Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049658 (Bdp1)
Chromosomal location
Chr 13: 100787952 - 100845576 (-)
Description
B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB Gene [Source:MGI Symbol;Acc:MGI:1347077]
RefSeq_peptide
NP_001074530.1 
UniGene
Mm.288546 
MGI
MGI:1347077 
Uniprot/SWISSPROT
Q571C7 
Human Ortholog
ENSG00000145734 (BDP1)
Omim not available
UniTrap UNI21407
Vector Insertion
Chr 13: 100831462 - 100834313
Public Clones not available
Private Clones OST331988 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37879
Vector Insertion
Chr 13: 100811376 - 100812241
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2476
Vector Insertion
Chr 13: 100805795 - 100807714
Public Clones XT0660 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099262
Sequence
ATGAAAT TAGGAGTATGTGTATTCCCTGATGTTCATTCAGAGGATAAAAGTCATGCTCCTTTTAGCCCAGATAATGTAAATCAAAAAGTTGTCCATGAC

TATCCGGAGGTTTGTTCACCTGTCATTAGTACATCGCATGCATCATTTGAAGAAAACAGGATTGTATCAAAGGAACAAAGCAATAGAGACGCTGCTGTGG

AGGAAGAAGCAGTGGAGGAGACCTTGCCAACCAG GAATACAACTTCTACGATGAGCACACATTTAAGAATGGAGAGTATGGTTGTTACACCTGAACTAA

ATTCTGAGAAGACTTTAGAGATCAGTGAGTCTCATGGTCATCAGGAAGTTGCCAGTTTCTGCATAACTAAAGAGACAGAAGTGGAAATTCAAAGAG AAA

AAGAAACTGAAGGAGATGATTCCAAAGCAGTAGAATTAGAAGATAAAAGCCATGCACCAGTCACAGCAGCAGAAACTAAGGAAGAGGAGCAGTCGCAGTG

TGTGGGTGATGTTGAAGGGGCCAGTGTTTCTCAAGAAGCAATCCTACCTGCGAG AATTGAAGATCATGAGGAGACCTTGCAAGAGGTTCAAGAGTCGGG

TACTGCAGTTGCTTCTTCTGAGATAGGGCAGCAGACACTCGATTCGGGTCAGAGTTTTGGTGAGAGTGCTGCTAAAGAAGCCCTCAAAGAAACCCCTAAA

GGCAGCGACGTGCCCGTGCTTCATGGGCCAGAG - UNI2476 - AGTGTACCATCTCATATTCCAGAAGCCCAACAAGAAAACACCGGTCCTCAAGCT

GTTACAG TGAATCCATTTGCTGATGGACAGCAAGATGGAGAAGATGAACAAGCCTTCATTTTAACTCTGGTGGAAATCCCAACCCATGCAACAGAAGGA

TTCACTGACGCTGCCATGCAGTTAATGCCGAGCTCTCTGCTGCCAGCACCTATATTGGTCAGGTCTGGGAATGCAGCAGAACGAGGTGACCTGAG TGGG

AGTTTACAAACCTCTTTGGTTGTTCAAGATGCTCCATCCTTATCTCCTTCTAGAAGTGGCAGTTCTGAAAAGCCTCCTGCTAATTTGGATCTTACATCTA

