAGAAGTCATGTCCTTATTGCCCAGCAACATTTGAAACAGGTGTTGGGTTGTCAAATCATG

TCCGAGGACATCTTCACAGAGCAGGATTGAGCTATGAAGCCCGTCATGTTGTATCACCAGAACAAATAGCCACAAGTGACAAGATGCAGCACTTCAAAAG

AACTGGCAACGGGACGCCTGTGAAACGAGTTAGAAAAG CTATAGAGAAGTCTGAAACTACTTCCGAACATACTTGTCAGCTCTGTGGTGGTTGGTTTGA

CACAAAGATTGGGTTATCAAATCATGTCAGAGGCCATCTGAAAAGACTTGGGAAAACTAAATGGGATGCTCACAAATCTCCAATCTGTGTTCTGAATGAG

ATGATGCAAAACGAAGAGAAGTATGAAAAGATCCTGAAGGCGCTCAACAGTCGCCGCATTATCCCCAGACCGTTTGTAGCTCAGAAACTCTCCTCAGGCG

ATGACTTCCTATCTCACAATGTCTTACCTCTTGATGAATACCACAATGGCCTAAAGACAGAGGCTCTCTCAGTGTCTGCATCAGAGGAAGAAGGGCTGCA

TTTCTTAAGTGAGTGTGGTGAAAGAAAGCCTGAACTGCCCAGTGGGAGAAAGAACCAGTCTCTTACACTGATAGAACTTCTTAAAAGTAGAAGGCTAGGC

GAAGAAAGGAATTCTGCAGTCTCTCCTCACAAGACCCATAACCAGACAGCAAGAAAGAGATTTGTTCAGAAATGTGTTCTTCCATTAAACGAAGACAGTC

CGTTGATCTATCAGCCACAAAAAATGGACTTGACTGTGCACTCAG CCATAGATTGTAAGCAGAAGAAATCAAGGTCAAGATCTGGAAGCAAGAAGAAAA

TGCTAACGTTGCCTCATGGTGCTGACGAGGTTTACATTCTCCGATGCAG GTTTTGTGGCCTAGTCTTTCGGGGACCATTGTCTGTTCAGGAAGACTGGA

TTAAGCACTTACAGCGTCACATTGTAAACGCTAATCTTCCACGGACTGGAGCTGGCATGGTGGAAGTCACATCACTACTTAAAAAGCCTGCCTCTATCAC

AGAAACGTCGTTTTCTTTACTAATGGCAGAAGCAGCATCATAGAACCAGGAATCCTTTTCAATAGCAAATTTAATTGGATGTAAATTTAAAATTTGTGTC

TTTTTTTTGTAAGCCACATGAAAGTATCCATTATAAATACTAAAGTAGGAAGAATGAGGGACCGTAAATTAGAGTGGCATCGGAGCAAACAATACTTCAG

ACAAGACAGTAAGTAGTCATATATTTTATATAGGGTGGAGATGTGTTCTTAAGGTTTACTAAGTTTTGTTGGCTGAGTTTACTCAACTAAAGGTCCTACA

TCTGAGAGCCATTTGTAAAGTGTTGCACATGAATCCTTACAGACAGACTTACTGAAAGATTATGTTCTCTACAGTGTTACCAGAATCAAGGCTCTGGTTT

TTCCCCACACATAGAAAAATAAGAAATTATATTTTGTTGGTATGTATTTAGTGTTTTGTATAATACCAGGAACTGCTAACTAAATTTACTCAACTTAGGG

CATTAAATATCATGTACTTCATAGTTTGAGACTGTTCCCTCAAATAGGGCAGAGTACTATTCTATCTAGATGTGTTAAGTGTTTTTTTAAAATCATAATG

GAACGGTTTTTTTTTATATATATATACATATATATATATATATACTAAAAAGTTGGAGCGAGATTTGTTTAAACAAGTATTTCTAAAAGAAATATTGTAC

ATAGTCCTGGAAATTATTTGTGGTAAGGAAATATTCTTTAATCCAGTTGCATTTCTCAGACAATGAAGTGGTGCGTCCATGCTACCTCCTGCTTTGTCAA

CAAAGATGCTATTTACCCTTTCCATTTGTATCATAATAGATTTTAAAAATCTAATGTTCTTTATTGCAAGACATACTTTTGTTAACAGATTTGTTTCTTT

GTAACGTTTTCCATACGTTTGACATGCTTACAGGACAGGGTTGTCTTTATTTAACATTGTAGAAATGTAATTAATAAACAAGGCTCACTACACAATTTAG

AATAGGCTTTCTCATTTATATTCCAAATTTGATCATTTAGCAAAACTATTGATACACAAAATATTTCTACATATGAGAATGTTTACAATTTGAATTTTAG

AAGTTGTTTTTGGATGTGATTCTATGTATGAAAATTGTGTAACACTATGCTCATGCTAAGAACCGACTTAACAGAATTACTGAAATAAATGTGCTGTGAG

GAATGGACAGTACGGTGCAGGTGTCTTGGTCATGATAAACTGTGATGATTCTTTTAAACACTTTCCAAAAACAACTTAGTTCCTTTCATCCTGAATGAGC

GTCGTTTACAAACAGCAGTTTGTATGCAAGCACCATTCCGCTTCATTTCATGGTGTTGCTAATATAGTTGAACCAAGGATATGCATTGATACTTTTCATA

ATTTGTAAATAAAGTTAAAAACAGTTAAAGGAGTGTTTGGTAGAGGTATATGTATATATACCTCACTGCCAGTGAAATTACTTTCCTATGGTATATCTCC

TTGCCAGAAATCACTAAATAAAAAGACTTCAAGAATTA
Translation
 - UNI9369 - - UNI22080 - - UNI29830 - MRLFLHQDVNKPKFR - UNI9369 - - UNI22951 - RLKVLNDLANNMDDLKINTD

