Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049676 (A230107C01Rik)
Chromosomal location
Chr 7: 29966553 - 29999002 (-)
Description
RIKEN cDNA A230107C01 gene Gene [Source:MGI Symbol;Acc:MGI:2443617]
Human Ortholog
not available
Omim not available
UniTrap UNI35977
Vector Insertion
Chr 7: 29996465 - 29999003
Public Clones IST12381C9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000069861
Sequence
AGTGCTCTGGCAAGGCAAGAAAAAAAAAGAGGGACTTGGCGAAGAGTAG - UNI35977 - GTTCTAGCTACATGGTGTCCCGGCCAGCCATGTCCCC

GGTCAGCCCTGTGTGGCCGAGAAAACCAAACCTTTGGGCATTCTGGGTACTGCGGCTAGTGCTATTGCTGTCGTTGAAGTCGTGGGCGGAAGATACCTTA

CAGCATTGCACCTGGCTTCTTGTCCTGAACAAGTTCGAGAAG AACTATTTGAGCTTTCCTTACTACTTGCAAATCAACTTTTCCTGTCCGGGACAG CT

GAGTATTGACAGTTGCTGGGTCGGCTCCTTCTACTGTCCCATTCTTGGCTTCTCAGCCACCATCCATGACGCCATTGCCACCGAGAGCACACTCTTCATT

CGACAGAACCAGCTTGTCTACTATTTCACAGGCACCTACAGCACGCTCTTTGACAAAAGCCATGGCAGTA GCAGATGGGTTCGTGTCCTGCCTAGCGAG

TGCATCAAGAGACTGTGCCCGGTGTATTTCAGTGGCAATGGTTCTGAGTACGTCCTAGCCCTCACCACTGGCAAGAATGAGGGTTATATTCACATCGGGA

CCATCACAG ATGGCCTCGTGTCCTTCGAGATGGTGCCAGATGGCTGGTCAGTATGTGAAAAATTACCAGGTACTCATTTTTTTTTGTGTGTGTGGGGGA

TCTGGAATAGGAGGGTGGTAGGCCTTTGAGAAATGGTGTGAAAGGTTATGGGGATAGCTGGATTCTAGACTGCTGTGGATTTTTCTCTCCCCCAACAGGT

AAAAACTGCAGCATCGACTGGGCTACATACATCACTGATGAGAGGAACCTGCTGTTGTTAGTGAAAATTGACTCTGGGCAATTTTACCTAGTCAACTTTA

ATACAGGTAAATCAGGTTGCCTGGAGGTCAGGAGGGAACATGCAGGGGTGAGGACTGTCATCATAGGCCCACCCCACACATGCCACTCTTAGATAAGGTG

TGCAGTGGGCTGGTGAAGCCAGTGTGTCTAGGACAGAGAGAAGAGGACAAGGTGGAAGCCTGCAGACCGAACAGAACTACATCAGGGAGGGCCCTGTAGT