GGAAGAGATTTTGTTGCAGTCCTGATGAAAGTATTCATGTTCCTCCTGCCAAAAAGTCCTCACTTGTTCCAGGAATTGATTATCAAGAATGTACCTCTGA

G GTATGTTCAGAGGAATTAAATGTTTTTGAGAAAACAG CAGAGTCTTGCATGGGACAAGGCATTTTCCCTACCTCAGAGAGCACACATGCAACCTCAA

AACCTCAGAAGGAACACAGTGAGCCAACTGATACAGGATCATCTGGATCTCTTGATGAAATCAAAGATGCGTGTGTAGAAAACATGGCTCAATTGCCTCA

GAGTGAGATAGTATCTGATAAAGAAGAGAAAACTGAACCTGCTTCCAATTCTGAACAGAGAGACATCGTGACATCCTCTTCAAAACCCCCTCTGACCAG 

ACCTGGCAGAAGGCCTTTGGGATTTTTATCATTACTGTGTCCAAAAAATAGTTTGGAATCTGATGAAGTGACTCAAACCCATAGTAAGAAGCGCCTAAAA

CCTCAGATACCTGTATCACGGCGAAATTTGAGAAAACCTAATCTGCATAATACAAGCCAGAAAAAAAATCAAGACTCTTCAGCCCCACCCCCATCACCCA

GCGTTACTGCGCCTCTGTCTGGCACTGCTGGGAGTCCTGAGAGTTCAGCAGCTCAG GTTTCTTCTGATCAGCCCTTGCTAAAAGAAGAGTGTAAAAATG

GGCCCAAAGGAGCACCTGAGGAAGAGGTGACCCCAGTCTCAGAGTTTGTCTTCAGTGACATCTTCATTGAAGTGGATGAGACACTATAAAGCTCTCTCCT

GGGGCCCCTTCTTTTTACTTTCTACTTTTGTAATGAGTTTGAGATTTCCAGCGACCCTGACTTTCACCAAGCAGAAAAGCACCACTGTCTGTTTTGATTT

AGGTCAATTTTGAATATTTATTGAGCTTCATTTGAAGCTTTTATAATCAGTGGGAAACATTTCTTTCTGATTGACCCTGCATTTGGAAATATCAAGCAAT

TAAGACTGGTCTCACTGACAGGCATTGTAGCTTGTTTACATTTGATGTCCTCTGTGCTGAGCGCACCTGGACTTGAGAACTGTGTGCACGCACATCTGTA

TAAATCGTAGTGCTGGCACACTGGGAGCTTGATTGTGCTTAACATTTGCTGCCCTTCTTTTCTAAAGGTGGCTGTGTTTTGTTTCTGTATTTTGTTTTGT

TTTTTATTTTGTTTTTTTCTTTCTTTCATTTTTCTTTTTCTTGAGGGTGATCAGTTGCCTGTAACAATATGAAAGCAAAGTGTGAAACTCCACTTTGGTA

TGGTAAAGTTAAAACTTTTCTATCATCATCTATTTGACTGAAAAAAAAAATGTATATTTTTCTAATTCATGGTGATGTAACATTAGTCCTGATTGAAGAT

CTAGTATTTAAACTTGCTATTTATAAAGTCGGCACATCAAAGAGATTTATTTTTAAATTTTTTATTTAAAATATATCCCAATTTAATTATTTTCACTCAT

CAAATTTGGGTAAAGAAAGCATTAACAAATAATTTGTCTCCTTTTCCTCTTTACTTTAAAAGCTATTTTAAAATGTCATAATTAAAAATGTTTAGTGTTC

ATATTTTGAATACTTTTCTCACACTTTAATATACTGAATTTGTACTGTGAATATTTTTTGCTTTTCTTATTCTAATCTCAGGATTTTCATTGGAAGAAAA

AAATTAACATAAAGGACAAATTGTCTTGTATAATTGATCTTTTTTACACACACACACACCCTTAAAAAAAGGTTTAGTGATAGCTATTTTCCCTACTAAA

TTCTGTTCACAGGACATGTGGGCTTTCAGCCACAGAACATGAATCTGATGTTAAAGCAGAAAATAAGGCAGCCAGTGAGGTCCTCATTATGAACTTGGGT

GTTTTTAATTTTGAGTCTTTATGATTTATGTGTCTTGTTTTCCCTAACAGTTTTTCCCCTGGTTCAAATTAAATGCTTCCAAGAGCAAATGTATTCAACT