ITGAKEELQDDNNFISEKDSGVHKPKDCQTSFQKNSSLTRSEELSEDQSEQALSGGQSALFLPASTPAVPTENFPLPTGAVVNGPVSCSSSTKTSNMNEG

SVSLTPGQPADQLAAESCSTLKAAADHQLSTPQKASQHQVLFLLSDVAHAKNPTHSIKKVPTSALVGCDVQNSVGNNMKSESTLLSQAEVGQGDASTVVR

DDCVSALAVISSGTDEFRSENDTNWDPQKEFIQFLMTSEETVDKPPAHSKVVGLEKKRKRKMDVSKITRYTEDCYSDSGRAPGKSKILQVDFLGQNEEMQ

AIDSQNYTLSKVKPESAGGDLESVDTFQHLVYNSDKCGEDNSPVHTRTLISNTLKKKCEESDPESPVAFSTEEPSFYPCTKCNVNFREKKHLHRHMMYHL

DGNSHFRHLNVPRPYACRECGRTFRDRNSLLKHMIIHQERRQKLMEEIRELKELQDEGRSARLQCPQCVFGTNCPKTFVQHAKTHEKDKRYYCCEECNFM

AVTENELECHRGIAHGAAVKCPVVSSEVTQRKTQKKTSVKDSVIGSSKKPATYLCKMCPFTTSARSILKKHTEYLHSSACVDSFGNPLGLDKRKNDSLEE

SVDVDSTKSLAKQQPSTFPKNSALKQDAKRTFGSSSQSSNFSKFHKRPHRIQKARKSIAQSGVNSCSQNKSPHKNVMVKSSTDQQPKYFHQAPREKPNAR

ADSSYLYRHKYNNYRTIRKSD DPHNADTKRPENEKDHKRVAVKRVAKASKKESSAGEDLDSYPDFLHKMTVVVLQKLHSDKKDSYETEDDSSWDNVELG

DYTTQAMEEEAYSDLSQEHVNLLPLFKSKIEGQGPGDSAALSYDQNDGFYFEYYEDGGTNSFLQDIHDPQHLENPETPLSKHSSVFHWTDLSLEKKSCPY

CPATFETGVGLSNHVRGHLHRAGLSYEARHVVSPEQIATSDKMQHFKRTGNGTPVKRVRKA AIEKSETTSEHTCQLCGGWFDTKIGLSNHVRGHLKRLG

KTKWDAHKSPICVLNEMMQNEEKYEKILKALNSRRIIPRPFVAQKLSSGDDFLSHNVLPLDEYHNGLKTEALSVSASEEEGLHFLSECGERKPELPSGRK

NQSLTLIELLKSRRLGEERNSAVSPHKTHNQTARKRFVQKCVLPLNEDSPLIYQPQKMDLTVHSA AIDCKQKKSRSRSGSKKKMLTLPHGADEVYILRC

R RFCGLVFRGPLSVQEDWIKHLQRHIVNANLPRTGAGMVEVTSLLKKPASITETSFSLLMAEAAS
Transcript ENSMUST00000112696
Sequence
GTTTGGTTTTGGCACGGGAGAGCAGCGGTGCAGCGTTGCTGCCGCCCCCCGTGGGTCTGATTGGCACGGGAGCTCCGGCGGCCCGAGAGCACGGGCGCGC