CCACAAGGAGATTCAGTTTTATGTTCCTTTGAGATAAAAACTGTTTCAAAAACGACAATAGTGGAGGAATCCCCAAGTGGACATCCAGTGTGTGTATACA

CATACTTGCATTTTGATATTCTATGTCAGCAAGGTGGCTCAGTGGGTACAGACACTTGCCACCAAAAGTGATAACCTAAGCTCAATTCTCAAGACCCGAA

TGGTAGAAAGAGGAAGACTCCCAAAAGCTGTCCTCTGTTGCTGAAGAATGCGCATGTGAATGCACGCATACACATACATAATGACATAGAGTATACATAA

TAATTCAAGGAAAATATTCTATGTTAAATGAAAAACCTCTAGATCCTTTAGGTTGGGTGGTAATTGTTTTTATTGTTTTTTTGTTTGTGTGTTTTTGTTT

TTTGAGATAAGGTTGTATTGTGTAGCCCTTGCTCGCCCAGAACTCCCCTTGTAGACCAAGCTGTCTTCCAACGCTCAAAAGATTCACATGCCCCAGTTCC

GAGTGCTGGGATTAAATAGTCACCTTGCTCAGTTGACAGCAGAGTCACATATAAAGCTTGGAGAATAGTAACTCTGACTTTGCTTACAGATATTGTGAGA

TTAGGGTTTCAAGAGAGTTCTTCAGGTTTCTGGGTGCTGTTTTCTTATCTCTAGAGTTCAAGACTCTGAATATCCTCTACAAAATACCAGAGTTTATACC

GGAAGGTAGGACCAAAGGGCAAGGGTGATTTCCAGGGTGGACAGTGATCAGGAAGAGACCAGGTGAGCACTCTTCTCCTCTCCCCTGCCTCCTCATCTCC

TCTGTTGTGGTCAGCTAAGGAACTAGACTTCTTGGTGCTCCTTGATACAGTGACATACACCAACACTCCTATGACACCCAAGGGCTTGTTCTTCAACACA

TTGAACAACATGTTGTACATCTGGGGCAACTTCATCCTGCAAAGGTAGGTGTAAGCCATCTCCCCAGGGACCCAGGCATACAGATGCGCCTGGAAACACA

CACATATTTGTTTATATAAATAATTTTAATCTGTTTTTGAGACATGTCTCACCTATGTAGCCCTGGTTGTCCCAGAACTCACTCTGTAGACCAGGCTAGC

CTCAAACTCAAAGTTCTATCTGGCTCAGTCTCCCCAAGGCTGAAATTAAAGGCCTATGCTATAAATCCC
Translation
 - UNI35977 - MVSRPAMSPVSPVWPRKPNLWAFWVLRLVLLLSLKSWAEDTLQHCTWLLVLNKFEK NYLSFPYYLQINFSCPGQ LSIDSCWVGS

FYCPILGFSATIHDAIATESTLFIRQNQLVYYFTGTYSTLFDKSHGSS SRWVRVLPSECIKRLCPVYFSGNGSEYVLALTTGKNEGYIHIGTITD DGL

VSFEMVPDGWSVCEKLPGTHFFLCVWGIWNRRVVGL
Transcript ENSMUST00000047846
Sequence
ATGGTGTCCCGGCCAGCCATGTCCCCGGTCAGCCCTGTGTGGCCGAGAAAACCAAACCTTTGGGCATTCTGGGTACTGCGGCTAGTGCTATTGCTGTCGT