TTATTATAAAACCTTATAGATTGATACATAGAAGTTTTTCCATAAAAGATTCTTTTTGAACTGTGTAGCCCAAGTGGTCCTGGTAGCAGCTGCTTAGGCA

GGATGTGCCTAAGATTCAAAAACTGTTCAGTGTATTAGGAAATGAGCAATACTTCAGTTGGAAAATATTTTTACATCTAGGTAATTTTTGTTTTTCATAT

TGATAAAATGGTGACCACTTTTCAAGTTTCTAAGCAAACAAGGGTCGAACTCAATGAGTCTAGAGTGCTGATTCATTGAACTTACTGTGAGCCTGTTTCC

TGTTCTGTGGCTTAGAGTCAAATGTATAGTTTAATGTCTGCTATAAAGGGAGATCTATAAGTTAGATGGAAATTCTCAAAAGTATGCATCTATTTCATGT

GACTAATGTCACAAAATCATGGAGGTAATTCACATTGCTATATAAATGCCTTTTTGTTAGTTTTTAAAATGTCATGTTCTGTAAAGTTTGTTTGTTTGTT

TTTGTAAATGTTACTTGGGTTAGATCACCGAGACTAAACTATTATTTATCCCTGTATAATATTTATTTTTTTAACCTCTGTCTCATTTATCTGTAATAAA

CTGATTTTATGGAAGATGTAATTTATTGTATAAAGACTACAGGGGCATTTGTTGTATAGAGAATCATGTCGGTCAACAAATTGTCCTGCTGCCACTGGAC

AAACCGGTGCTAGGAAGAGAAATACAATCAGTGTGCTTAGCTTTAAGGTGGGAAGATTTGTGATGGTGGAAAGATGTTGCAAGGAATTTGTTATAGAAAT

CTTCAAGGAGATGTATGAAAGGGCTTTACCTTCTCTTGACTGTTTTCCTCTGATCAATTACATCTTAGCAGGTGGCCCAGGCAAGACATAGATGCAAATA

TTAATACCCAGTGTTTACCACCATTATTCAAATGCAAGTGACCATGTTTAATATCTTGCTTGAAGTTTTTGACAAAGAAGCAATATCTTGTCATTTGTAA

ATTTTCTTGTTCTAAAGAAAGCAGTAATGTTCTGTAGATAAAAATTATGTAAATAAAAGTTATTTTATACC
Translation
MKL LGVCVFPDVHSEDKSHAPFSPDNVNQKVVHDYPEVCSPVISTSHASFEENRIVSKEQSNRDAAVEEEAVEETLPTR RNTTSTMSTHLRMESMVVT

PELNSEKTLEISESHGHQEVASFCITKETEVEIQRE EKETEGDDSKAVELEDKSHAPVTAAETKEEEQSQCVGDVEGASVSQEAILPAR RIEDHEETL

QEVQESGTAVASSEIGQQTLDSGQSFGESAAKEALKETPKGSDVPVLHGPE - UNI2476 - SVPSHIPEAQQENTGPQAVTV VNPFADGQQDGEDE

QAFILTLVEIPTHATEGFTDAAMQLMPSSLLPAPILVRSGNAAERGDLS SGSLQTSLVVQDAPSLSPSRSGSSEKPPANLDLTSRKRFCCSPDESIHVP

PAKKSSLVPGIDYQECTSE VCSEELNVFEKTA AESCMGQGIFPTSESTHATSKPQKEHSEPTDTGSSGSLDEIKDACVENMAQLPQSEIVSDKEEKTE

PASNSEQRDIVTSSSKPPLTR RPGRRPLGFLSLLCPKNSLESDEVTQTHSKKRLKPQIPVSRRNLRKPNLHNTSQKKNQDSSAPPPSPSVTAPLSGTAG

SPESSAAQ VSSDQPLLKEECKNGPKGAPEEEVTPVSEFVFSDIFIEVDETL
Transcript ENSMUST00000038104
Sequence
TGAAAGTGAATGCAATAAAGAACAGATACCATCCTTGACACAGAACATAGATGACATTGCAGGTTTAGCACCCAGTGAAGAGACCGAGATGAGAATGGAC