CTCGCTGGCTTCCCCCGGCGGCCGGCGGCCAGGCAGAGGCGGGAAAGCCGCGCGCCTGCGCCGTGGGAACCGAGGCCGGAGGCGAGAAGCGGGGAGCGGA

GGGGGCCGTTGGAGCCGAGTAGCGTACAGAGCGGCGTGTGACGCGGGGACGCCGCGCGCTCCCAACGTCGCCCCGGTTTGACGCACACGGCACCAAACT 

- UNI9369 - - UNI22080 - - UNI29830 - GCTTGATTTAAATTTGGATGAGATTATTCTTGCATCAAGATGTTAATAAGCCAAAATTTAG 

- UNI9369 - - UNI22951 - ACTAAAGGTGTTAAATGATCTTGCCAACAATATGGATGATTTGAAGATAAACACCGACATTACTGGTGCTAAAGA

AGAACTCCAAGATGACAACAATTTTATCTCTGAGAAAGACAGTGGAGTTCATAAACCAAAAGATTGTCAGACATCATTTCAGAAAAACAGTTCATTGACT

CGATCTGAGGAATTGTCAGAGGATCAATCAGAACAAGCCTTAAGTGGAGGCCAGTCTGCTTTGTTTCTCCCTGCCAGCACTCCTGCTGTTCCTACTGAAA

ACTTTCCCTTGCCCACAGGAGCTGTTGTTAATGGACCAGTCTCATGCTCCTCCTCCACAAAGACTTCCAATATGAATGAAGGTAGTGTTTCATTAACCCC

TGGACAGCCTGCAGATCAGCTAGCAGCAGAGTCTTGCTCCACTTTGAAGGCAGCAGCTGATCATCAGCTGTCTACACCACAAAAAGCAAGTCAACACCAA

GTTCTGTTTTTGTTATCAGATGTAGCACATGCTAAGAATCCAACCCATTCCATTAAAAAAGTACCTACCTCTGCTTTAGTTGGTTGTGATGTTCAGAATT

CAGTAGGGAATAACATGAAGTCAGAGAGCACTTTACTAAGTCAAGCAGAGGTGGGTCAGGGCGACGCCTCCACAGTGGTCAGAGACGACTGTGTCAGCGC

GTTAGCAGTGATTTCCTCAGGTACAGACGAATTTAGGTCAGAAAATGATACAAACTGGGATCCCCAAAAAGAGTTCATTCAGTTTCTTATGACTAGTGAA

GAGACGGTGGATAAGCCCCCAGCTCATTCTAAAGTAGTAGGTCTAGAAAAAAAGAGAAAGAGAAAAATGGATGTGAGCAAGATCACTCGCTACACAGAGG

ACTGCTACAGTGACTCAGGCCGTGCACCTGGAAAATCAAAAATTCTTCAGGTTGACTTTCTAGGGCAAAACGAGGAGATGCAAGCAATAGACTCACAGAA

CTACACATTATCAAAAGTGAAACCCGAGTCAGCTGGTGGAGACTTGGAGTCTGTGGACACTTTTCAGCATCTAGTTTATAACTCAGATAAATGTGGAGAG

GATAATTCACCTGTTCATACTCGCACTTTAATTTCAAATACCTTAAAAAAGAAATGTGAAGAGAGTGATCCTGAGTCACCTGTTGCTTTCAGTACTGAAG

AGCCATCATTCTACCCCTGTACAAAGTGCAATGTGAATTTTAGGGAGAAAAAGCATCTCCACAGGCATATGATGTATCATTTAGATGGGAATAGTCACTT

TCGCCACCTTAATGTCCCCAGGCCATATGCTTGTAGAGAATGTGGACGGACATTTCGAGATCGTAATTCACTACTAAAGCATATGATCATTCACCAAGAA

AGACGGCAGAAGCTGATGGAAGAGATTCGTGAGCTGAAAGAGCTCCAGGATGAAGGCAGAAGTGCTCGACTCCAGTGCCCTCAGTGTGTGTTTGGTACCA

ATTGCCCTAAGACGTTTGTGCAACATGCAAAAACCCATGAGAAAGACAAACGGTACTACTGCTGTGAGGAGTGTAACTTCATGGCAGTGACGGAGAATGA

GCTGGAATGCCATAGGGGCATCGCCCACGGAGCAGCAGTGAAGTGTCCTGTTGTGAGTTCAGAAGTAACTCAGAGAAAAACACAAAAGAAGACTTCAGTG

AAAGACTCTGTTATAGGATCATCCAAAAAACCTGCTACTTACCTATGTAAGATGTGTCCCTTCACTACTTCAGCCAGAAGTATTCTGAAGAAGCACACGG

AGTATTTGCATTCCTCGGCGTGTGTTGACTCCTTTGGTAATCCACTGGGACTTGACAAAAGAAAAAATGACAGCCTCGAGGAGTCTGTAGATGTCGATAG

CACCAAGTCATTAGCTAAGCAGCAGCCAAGTACATTTCCAAAGAACTCTGCTTTAAAACAGGATGCTAAACGGACATTTGGATCAAGCTCACAGTCAAGT

AATTTTTCAAAATTTCATAAGCGGCCACATAGAATACAAAAAGCCCGGAAAAGCATTGCCCAATCTGGTGTAAATTCGTGCAGTCAAAACAAGTCTCCTC