TGAAGTCGTGGGCGGAAGATACCTTACAGCATTGCACCTGGCTTCTTGTCCTGAACAAGTTCGAGAAGGTAGGCTTGCATCTCTCCAAGGATCGATTTCA

AGATCATGAGCCCATCGATACAGTGGCCAAGGTGTTCCAAAAGTTGACAGACTCGCCAATCGATCCGTCAGAG AACTATTTGAGCTTTCCTTACTACTT

GCAAATCAACTTTTCCTGTCCGGGACAG CTGAGTATTGACAGTTGCTGGGTCGGCTCCTTCTACTGTCCCATTCTTGGCTTCTCAGCCACCATCCATGA

CGCCATTGCCACCGAGAGCACACTCTTCATTCGACAGAACCAGCTTGTCTACTATTTCACAGGCACCTACAGCACGCTCTTTGACAAAAGCCATGGCAGT

A GCAGATGGGTTCGTGTCCTGCCTAGCGAGTGCATCAAGAGACTGTGCCCGGTGTATTTCAGTGGCAATGGTTCTGAGTACGTCCTAGCCCTCACCACT

GGCAAGAATGAGGGTTATATTCACATCGGGACCATCACAG GTAAAAACTGCAGCATCGACTGGGCTACATACATCACTGATGAGAGGAACCTGCTGTTG

TTAGTGAAAATTGACTCTGGGCAATTTTACCTAGTCAACTTTAATACAG AGTTCAAGACTCTGAATATCCTCTACAAAATACCAGAGTTTATACCGGAA

G CTAAGGAACTAGACTTCTTGGTGCTCCTTGATACAGTGACATACACCAACACTCCTATGACACCCAAGGGCTTGTTCTTCAACACATTGAACAACATG

TTGTACATCTGGGGCAACTTCATCCTGCAAAG CTACAATAGGGAAGAATTCATTTTTCTGGCGGACTTCCCCAAGGAGTCCACCATCAAATACATGGTC

AACTCTTTCAAAGGACAAATGGCTGTTGTCACAGAAAATGAAGAG GAACTACAAGATGATCACCTTCACCAACACGTGCCCTTTTAAGGCCATTCATGC

AGTTGATGTGCCCAAAAAACAGCATGCATCACGCACAGAGAGCTATGTTGCTCTGCCACCTCTGGTCTCTGAATCCTTGGGCTTCCACAACAATAACACA

CTCGCTGTCTATCAAGGCCTCGTCTATTACCTGCTGTGGCTGCACTCCAAGTATGATAAG CCCTATGCAGACCCAGTGCACGATCCCACCTGGCGCTGG

TGGCAACACAAAACAAAGGACAAG GATTACTTCTTTTACCTGTTCAGCAACCGGCTGGCGGCAGAAGGCATATACATCAACATGAACGCCTACCAAAAG

CTCTACAACATGTCGGGTGACTATGGAATACCCGATCTTTTCTTCCTAGACAAGGGCAACTGGTTCACCTTCACTGTGGTCTTATTGTCACATCAGGATA

CCTTCACAAGCTCTGATAGCCAAG GACCCACTATTAATGTGGACAAGAAGCTGTCATTGTCTCTGGTACTGGCGGATCCTGAGTGCCTTTCAGTAACTG

CGACTCGGGAGTTCCTTCTTAATCGCAACACTCTGCTCACCAAG ATTAAAGTCATAGATAAAAAGAGATGCTCCGAACAGGGCATGGTTGGACGTAACA

TCAAGAAGACTTCCATGTTGATCAAG GTCTTGGGCGCTCCTGGGAATTGCATCCAGCGCACGTACCTTGGGGACCACATTCAA GGTATCAGGCTGGTA