CCCATCCCTTCCACATG TAATCAACAAGACATCATGCCACTAGCAAGGGAGTCCTCAGAGTCGTGTGCTGTGGCTTTACCTGTGTGGGAACCCGGTAAT

ACTGCCTCTGCTGACATGGCTCATGCTGAGAGCTCCTGCTCAGAAGGAAGAGGTGCTGACCTGAAGACTGCGGCACC AGAGACTGAACAGACAGAAAAT

GTCAAACCAAAATCAAGAAGTCGACTACAGAGACCTAAGCCTAATCTGGCAAGGGCAGTTGGGAAGAAATCAGCTGTTTCACAAGACAGACAAGATGAAA

GGAACAAGAACTCACCTTCAGAAACTGCAGCTGAGAAG AATCACATGGAAAAAGAGACCATGAATGAATCTGAAACATCTGTAGCAAAGAATACAGACG

GAGAGAGCCCAGGTGCCAAAACTGTGTCTGA TTTGAGTGAGAAATCCTGTGTACAGCAGGATAGTCAGGCAAAGGTTTTAAGACCTACCAGACTAATGA

GGAGTCGAATGCAAAGACCAAAGCCAAATGTAGTGAAAGCTGCAGAAAGGAAAGAAATTCTCACCTCACAGGAAAAATTTGGGGCCCATGTAGAGAAAAG

TGAAGATGAATCCTGTGTTGTG ATTCCTCCACAAACGGAAAATGAGTCACATAAAAACTTGCAATGTGAAGATACTGTGTCAGAGCCTGGAAGAAAGGA

CCCTTTTGAGAATATTCAGCCTGATCAGCCCCAGGTTCTTAGTGACTGCCCAAG - UNI21407 - TATTCATGAAGGTAATAAAGAAAACAAACGGA

AACAAGTCCCAGTTCTAAGGACTAGATTCCAGAAACCAAAACCAAATACAGGAAGAAGAAGAAGAAGAATATCCTCCAAGGAAGGGATACCAGAGGAGAC

ACCTATTTCTGGAGAAATACCAGCAACTTGGGAAGAAATTCCGAGTCTGGACACTTCTCTGAGGGAGGAGGTACTGAGTGTACCTCTTGCCCCTCTTACT

GCTACCGCTTCCACCAAGGACTCAGAGTCAGATGTGAAAGACAGTGGCAGAAATGATACAGCTTCTAATGCGGAGATGTCAGAAATGACAGATGTCACTA

TGGAAATGGAGACAGGTTTGGAAACAATTGGAAGAGATACTTGCCCAGGGGAGATGGGAGCAGAAATGATTGACATCCCTATGGAAACAGAGGCAGGTTT

GAAAGCATCTTTAAATGAGACTTCTTGTATGGAGAAGGTACCAGAGCTTATTGATACCACTGGGGAAATTTGCACAAATTTGGGAGAAACTGGAAGAAAA

GAAGTATTTTTACAGGAAAATGGCCCGAAGGAGGTCGGTCCAGTTAGTGAACCAGAGACAGGTTTGCAAGAAACTGGAAAAGATTTGGCCATGAAAGAGA

GCACACCAGACACGACAGATAGCACTGAAGAAAGGGAGGCATATTCAGAAGAAACTGAAAGACAAGAAAAAATATCTGCACTGATAAAGGATGCAGAGGA

GGCCAAAGCCAGGGGTGAAATGGAAACCCCCCTGGAAGAGATTGGAGGAGGAACTTCCCAGAGAGGAAAGGCAGCAGGCGCTCCTGTGGAGCAGTCTGCC

AGCGAGGAGGAGCCACAGGGCAGCGCATGCAGAGAGGAGGTGGCAGTGGAGTCGAGCACTGCAGAAGGAAAGGAGCTGAACCTGAGGGAAACTGGAGAAG

ATGACGTCTCCTCGATGGTTGTGGTCTTAGGAGAAAAGACTGACATTGAGGAAACGAATGGAGATCCGAAAGAAACAGAAAGAGAGAGTTCTGTCTCTTG

GGAGAGAGGGTCTGGAGAGATCCAGGTCGGGGAGGAAATGGTGGAAGACTTAGGAAAACCAGAAAAAATAGATGTTGCTCCAAGAGAACGTGAACCAGAG

GAACATTCCTCAGGGCAGCCTGAGGCAGATGTAATTCTGAGCAGTAGTGACGGCAGCACTGGCTCTCCACAGGATAAAGTG AATATTAGCAGTAAAATA

TCAGTGATGCCTACACTTGTGGAAGAAAAAGAAACTACTGACAAGGACATATCCAGCCACTTAGGTCATGTGGAGTCTTGCTCACAGAATTTGGGACGCC