ACAAGAACGTTATGGTTAAGAGCAGCACTGACCAACAACCAAAGTATTTCCATCAGGCCCCAAGAGAAAAACCTAACGCCAGGGCAGACAGCAGTTATTT

ATATAGACACAAGTATAACAACTACCGGACGATCAGAAAATCAGGTGACTCATACCCACTTCCTTTCAAAAAAGAGGTTAATTCATTAAACTCTTTACAT

CTATTTTCATCAAGTAACTCTCATAATTTTATTTCAGACCCTCATAATGCAGACACCAAAAGGCCAGAAAACGAGAAAGACCACAAGCGTGTAGCTGTGA

AAAGAGTAGCTAAGGCCTCAAAGAAGGAAAGCTCTGCTGGAGAGGACTTGGATAGCTATCCCGACTTTCTGCATAAAATGACTGTTGTTGTTTTGCAAAA

GCTTCATTCTGATAAGAAAGATAGTTACGAAACAGAAGATGACAGCTCCTGGGATAACGTTGAGTTAGGTGACTACACTACACAGGCCATGGAAGAAGAA

GCCTACAGTGACCTTAGTCAAGAACATGTAAACTTATTGCCCCTGTTTAAAAGCAAGATAGAGGGCCAGGGCCCTGGAGACAGTGCTGCCCTGAGTTACG

ATCAGAATGATGGCTTCTACTTTGAATATTATGAAGACGGTGGCACTAACAGCTTTTTACAGGATATACATGATCCTCAGCATTTGGAAAACCCAGAAAC

GCCTTTGTCAAAGCATAGTTCTGTTTTTCATTGGACTGATTTGTCTCTTGAGAAGAAGTCATGTCCTTATTGCCCAGCAACATTTGAAACAGGTGTTGGG

TTGTCAAATCATGTCCGAGGACATCTTCACAGAGCAGGATTGAGCTATGAAGCCCGTCATGTTGTATCACCAGAACAAATAGCCACAAGTGACAAGATGC

AGCACTTCAAAAGAACTGGCAACGGGACGCCTGTGAAACGAGTTAGAAAAG CTATAGAGAAGTCTGAAACTACTTCCGAACATACTTGTCAGCTCTGTG

GTGGTTGGTTTGACACAAAGATTGGGTTATCAAATCATGTCAGAGGCCATCTGAAAAGACTTGGGAAAACTAAATGGGATGCTCACAAATCTCCAATCTG

TGTTCTGAATGAGATGATGCAAAACGAAGAGAAGTATGAAAAGATCCTGAAGGCGCTCAACAGTCGCCGCATTATCCCCAGACCGTTTGTAGCTCAGAAA

CTCTCCTCAGGCGATGACTTCCTATCTCACAATGTCTTACCTCTTGATGAATACCACAATGGCCTAAAGACAGAGGCTCTCTCAGTGTCTGCATCAGAGG

AAGAAGGGCTGCATTTCTTAAGTGAGTGTGGTGAAAGAAAGCCTGAACTGCCCAGTGGGAGAAAGAACCAGTCTCTTACACTGATAGAACTTCTTAAAAG

TAGAAGGCTAGGCGAAGAAAGGAATTCTGCAGTCTCTCCTCACAAGACCCATAACCAGACAGCAAGAAAGAGATTTGTTCAGAAATGTGTTCTTCCATTA

AACGAAGACAGTCCGTTGATCTATCAGCCACAAAAAATGGACTTGACTGTGCACTCAG CCATAGATTGTAAGCAGAAGAAATCAAGGTCAAGATCTGGA

AGCAAGAAGAAAATGCTAACGTTGCCTCATGGTGCTGACGAGGTTTACATTCTCCGATGCAG GTTTTGTGGCCTAGTCTTTCGGGGACCATTGTCTGTT

CAGGAAGACTGGATTAAGCACTTACAGCGTCACATTGTAAACGCTAATCTTCCACGGACTGGAGCTGGCATGGTGGAAGTCACATCACTACTTAAAAAGC

CTGCCTCTATCACAGAAACGTCGTTTTCTTTACTAATGGCAGAAGCAGCATCATAGAACCAGGAATCCTTTTCAATAGCAAATTTAATTGGATGTAAATT

TAAAATTTGTGTCTTTTTTTTGTAAGCCACATGAAAGTATCCATTATAAATACTAAAGTAGGAAGAATGAGGGACCGTAAATTAGAGTGGCATCGGAGCA

AACAATACTTCAGACAAGACAGTAAGTAGTCATATATTTTATATAGGGTGGAGATGTGTTCTTAAGGTTTACTAAGTTTTGTTGGCTGAGTTTACTCAAC

TAAAGGTCCTACATCTGAGAGCCATTTGTAAAGTGTTGCACATGAATCCTTACAGACAGACTTACTGAAAGATTATGTTCTCTACAGTGTTACCAGAATC

AAGGCTCTGGTTTTTCCCCACACATAGAAAAATAAGAAATTATATTTTGTTGGTATGTATTTAGTGTTTTGTATAATACCAGGAACTGCTAACTAAATTT

ACTCAACTTAGGGCATTAAATATCATGTACTTCATAGTTTGAGACTGTTCCCTCAAATAGGGCAGAGTACTATTCTATCTAGATGTGTTAAGTGTTTTTT

TAAAATCATAATGGAACGGTTTTTTTTTATATATATATACATATATATATATATATACTAAAAAGTTGGAGCGAGATTTGTTTAAACAAGTATTTCTAAA