CCAATATTCATCGGCTGTCCTCCTGGCAAGCGCTTGGCCTTTGATGTCTCCTACACGATTAAGCATTCTGAGGAGATAAACAAGCACTATTTCGACTGTG

TGATTAAAGACGCCGAGATGCCATGCTTCCTCTTTCGTGACT TATTCCAGCCCTTCTTCTTAGTCCAAGACTTGGTGACTGGCGACTCTGGCAGTTTCT

TGGGCAG TTACGTGCTGAAGGTGGTGGGTGGTGGTCGCACACTGAACACCATCAGAGACTACACGGAGGAAGAAATCTTCCGTTACAACAGCCCGCTGG

ACACGTAATCCCTTGGGGACCCCAGTCCACAGTTGGTGGGTCTGGTTTGTAGGGTCACCCCTCCCACTTCCAGTTATGCAGGGGACTCTTTCTGCAAGCT

ACACTCAAGGTGCCTCAGACAGTAATGTCTAGGGTTCCACAATCCTGCCCCACCTACTAGGTCCCCACCCTTAGGTGCTGAGAACTATTTCTGCTCTCAA

CCCACTTTGACTTTATATGGGCCTGCATAGAACGAATAGCCTCATCTGGAAAACAAAGGTCGAAAGGACCACGGAGGACAAAAAGTTCTACATAATGTCC

CATGAGAGCCCTGGAGTCGA GTGGCTGTGCTTGGAGAACTCCCCTTGCTATGACATCATCCCCCAAAGCATCTACCCACCTGAGTTCTTCTTCAAGTTG

TTAGTGAGCAATAG AGGTGTAGACAATAGCACATACTGTGACTACAAGCTCACCTTTATAGTGCACATCCATGGGCTACCGCTCAGCAGCAAGCGGTCC

TCCTTCATTGTTATG GTGTCTACCAGCTTCTTTATAGCCCTGGTTGTCTTCTACATCCTGTTCTGCCTCGTGTGGCCTCACATAGTGAAGGCCTGGGTC

TCATTTCGCTGGAAGATTCACAACATGATGGCACCAGAGACCTATTCATCTTCCTCCTCTTCTGGGGGCTTCACCCTCCATTCTCACAGCTCAGAGGGAA

GTTTTGAGGGTCCCTCCAGACCAGGTACCAAAGAGGACAATGTTCAAGCTAAGAGAGCAAAGGTGGCCTGAGTCCCTGGTCTGTACTCTTCCTCATGAAC

CCTTAGGCCTCTCCTCATGGGAATGCAGCCTGCCACCTCCCCAGGACTTTCTGGTTGGCTAGAATGCTCATGTCTCATTCAGACCCTAATAAAGCCTCCT

TGCAGAATC
Translation
MVSRPAMSPVSPVWPRKPNLWAFWVLRLVLLLSLKSWAEDTLQHCTWLLVLNKFEKVGLHLSKDRFQDHEPIDTVAKVFQKLTDSPIDPSE NYLSFPYY

LQINFSCPGQ LSIDSCWVGSFYCPILGFSATIHDAIATESTLFIRQNQLVYYFTGTYSTLFDKSHGSS SRWVRVLPSECIKRLCPVYFSGNGSEYVLA

LTTGKNEGYIHIGTITG GKNCSIDWATYITDERNLLLLVKIDSGQFYLVNFNTE EFKTLNILYKIPEFIPEA AKELDFLVLLDTVTYTNTPMTPKGL

FFNTLNNMLYIWGNFILQS SYNREEFIFLADFPKESTIKYMVNSFKGQMAVVTENEE ELQDDHLHQHVPF           
Transcript ENSMUST00000085819
Sequence
AGGAGCTGGAAAGAGGGGTTGAACAGGCGCTGCCAAGCAACGGTTGACCGGTTTTAACCAAGTGATTG - UNI35977 - TTCGAGAAGGTAGGCTTG