ATGAAACAGACCAAGGGATGCCGCTTCCAGATGCTCTAGAGCGGTTTTCAGATACTAACTTAAG CAAACCTCTTCCTCAAGAACAGCAGCCACTTCAAG

TTAAACCAGCTCCCTTTCTGAGAAGTCGATTCAAAAAACCAAAACCAAACCTGTCAAGAGCAGCTTTAAAGAGAGCAACCATAGAAGCAGAGCACTGTGT

GCCTGGGAAGAAATCCGAAGCCTGCAAAGTGGAGGCCGCCATGCTACAGCAGGACAGTGACCAAGCTGCTCTCTCTCCTCAACAT AATGTACCTTCCCT

GATGGCATCAAGAGAAAATGATAAATCCGGTCATGAGGAGGAGGAGGAGGCTGCGATACTACCATGTACACAGACTGAAAAGGATGCTTCACCGCCAAAT

TCAAGTGAACCTAAAGAGGGTTCTCAGTTAACCCCAAACCAGGAAAATGGCTTACTTGTTCCTATTGG GACTCCCATGATGAATACGGTCACACAAGAA

ACAAGGCAAAATGTTGTCCAGACAACTCTCCCAGTGAGGGGTCGACTTCAGAGACCAAGACCAAATGTGCAAAAGGCCAGACAGAGGCAAATAGTAGAAA

AAGGCGAAGCGCGAGACATAGCTAAGAATGAAGGACCAGAACTGCAAAAAGACGAGACTAGAACATGCCTGACTGTG GCAAACTCTTCTCACATTGAAA

GTGGAGTTGCAGTTGACATGTCCTCCAGAGTGTCAGAGTGCCAAGTGAGTGAAAGTCAAGGCCACGCAGATCCTGTAGAAAACTTAAGTGTTAATAAAGC

CAGTGTTGTTCATGAACAGATGAG GCATGAAAATAAACCGTATGTTCCTAGTCCAGCACTGCTGATAAGAAGGCGGTTCCAAAAGGCTAAACCAAATTT

AGGAGGAGCACGCCGTAAGGATGAGCAACCAGGTGTGGAGAAAGGCCGGACAGACGAGAGCACAGCACTAACAGCAGAAGATCACCTGCTGCAGAAGGAA

GACTGTGACACCCAGCTTTCTCTGCAAGCAAGG GAAAAGGCAGATATGCCTCTGGAGGTTTCAGTGAGAAAAGAGTGTATACATTCTGAAGAGTCGGGT

TCTGACAGAAACGATGCTCAGCCGAACGCTGGACCATCAGAAGGTTCCAGGGATGAGACTGCGAAAGAGCAGCCTACATCTTTGGGGCTTGAAGAGCAGA

GTCTTAGTAAACAAATTAG ATCCAGCTGTCCACAACTATGGAAAGAATCAAGCTATCCCAAGACTGTTTCGAGTCGAAGAACCCCTCTCTCTTCTGCCT

CTGAGTGTGAAATAGAGCACAGTTGGAAAAGAACACAGAGGAAGACGAAACCAAATCTGACCAAAGGGCGTGGATCAAAACGAATTCGAGGTAAGACTGC

TAAGAAGGAACCTAGAGCTTCCAAGTCCGTGTTGGTGACTCTTCGGGCTTCTCAGAAAGAGGATGAAGATGATGCTGAGGATTTTGATTCTGACTATGAG

GAAGAAACCTATCATCTTGCCCCAGAAGAATTAAGCAAAGCACCAGTGTTTGTACCTGTTGGTCTCAGATCCCCTGAACCAGTTTCTGCTCAGATCGAGG

AAACAATGGAAGAG CTTGAGATAACCATGGACGTTGCAGACATGACTGTTGTTGAACATCAGCTTTCACATATGGACACAACAGCTCAGGCTGTGCAAG

CAGAGAAAGCTGTGTATCCGCCATCATTT GAAATGGACGTAGGTGAACAGACCCAAGAAGAGCCAG GTCCCAGTGATGGAAGCACGGAAGCCGCCATA

ACTTTACTTACAATGGGAGATATAGTATTGCAGTCAGAGATCATTCCTGGACAGGGGGATG TAGGAGTATGTGTATTCCCTGATGTTCATTCAGAGGAT

AAAAGTCATGCTCCTTTTAGCCCAGATAATGTAAATCAAAAAGTTGTCCATGACTATCCGGAGGTTTGTTCACCTGTCATTAGTACATCGCATGCATCAT