AGAAATATTGTACATAGTCCTGGAAATTATTTGTGGTAAGGAAATATTCTTTAATCCAGTTGCATTTCTCAGACAATGAAGTGGTGCGTCCATGCTACCT

CCTGCTTTGTCAACAAAGATGCTATTTACCCTTTCCATTTGTATCATAATAGATTTTAAAAATCTAATGTTCTTTATTGCAAGACATACTTTTGTTAACA

GATTTGTTTCTTTGTAACGTTTTCCATACGTTTGACATGCTTACAGGACAGGGTTGTCTTTATTTAACATTGTAGAAATGTAATTAATAAACAAGGCTCA

CTACACAATTTAGAATAGGCTTTCTCATTTATATTCCAAATTTGATCATTTAGCAAAACTATTGATACACAAAATATTTCTACATATGAGAATGTTTACA

ATTTGAATTTTAGAAGTTGTTTTTGGATGTGATTCTATGTATGAAAATTGTGTAACACTATGCTCATGCTAAGAACCGACTTAACAGAATTACTGAAATA

AATGTGCTGTGAGGAATGGACAGTACGGTGCAGGTGTCTTGGTCATGATAAACTGTGATGATTCTTTTAAACACTTTCCAAAAACAACTTAGTTCCTTTC

ATCCTGAATGAGCGTCGTTTACAAACAGCAGTTTGTATGCAAGCACCATTCCGCTTCATTTCATGGTGTTGCTAATATAGTTGAACCAAGGATATGCATT

GATACTTTTCATAATTTGTAAATAAAGTTAAAAACAGTTAAAGGAGTGTTTGGTAGAGGTATATGTATATATACCTCACTGCCAGTGAAATTACTTTCCT

ATGGTATATCTCCTTGCCAGAAATCACTAAATAAAAAGACTTCAAGAATTACA
Translation
 - UNI9369 - - UNI22080 - - UNI29830 - MRLFLHQDVNKPKFR - UNI9369 - - UNI22951 - RLKVLNDLANNMDDLKINTD

ITGAKEELQDDNNFISEKDSGVHKPKDCQTSFQKNSSLTRSEELSEDQSEQALSGGQSALFLPASTPAVPTENFPLPTGAVVNGPVSCSSSTKTSNMNEG

SVSLTPGQPADQLAAESCSTLKAAADHQLSTPQKASQHQVLFLLSDVAHAKNPTHSIKKVPTSALVGCDVQNSVGNNMKSESTLLSQAEVGQGDASTVVR

DDCVSALAVISSGTDEFRSENDTNWDPQKEFIQFLMTSEETVDKPPAHSKVVGLEKKRKRKMDVSKITRYTEDCYSDSGRAPGKSKILQVDFLGQNEEMQ

AIDSQNYTLSKVKPESAGGDLESVDTFQHLVYNSDKCGEDNSPVHTRTLISNTLKKKCEESDPESPVAFSTEEPSFYPCTKCNVNFREKKHLHRHMMYHL

DGNSHFRHLNVPRPYACRECGRTFRDRNSLLKHMIIHQERRQKLMEEIRELKELQDEGRSARLQCPQCVFGTNCPKTFVQHAKTHEKDKRYYCCEECNFM

AVTENELECHRGIAHGAAVKCPVVSSEVTQRKTQKKTSVKDSVIGSSKKPATYLCKMCPFTTSARSILKKHTEYLHSSACVDSFGNPLGLDKRKNDSLEE

SVDVDSTKSLAKQQPSTFPKNSALKQDAKRTFGSSSQSSNFSKFHKRPHRIQKARKSIAQSGVNSCSQNKSPHKNVMVKSSTDQQPKYFHQAPREKPNAR

ADSSYLYRHKYNNYRTIRKSGDSYPLPFKKEVNSLNSLHLFSSSNSHNFISDPHNADTKRPENEKDHKRVAVKRVAKASKKESSAGEDLDSYPDFLHKMT

VVVLQKLHSDKKDSYETEDDSSWDNVELGDYTTQAMEEEAYSDLSQEHVNLLPLFKSKIEGQGPGDSAALSYDQNDGFYFEYYEDGGTNSFLQDIHDPQH

LENPETPLSKHSSVFHWTDLSLEKKSCPYCPATFETGVGLSNHVRGHLHRAGLSYEARHVVSPEQIATSDKMQHFKRTGNGTPVKRVRKA AIEKSETTS

EHTCQLCGGWFDTKIGLSNHVRGHLKRLGKTKWDAHKSPICVLNEMMQNEEKYEKILKALNSRRIIPRPFVAQKLSSGDDFLSHNVLPLDEYHNGLKTEA

LSVSASEEEGLHFLSECGERKPELPSGRKNQSLTLIELLKSRRLGEERNSAVSPHKTHNQTARKRFVQKCVLPLNEDSPLIYQPQKMDLTVHSA AIDCK

QKKSRSRSGSKKKMLTLPHGADEVYILRCR RFCGLVFRGPLSVQEDWIKHLQRHIVNANLPRTGAGMVEVTSLLKKPASITETSFSLLMAEAAS
Transcript ENSMUST00000112698
Sequence
GTTTGGTTTTGGCACGGGAGAGCAGCGGTGCAGCGTTGCTGCCGCCCCCCGTGGGTCTGATTGGCACGGGAGCTCCGGCGGCCCGAGAGCACGGGCGCGC