CATCTCTCCAAGGATCGATTTCAAGATCATGAGCCCATCGATACAGTGGCCAAGGTGTTCCAAAAGTTGACAGACTCGCCAATCGATCCGTCAGAG AAC

TATTTGAGCTTTCCTTACTACTTGCAAATCAACTTTTCCTGTCCGGGACAG AATAGTGAGGAGCTGGCCCGAAAGGGCCACCTGATGGGGATGAAGCCC

ATGGTCCGGATCAACTACATGTACTCAGTCAATTTCTACCGTTGGGAGATGGAAAATTTGCAGATTCTGATGGAGGCTGCTCCAATGCGCAGCACAG GG

TACTGCCCGGCAGAGGCCATGTGCATCCTGAACTGGTACACACCCATGCCCTTTAAAAACGGCTCCGTGGTCTCCTCAGTGGACATCTATACCAATGGTA

TAGGGCCCTTCATACCCAAGAAAAG GTTCTATGTGAATATGAATGGCTTCTTGAAGAGAGATGCAAGTGGTAAATCCTTATTCGCCATAGGATATGAG 

AGCCTTGTTCTGAAGTCGAGTCACTTTAGGCTTTCAAAATCAAGACCCCTGTGGTACACTGTGAACCATGCCCCCGTGTTCATCCTTGGAGGCTTTTATG

ATGAAAAGGCCATCCTGTTCTCAGATTCTAATTTCCAGGACTATGTTCTCTTGGAG CTGAGTATTGACAGTTGCTGGGTCGGCTCCTTCTACTGTCCCA

TTCTTGGCTTCTCAGCCACCATCCATGACGCCATTGCCACCGAGAGCACACTCTTCATTCGACAGAACCAGCTTGTCTACTATTTCACAGGCACCTACAG

CACGCTCTTTGACAAAAGCCATGGCAGTA GCAGATGGGTTCGTGTCCTGCCTAGCGAGTGCATCAAGAGACTGTGCCCGGTGTATTTCAGTGGCAATGG

TTCTGAGTACGTCCTAGCCCTCACCACTGGCAAGAATGAGGGTTATATTCACATCGGGACCATCACAG ATGGCCTCGTGTCCTTCGAGATGGTGCCAGA

TGGCTGGTCAGTATGTGAAAAATTACCAG GTAAAAACTGCAGCATCGACTGGGCTACATACATCACTGATGAGAGGAACCTGCTGTTGTTAGTGAAAAT

TGACTCTGGGCAATTTTACCTAGTCAACTTTAATACAG AGTTCAAGACTCTGAATATCCTCTACAAAATACCAGAGTTTATACCGGAAG CTAAGGAAC

TAGACTTCTTGGTGCTCCTTGATACAGTGACATACACCAACACTCCTATGACACCCAAGGGCTTGTTCTTCAACACATTGAACAACATGTTGTACATCTG

GGGCAACTTCATCCTGCAAAG CTACAATAGGGAAGAATTCATTTTTCTGGCGGACTTCCCCAAGGAGTCCACCATCAAATACATGGTCAACTCTTTCAA

AGGACAAATGGCTGTTGTCACAGAAAATGAAGAG CTAGTCTATCTTTTTGACGTTGGAAAAGAACGTTTAGTCAAGAGGCTCCTGCCTGTGGGAACACT

GATGGAGTACAACCTGCCCAAACCCTTCACAGTGGTGAACCAAGG GAACTACAAGATGATCACCTTCACCAACACGTGCCCTTTTAAGGCCATTCATGC

AGTTGATGTGCCCAAAAAACAGCATGCATCACGCACAGAGAGCTATGTTGCTCTGCCACCTCTGGTCTCTGAATCCTTGGGCTTCCACAACAATAACACA

CTCGCTGTCTATCAAGGCCTCGTCTATTACCTGCTGTGGCTGCACTCCAAGTATGATAAG CCCTATGCAGACCCAGTGCACGATCCCACCTGGCGCTGG

TGGCAACACAAAACAAAGGACAAG GATTACTTCTTTTACCTGTTCAGCAACCGGCTGGCGGCAGAAGGCATATACATCAACATGAACGCCTACCAAAAG

CTCTACAACATGTCGGGTGACTATGGAATACCCGATCTTTTCTTCCTAGACAAGGGCAACTGGTTCACCTTCACTGTGGTCTTATTGTCACATCAGGATA

CCTTCACAAGCTCTGATAGCCAAG GACCCACTATTAATGTGGACAAGAAGCTGTCATTGTCTCTGGTACTGGCGGATCCTGAGTGCCTTTCAGTAACTG

CGACTCGGGAGTTCCTTCTTAATCGCAACACTCTGCTCACCAAG ATTAAAGTCATAGATAAAAAGAGATGCTCCGAACAGGGCATGGTTGGACGTAACA