TTGAAGAAAACAGGATTGTATCAAAGGAACAAAGCAATAGAGACGCTGCTGTGGAGGAAGAAGCAGTGGAGGAGACCTTGCCAACCAG GAATACAACTT

CTACGATGAGCACACATTTAAGAATGGAGAGTATGGTTGTTACACCTGAACTAAATTCTGAGAAGACTTTAGAGATCAGTGAGTCTCATGGTCATCAGGA

AGTTGCCAGTTTCTGCATAACTAAAGAGACAGAAGTGGAAATTCAAAGAG AAACTGAAGGAGATGATTCCAAAGCAGTAGAATTAGAAGATAAAAGCCA

TGCACCAGTCACAGCAGCAGAAACTAAGGAAGAGGAGCAGTCGCAGTGTGTGGGTGATGTTGAAGGGGCCAGTGTTTCTCAAGAAGCAATCCTACCTGCG

AG AATTGAAGATCATGAGGAGACCTTGCAAGAGGTTCAAGAGTCGGGTACTGCAGTTGCTTCTTCTGAGATAGGGCAGCAGACACTCGATTCGGGTCAG

AGTTTTGGTGAGAGTGCTGCTAAAGAAGCCCTCAAAGAAACCCCTAAAGGCAGCGACGTGCCCGTGCTTCATGGGCCAGAG - UNI2476 - AGTGTA

CCATCTCATATTCCAGAAGCCCAACAAGAAAACACCGGTCCTCAAGCTGTTACAG TGAATCCATTTGCTGATGGACAGCAAGATGGAGAAGATGAACAA

GCCTTCATTTTAACTCTGGTGGAAATCCCAACCCATGCAACAGAAGGATTCACTGACGCTGCCATGCAGTTAATGCCGAGCTCTCTGCTGCCAGCACCTA

TATTGGTCAGGTCTGGGAATGCAGCAGAACGAGGTGACCTGAG TGGGAGTTTACAAACCTCTTTGGTTGTTCAAGATGCTCCATCCTTATCTCCTTCTA

GAAGTGGCAGTTCTGAAAAGCCTCCTGCTAATTTGGATCTTACATCTAGGAAGAGATTTTGTTGCAGTCCTGATGAAAGTATTCATGTTCCTCCTGCCAA

AAAGTCCTCACTTGTTCCAGGAATTGATTATCAAGAATGTACCTCTGAG GTATGTTCAGAGGAATTAAATGTTTTTGAGAAAACAG CAGAGTCTTGCA

TGGGACAAGGCATTTTCCCTACCTCAGAGAGCACACATGCAACCTCAAAACCTCAGAAGGAACACAGTGAGCCAACTGATACAGGATCATCTGGATCTCT

TGATGAAATCAAAGATGCGTGTGTAGAAAACATGGCTCAATTGCCTCAGAGTGAGATAGTATCTGATAAAGAAGAGAAAACTGAACCTGCTTCCAATTCT

GAACAGAGAGACATCGTGACATCCTCTTCAAAACCCCCTCTGACCAG ACCTGGCAGAAGGCCTTTGGGATTTTTATCATTACTGTGTCCAAAAAATAGT

TTGGAATCTGATGAAGTGACTCAAACCCATAGTAAGAAGCGCCTAAAACCTCAGATACCTGTATCACGGCGAAATTTGAGAAAACCTAATCTGCATAATA

CAAGCCAGAAAAAAAATCAAGACTCTTCAGCCCCACCCCCATCACCCAGCGTTACTGCGCCTCTGTCTGGCACTGCTGGGAGTCCTGAGAGTTCAGCAGC

TCAG GTTTCTTCTGATCAGCCCTTGCTAAAAGAAGAGTGTAAAAATGGGCCCAAAGGAGCACCTGAGGAAGAGGTGACCCCAGTCTCAGAGTTTGTCTT

CAGTGACATCTTCATTGAAGTGGATGAGACACTATAAAGCTCTCTCCTGGGGCCCCTTCTTTTTACTTTCTACTTTTGTAATGAGTTTGAGATTTCCAGC

GACCCTGACTTTCACCAAGCAGAAAAGCACCACTGTCTGTTTTGATTTAGGTCAATTTTGAATATTTATTGAGCTTCATTTGAAGCTTTTATAATCAGTG

GGAAACATTTCTTTCTGATTGACCCTGCATTTGGAAATATCAAGCAATTAAGACTGGTCTCACTGACAGGCATTGTAGCTTGTTTACATTTGATGTCCTC

TGTGCTGAGCGCACCTGGACTTGAGAACTGTGTGCACGCACATCTGTATAAATCGTAGTGCTGGCACACTGGGAGCTTGATTGTGCTTAACATTTGCTGC