CTCGCTGGCTTCCCCCGGCGGCCGGCGGCCAGGCAGAGGCGGGAAAGCCGCGCGCCTGCGCCGTGGGAACCGAGGCCGGAGGCGAGAAGCGGGGAGCGGA

GGGGGCCGTTGGAGCCGAGTAGCGTACAGAGCGGCGTGTGACGCGGGGACGCCGCGCGCTCCCAACGTCGCCCCGGTTTGACGCACACGGCACCAAACT 

- UNI9369 - - UNI22080 - - UNI29830 - GCTTGATTTAAATTTGGATGAGATTATTCTTGCATCAAGATGTTAATAAGCCAAAATTTAG 

- UNI9369 - - UNI22951 - ACTAAAGGTGTTAAATGATCTTGCCAACAATATGGATGATTTGAAGATAAACACCGACATTACTGGTGCTAAAGA

AGAACTCCAAGATGACAACAATTTTATCTCTGAGAAAGACAGTGGAGTTCATAAACCAAAAGATTGTCAGACATCATTTCAGAAAAACAGTTCATTGACT

CGATCTGAGGAATTGTCAGAGGATCAATCAGAACAAGCCTTAAGTGGAGGCCAGTCTGCTTTGTTTCTCCCTGCCAGCACTCCTGCTGTTCCTACTGAAA

ACTTTCCCTTGCCCACAGGAGCTGTTGTTAATGGACCAGTCTCATGCTCCTCCTCCACAAAGACTTCCAATATGAATGAAGGTAGTGTTTCATTAACCCC

TGGACAGCCTGCAGATCAGCTAGCAGCAGAGTCTTGCTCCACTTTGAAGGCAGCAGCTGATCATCAGCTGTCTACACCACAAAAAGCAAGTCAACACCAA

GTTCTGTTTTTGTTATCAGATGTAGCACATGCTAAGAATCCAACCCATTCCATTAAAAAAGTACCTACCTCTGCTTTAGTTGGTTGTGATGTTCAGAATT

CAGTAGGGAATAACATGAAGTCAGAGAGCACTTTACTAAGTCAAGCAGAGGTGGGTCAGGGCGACGCCTCCACAGTGGTCAGAGACGACTGTGTCAGCGC

GTTAGCAGTGATTTCCTCAGGTACAGACGAATTTAGGTCAGAAAATGATACAAACTGGGATCCCCAAAAAGAGTTCATTCAGTTTCTTATGACTAGTGAA

GAGACGGTGGATAAGCCCCCAGCTCATTCTAAAGTAGTAGGTCTAGAAAAAAAGAGAAAGAGAAAAATGGATGTGAGCAAGATCACTCGCTACACAGAGG

ACTGCTACAGTGACTCAGGCCGTGCACCTGGAAAATCAAAAATTCTTCAGGTTGACTTTCTAGGGCAAAACGAGGAGATGCAAGCAATAGACTCACAGAA

CTACACATTATCAAAAGTGAAACCCGAGTCAGCTGGTGGAGACTTGGAGTCTGTGGACACTTTTCAGCATCTAGTTTATAACTCAGATAAATGTGGAGAG

GATAATTCACCTGTTCATACTCGCACTTTAATTTCAAATACCTTAAAAAAGAAATGTGAAGAGAGTGATCCTGAGTCACCTGTTGCTTTCAGTACTGAAG

AGCCATCATTCTACCCCTGTACAAAGTGCAATGTGAATTTTAGGGAGAAAAAGCATCTCCACAGGCATATGATGTATCATTTAGATGGGAATAGTCACTT

TCGCCACCTTAATGTCCCCAGGCCATATGCTTGTAGAGAATGTGGACGGACATTTCGAGATCGTAATTCACTACTAAAGCATATGATCATTCACCAAGAA

AGACGGCAGAAGCTGATGGAAGAGATTCGTGAGCTGAAAGAGCTCCAGGATGAAGGCAGAAGTGCTCGACTCCAGTGCCCTCAGTGTGTGTTTGGTACCA

ATTGCCCTAAGACGTTTGTGCAACATGCAAAAACCCATGAGAAAGACAAACGGTACTACTGCTGTGAGGAGTGTAACTTCATGGCAGTGACGGAGAATGA

GCTGGAATGCCATAGGGGCATCGCCCACGGAGCAGCAGTGAAGTGTCCTGTTGTGAGTTCAGAAGTAACTCAGAGAAAAACACAAAAGAAGACTTCAGTG

AAAGACTCTGTTATAGGATCATCCAAAAAACCTGCTACTTACCTATGTAAGATGTGTCCCTTCACTACTTCAGCCAGAAGTATTCTGAAGAAGCACACGG

AGTATTTGCATTCCTCGGCGTGTGTTGACTCCTTTGGTAATCCACTGGGACTTGACAAAAGAAAAAATGACAGCCTCGAGGAGTCTGTAGATGTCGATAG

CACCAAGTCATTAGCTAAGCAGCAGCCAAGTACATTTCCAAAGAACTCTGCTTTAAAACAGGATGCTAAACGGACATTTGGATCAAGCTCACAGTCAAGT

AATTTTTCAAAATTTCATAAGCGGCCACATAGAATACAAAAAGCCCGGAAAAGCATTGCCCAATCTGGTGTAAATTCGTGCAGTCAAAACAAGTCTCCTC