TCAAGAAGACTTCCATGTTGATCAAG GTCTTGGGCGCTCCTGGGAATTGCATCCAGCGCACGTACCTTGGGGACCACATTCAA GGTATCAGGCTGGTA

CCAATATTCATCGGCTGTCCTCCTGGCAAGCGCTTGGCCTTTGATGTCTCCTACACGATTAAGCATTCTGAGGAGATAAACAAGCACTATTTCGACTGTG

TGATTAAAGACGCCGAGATGCCATGCTTCCTCTTTCGTGACT TATTCCAGCCCTTCTTCTTAGTCCAAGACTTGGTGACTGGCGACTCTGGCAGTTTCT

TGGGCAG TTACGTGCTGAAGGTGGTGGGTGGTGGTCGCACACTGAACACCATCAGAGACTACACGGAGGAAGAAATCTTCCGTTACAACAGCCCGCTGG

ACACGTAATCCCTTGGGGACCCCAGTCCACAGTTGGTGGGTCTGGTTTGTAGGGTCACCCCTCCCACTTCCAGTTATGCAGGGGACTCTTTCTGCAAGCT

ACACTCAAGGTGCCTCAGACAGTAATGTCTAGGGTTCCACAATCCTGCCCCACCTACTAGGTCCCCACCCTTAGGTGCTGAGAACTATTTCTGCTCTCAA

CCCACTTTGACTTTATATGGGCCTGCATAGAACGAATAGCCTCATCTGGAAAACAAAGGTCGAAAGGACCACGGAGGACAAAAAGTTCTACATAATGTCC

CATGAGAGCCCTGGAGTCGA GTGGCTGTGCTTGGAGAACTCCCCTTGCTATGACATCATCCCCCAAAGCATCTACCCACCTGAGTTCTTCTTCAAGTTG

TTAGTGAGCAATAG AGGTGTAGACAATAGCACATACTGTGACTACAAGCTCACCTTTATAGTGCACATCCATGGGCTACCGCTCAGCAGCAAGCGGTCC

TCCTTCATTGTTATG GTGTCTACCAGCTTCTTTATAGCCCTGGTTGTCTTCTACATCCTGTTCTGCCTCGTGTGGCCTCACATAGTGAAGGCCTGGGTC

TCATTTCGCTGGAAGATTCACAACATGATGGCACCAGAGACCTATTCATCTTCCTCCTCTTCTGGGGGCTTCACCCTCCATTCTCACAGCTCAGAGGGAA

GTTTTGAGGGTCCCTCCAGACCAGGTACCAAAGAGGACAATGTTCAAGCTAAGAGAGCAAAGGTGGCCTGAGTCCCTGGTCTGTACTCTTCCTCATGAAC

CCTTAGGCCTCTCCTCATGGGAATGCAGCCTGCCACCTCCCCAGGACTTTCTGGTTGGCTAGAATGCTCATGTCTCATTCAGACCCTAATAAAGCCTCCT

TGCAGAATC
Translation
 - UNI35977 -   MGMKPMVRINYMYSVNFYRWEMENLQILMEAAPMRSTG GYCPAEAMCILNWYTPMPFKNGSVVSSVDIYTNGIGPFIPKKR R

FYVNMNGFLKRDASGKSLFAIGYE SLVLKSSHFRLSKSRPLWYTVNHAPVFILGGFYDEKAILFSDSNFQDYVLLE LSIDSCWVGSFYCPILGFSATI

HDAIATESTLFIRQNQLVYYFTGTYSTLFDKSHGSS SRWVRVLPSECIKRLCPVYFSGNGSEYVLALTTGKNEGYIHIGTITD DGLVSFEMVPDGWSV

CEKLPG GKNCSIDWATYITDERNLLLLVKIDSGQFYLVNFNTE EFKTLNILYKIPEFIPEA AKELDFLVLLDTVTYTNTPMTPKGLFFNTLNNMLYI

WGNFILQS SYNREEFIFLADFPKESTIKYMVNSFKGQMAVVTENEE LVYLFDVGKERLVKRLLPVGTLMEYNLPKPFTVVNQG GNYKMITFTNTCPF

KAIHAVDVPKKQHASRTESYVALPPLVSESLGFHNNNTLAVYQGLVYYLLWLHSKYDK PYADPVHDPTWRWWQHKTKDK DYFFYLFSNRLAAEGIYIN

MNAYQKLYNMSGDYGIPDLFFLDKGNWFTFTVVLLSHQDTFTSSDSQG GPTINVDKKLSLSLVLADPECLSVTATREFLLNRNTLLTK IKVIDKKRCS

EQGMVGRNIKKTSMLIK VLGAPGNCIQRTYLGDHIQ GIRLVPIFIGCPPGKRLAFDVSYTIKHSEEINKHYFDCVIKDAEMPCFLFRDL LFQPFFLV

QDLVTGDSGSFLGS SYVLKVVGGGRTLNTIRDYTEEEIFRYNSPLDT   

For any suggestions or comments, please send an email to unitrap@crg.es