CCTTCTTTTCTAAAGGTGGCTGTGTTTTGTTTCTGTATTTTGTTTTGTTTTTTATTTTGTTTTTTTCTTTCTTTCATTTTTCTTTTTCTTGAGGGTGATC

AGTTGCCTGTAACAATATGAAAGCAAAGTGTGAAACTCCACTTTGGTATGGTAAAGTTAAAACTTTTCTATCATCATCTATTTGACTGAAAAAAAAAATG

TATATTTTTCTAATTCATGGTGATGTAACATTAGTCCTGATTGAAGATCTAGTATTTAAACTTGCTATTTATAAAGTCGGCACATCAAAGAGATTTATTT

TTAAATTTTTTATTTAAAATATATCCCAATTTAATTATTTTCACTCATCAAATTTGGGTAAAGAAAGCATTAACAAATAATTTGTCTCCTTTTCCTCTTT

ACTTTAAAAGCTATTTTAAAATGTCATAATTAAAAATGTTTAGTGTTCATATTTTGAATACTTTTCTCACACTTTAATATACTGAATTTGTACTGTGAAT

ATTTTTTGCTTTTCTTATTCTAATCTCAGGATTTTCATTGGAAGAAAAAAATTAACATAAAGGACAAATTGTCTTGTATAATTGATCTTTTTTACACACA

CACACACCCTTAAAAAAAGGTTTAGTGATAGCTATTTTCCCTACTAAATTCTGTTCACAGGACATGTGGGCTTTCAGCCACAGAACATGAATCTGATGTT

AAAGCAGAAAATAAGGCAGCCAGTGAGGTCCTCATTATGAACTTGGGTGTTTTTAATTTTGAGTCTTTATGATTTATGTGTCTTGTTTTCCCTAACAGTT

TTTCCCCTGGTTCAAATTAAATGCTTCCAAGAGCAAATGTATTCAACTTTATTATAAAACCTTATAGATTGATACATAGAAGTTTTTCCATAAAAGATTC

TTTTTGAACTGTGTAGCCCAAGTGGTCCTGGTAGCAGCTGCTTAGGCAGGATGTGCCTAAGATTCAAAAACTGTTCAGTGTATTAGGAAATGAGCAATAC

TTCAGTTGGAAAATATTTTTACATCTAGGTAATTTTTGTTTTTCATATTGATAAAATGGTGACCACTTTTCAAGTTTCTAAGCAAACAAGGGTCGAACTC

AATGAGTCTAGAGTGCTGATTCATTGAACTTACTGTGAGCCTGTTTCCTGTTCTGTGGCTTAGAGTCAAATGTATAGTTTAATGTCTGCTATAAAGGGAG

ATCTATAAGTTAGATGGAAATTCTCAAAAGTATGCATCTATTTCATGTGACTAATGTCACAAAATCATGGAGGTAATTCACATTGCTATATAAATGCCTT

TTTGTTAGTTTTTAAAATGTCATGTTCTGTAAAGTTTGTTTGTTTGTTTTTGTAAATGTTACTTGGGTTAGATCACCGAGACTAAACTATTATTTATCCC

TGTATAATATTTATTTTTTTAACCTCTGTCTCATTTATCTGTAATAAACTGATTTTATGGAAGATGTAATTTATTGTATAAAGACTACAGGGGCATTTGT

TGTATAGAGAATCATGTCGGTCAACAAATTGTCCTGCTGCCACTGGACAAACCGGTGCTAGGAAGAGAAATACAATCAGTGTGCTTAGCTTTAAGGTGGG

AAGATTTGTGATGGTGGAAAGATGTTGCAAGGAATTTGTTATAGAAATCTTCAAGGAGATGTATGAAAGGGCTTTACCTTCTCTTGACTGTTTTCCTCTG

ATCAATTACATCTTAGCAGGTGGCCCAGGCAAGACATAGATGCAAATATTAATACCCAGTGTTTACCACCATTATTCAAATGCAAGTGACCATGTTTAAT

ATCTTGCTTGAAGTTTTTGACAAAGAAGCAATATCTTGTCATTTGTAAATTTTCTTGTTCTAAAGAAAGCAGTAATGTTCTGTAGATAAAAATTATGTAA

ATAAAAGTTATTTTATACC
Translation
ESECNKEQIPSLTQNIDDIAGLAPSEETEMRMDPIPSTC CNQQDIMPLARESSESCAVALPVWEPGNTASADMAHAESSCSEGRGADLKTAAP PETEQ