ACAAGAACGTTATGGTTAAGAGCAGCACTGACCAACAACCAAAGTATTTCCATCAGGCCCCAAGAGAAAAACCTAACGCCAGGGCAGACAGCAGTTATTT

ATATAGACACAAGTATAACAACTACCGGACGATCAGAAAATCAG ACCCTCATAATGCAGACACCAAAAGGCCAGAAAACGAGAAAGACCACAAGCGTGT

AGCTGTGAAAAGAGTAGCTAAGGCCTCAAAGAAGGAAAGCTCTGCTGGAGAGGACTTGGATAGCTATCCCGACTTTCTGCATAAAATGACTGTTGTTGTT

TTGCAAAAGCTTCATTCTGATAAGAAAGATAGTTACGAAACAGAAGATGACAGCTCCTGGGATAACGTTGAGTTAGGTGACTACACTACACAGGCCATGG

AAGAAGAAGCCTACAGTGACCTTAGTCAAGAACATGTAAACTTATTGCCCCTGTTTAAAAGCAAGATAGAGGGCCAGGGCCCTGGAGACAGTGCTGCCCT

GAGTTACGATCAGAATGATGGCTTCTACTTTGAATATTATGAAGACGGTGGCACTAACAGCTTTTTACAGGATATACATGATCCTCAGCATTTGGAAAAC

CCAGAAACGCCTTTGTCAAAGCATAGTTCTGTTTTTCATTGGACTGATTTGTCTCTTGAGAAGAAGTCATGTCCTTATTGCCCAGCAACATTTGAAACAG

GTGTTGGGTTGTCAAATCATGTCCGAGGACATCTTCACAGAGCAGGATTGAGCTATGAAGCCCGTCATGTTGTATCACCAGAACAAATAGCCACAAGTGA

CAAGATGCAGCACTTCAAAAGAACTGGCAACGGGACGCCTGTGAAACGAGTTAGAAAAG CTATAGAGAAGTCTGAAACTACTTCCGAACATACTTGTCA

GCTCTGTGGTGGTTGGTTTGACACAAAGATTGGGTTATCAAATCATGTCAGAGGCCATCTGAAAAGACTTGGGAAAACTAAATGGGATGCTCACAAATCT

CCAATCTGTGTTCTGAATGAGATGATGCAAAACGAAGAGAAGTATGAAAAGATCCTGAAGGCGCTCAACAGTCGCCGCATTATCCCCAGACCGTTTGTAG

CTCAGAAACTCTCCTCAGGCGATGACTTCCTATCTCACAATGTCTTACCTCTTGATGAATACCACAATGGCCTAAAGACAGAGGCTCTCTCAGTGTCTGC

ATCAGAGGAAGAAGGGCTGCATTTCTTAAGTGAGTGTGGTGAAAGAAAGCCTGAACTGCCCAGTGGGAGAAAGAACCAGTCTCTTACACTGATAGAACTT

CTTAAAAGTAGAAGGCTAGGCGAAGAAAGGAATTCTGCAGTCTCTCCTCACAAGACCCATAACCAGACAGCAAGAAAGAGATTTGTTCAGAAATGTGTTC

TTCCATTAAACGAAGACAGTCCGTTGATCTATCAGCCACAAAAAATGGACTTGACTGTGCACTCAG CCATAGATTGTAAGCAGAAGAAATCAAGGTCAA

GATCTGGAAGCAAGAAGAAAATGCTAACGTTGCCTCATGGTGCTGACGAGGTTTACATTCTCCGATGCAG GTTTTGTGGCCTAGTCTTTCGGGGACCAT

TGTCTGTTCAGGAAGACTGGATTAAGCACTTACAGCGTCACATTGTAAACGCTAATCTTCCACGGACTGGAGCTGGCATGGTGGAAGTCACATCACTACT

TAAAAAGCCTGCCTCTATCACAGAAACGTCGTTTTCTTTACTAATGGCAGAAGCAGCATCATAGAACCAGGAATCCTTTTCAATAGCAAATTTAATTGGA

TGTAAATTTAAAATTTGTGTCTTTTTTTTGTAAGCCACATGAAAGTATCCATTATAAATACTAAAGTAGGAAGAATGAGGGACCGTAAATTAGAGTGGCA

TCGGAGCAAACAATACTTCAGACAAGACAGTAAGTAGTCATATATTTTATATAGGGTGGAGATGTGTTCTTAAGGTTTACTAAGTTTTGTTGGCTGAGTT

TACTCAACTAAAGGTCCTACATCTGAGAGCCATTTGTAAAGTGTTGCACATGAATCCTTACAGACAGACTTACTGAAAGATTATGTTCTCTACAGTGTTA

CCAGAATCAAGGCTCTGGTTTTTCCCCACACATAGAAAAATAAGAAATTATATTTTGTTGGTATGTATTTAGTGTTTTGTATAATACCAGGAACTGCTAA

CTAAATTTACTCAACTTAGGGCATTAAATATCATGTACTTCATAGTTTGAGACTGTTCCCTCAAATAGGGCAGAGTACTATTCTATCTAGATGTGTTAAG

TGTTTTTTTAAAATCATAATGGAACGGTTTTTTTTTATATATATATACATATATATATATATATACTAAAAAGTTGGAGCGAGATTTGTTTAAACAAGTA

TTTCTAAAAGAAATATTGTACATAGTCCTGGAAATTATTTGTGGTAAGGAAATATTCTTTAATCCAGTTGCATTTCTCAGACAATGAAGTGGTGCGTCCA

TGCTACCTCCTGCTTTGTCAACAAAGATGCTATTTACCCTTTCCATTTGTATCATAATAGATTTTAAAAATCTAATGTTCTTTATTGCAAGACATACTTT

TGTTAACAGATTTGTTTCTTTGTAACGTTTTCCATACGTTTGACATGCTTACAGGACAGGGTTGTCTTTATTTAACATTGTAGAAATGTAATTAATAAAC

AAGGCTCACTACACAATTTAGAATAGGCTTTCTCATTTATATTCCAAATTTGATCATTTAGCAAAACTATTGATACACAAAATATTTCTACATATGAGAA

TGTTTACAATTTGAATTTTAGAAGTTGTTTTTGGATGTGATTCTATGTATGAAAATTGTGTAACACTATGCTCATGCTAAGAACCGACTTAACAGAATTA

CTGAAATAAATGTGCTGTGAGGAATGGACAGTACGGTGCAGGTGTCTTGGTCATGATAAACTGTGATGATTCTTTTAAACACTTTCCAAAAACAACTTAG

TTCCTTTCATCCTGAATGAGCGTCGTTTACAAACAGCAGTTTGTATGCAAGCACCATTCCGCTTCATTTCATGGTGTTGCTAATATAGTTGAACCAAGGA

TATGCATTGATACTTTTCATAATTTGTAAATAAAGTTAAAAACAGTTAAAGGAGTGTTTGGTAGAGGTATATGTATATATACCTCACTGCCAGTGAAATT

ACTTTCCTATGGTATATCTCCTTGCCAGAAATCACTAAATAAAAAGACTTCAAGAATT
Translation
 - UNI9369 - - UNI22080 - - UNI29830 - MRLFLHQDVNKPKFR - UNI9369 - - UNI22951 - RLKVLNDLANNMDDLKINTD

ITGAKEELQDDNNFISEKDSGVHKPKDCQTSFQKNSSLTRSEELSEDQSEQALSGGQSALFLPASTPAVPTENFPLPTGAVVNGPVSCSSSTKTSNMNEG

SVSLTPGQPADQLAAESCSTLKAAADHQLSTPQKASQHQVLFLLSDVAHAKNPTHSIKKVPTSALVGCDVQNSVGNNMKSESTLLSQAEVGQGDASTVVR

DDCVSALAVISSGTDEFRSENDTNWDPQKEFIQFLMTSEETVDKPPAHSKVVGLEKKRKRKMDVSKITRYTEDCYSDSGRAPGKSKILQVDFLGQNEEMQ

AIDSQNYTLSKVKPESAGGDLESVDTFQHLVYNSDKCGEDNSPVHTRTLISNTLKKKCEESDPESPVAFSTEEPSFYPCTKCNVNFREKKHLHRHMMYHL

DGNSHFRHLNVPRPYACRECGRTFRDRNSLLKHMIIHQERRQKLMEEIRELKELQDEGRSARLQCPQCVFGTNCPKTFVQHAKTHEKDKRYYCCEECNFM

AVTENELECHRGIAHGAAVKCPVVSSEVTQRKTQKKTSVKDSVIGSSKKPATYLCKMCPFTTSARSILKKHTEYLHSSACVDSFGNPLGLDKRKNDSLEE

SVDVDSTKSLAKQQPSTFPKNSALKQDAKRTFGSSSQSSNFSKFHKRPHRIQKARKSIAQSGVNSCSQNKSPHKNVMVKSSTDQQPKYFHQAPREKPNAR

ADSSYLYRHKYNNYRTIRKSD DPHNADTKRPENEKDHKRVAVKRVAKASKKESSAGEDLDSYPDFLHKMTVVVLQKLHSDKKDSYETEDDSSWDNVELG

DYTTQAMEEEAYSDLSQEHVNLLPLFKSKIEGQGPGDSAALSYDQNDGFYFEYYEDGGTNSFLQDIHDPQHLENPETPLSKHSSVFHWTDLSLEKKSCPY

CPATFETGVGLSNHVRGHLHRAGLSYEARHVVSPEQIATSDKMQHFKRTGNGTPVKRVRKA AIEKSETTSEHTCQLCGGWFDTKIGLSNHVRGHLKRLG

KTKWDAHKSPICVLNEMMQNEEKYEKILKALNSRRIIPRPFVAQKLSSGDDFLSHNVLPLDEYHNGLKTEALSVSASEEEGLHFLSECGERKPELPSGRK

NQSLTLIELLKSRRLGEERNSAVSPHKTHNQTARKRFVQKCVLPLNEDSPLIYQPQKMDLTVHSA AIDCKQKKSRSRSGSKKKMLTLPHGADEVYILRC

R RFCGLVFRGPLSVQEDWIKHLQRHIVNANLPRTGAGMVEVTSLLKKPASITETSFSLLMAEAAS

For any suggestions or comments, please send an email to unitrap@crg.es