TENVKPKSRSRLQRPKPNLARAVGKKSAVSQDRQDERNKNSPSETAAEK NHMEKETMNESETSVAKNTDGESPGAKTVSD DLSEKSCVQQDSQAKVLR

PTRLMRSRMQRPKPNVVKAAERKEILTSQEKFGAHVEKSEDESCVV IPPQTENESHKNLQCEDTVSEPGRKDPFENIQPDQPQVLSDCPS - UNI214

07 - SIHEGNKENKRKQVPVLRTRFQKPKPNTGRRRRRISSKEGIPEETPISGEIPATWEEIPSLDTSLREEVLSVPLAPLTATASTKDSESDVKDSGR

NDTASNAEMSEMTDVTMEMETGLETIGRDTCPGEMGAEMIDIPMETEAGLKASLNETSCMEKVPELIDTTGEICTNLGETGRKEVFLQENGPKEVGPVSE

PETGLQETGKDLAMKESTPDTTDSTEEREAYSEETERQEKISALIKDAEEAKARGEMETPLEEIGGGTSQRGKAAGAPVEQSASEEEPQGSACREEVAVE

SSTAEGKELNLRETGEDDVSSMVVVLGEKTDIEETNGDPKETERESSVSWERGSGEIQVGEEMVEDLGKPEKIDVAPREREPEEHSSGQPEADVILSSSD

GSTGSPQDKV NISSKISVMPTLVEEKETTDKDISSHLGHVESCSQNLGRHETDQGMPLPDALERFSDTNLS SKPLPQEQQPLQVKPAPFLRSRFKKPK

PNLSRAALKRATIEAEHCVPGKKSEACKVEAAMLQQDSDQAALSPQH NVPSLMASRENDKSGHEEEEEAAILPCTQTEKDASPPNSSEPKEGSQLTPNQ

ENGLLVPIG GTPMMNTVTQETRQNVVQTTLPVRGRLQRPRPNVQKARQRQIVEKGEARDIAKNEGPELQKDETRTCLTV ANSSHIESGVAVDMSSRVS

ECQVSESQGHADPVENLSVNKASVVHEQMR RHENKPYVPSPALLIRRRFQKAKPNLGGARRKDEQPGVEKGRTDESTALTAEDHLLQKEDCDTQLSLQA

R EKADMPLEVSVRKECIHSEESGSDRNDAQPNAGPSEGSRDETAKEQPTSLGLEEQSLSKQIR RSSCPQLWKESSYPKTVSSRRTPLSSASECEIEHS

WKRTQRKTKPNLTKGRGSKRIRGKTAKKEPRASKSVLVTLRASQKEDEDDAEDFDSDYEEETYHLAPEELSKAPVFVPVGLRSPEPVSAQIEETMEE LE

ITMDVADMTVVEHQLSHMDTTAQAVQAEKAVYPPSF EMDVGEQTQEEPG GPSDGSTEAAITLLTMGDIVLQSEIIPGQGDV VGVCVFPDVHSEDKSH

APFSPDNVNQKVVHDYPEVCSPVISTSHASFEENRIVSKEQSNRDAAVEEEAVEETLPTR RNTTSTMSTHLRMESMVVTPELNSEKTLEISESHGHQEV

ASFCITKETEVEIQRE ETEGDDSKAVELEDKSHAPVTAAETKEEEQSQCVGDVEGASVSQEAILPAR RIEDHEETLQEVQESGTAVASSEIGQQTLDS

GQSFGESAAKEALKETPKGSDVPVLHGPE - UNI2476 - SVPSHIPEAQQENTGPQAVTV VNPFADGQQDGEDEQAFILTLVEIPTHATEGFTDAA

MQLMPSSLLPAPILVRSGNAAERGDLS SGSLQTSLVVQDAPSLSPSRSGSSEKPPANLDLTSRKRFCCSPDESIHVPPAKKSSLVPGIDYQECTSE VC

SEELNVFEKTA AESCMGQGIFPTSESTHATSKPQKEHSEPTDTGSSGSLDEIKDACVENMAQLPQSEIVSDKEEKTEPASNSEQRDIVTSSSKPPLTR 

RPGRRPLGFLSLLCPKNSLESDEVTQTHSKKRLKPQIPVSRRNLRKPNLHNTSQKKNQDSSAPPPSPSVTAPLSGTAGSPESSAAQ VSSDQPLLKEECK

NGPKGAPEEEVTPVSEFVFSDIFIEVDETL

For any suggestions or comments, please send an email to unitrap@crg.es