Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049721 (Gal3st1)
Chromosomal location
Chr 11: 3883639 - 3899329 (+)
Description
galactose-3-O-sulfotransferase 1 Gene [Source:MGI (curated);Acc:Gal3st1-001]
RefSeq_dna
NM_016922 
RefSeq_peptide
NP_058618.2 
UniGene
Mm.103414 
MGI
MGI:1858277 
Uniprot/SWISSPROT
Q9JHE4 
Uniprot/SPTREMBL
Q5SQ23 
Human Ortholog
ENSG00000128242 (GAL3ST1)
Omim not available
UniTrap UNI31801
Vector Insertion
Chr 11: 3885162 - 3889935
Public Clones IST11745B8 (tigm) IST12093G9 (tigm) IST14120D10 (tigm) IST13688E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32839
Vector Insertion
Chr 11: 3890010 - 3896911
Public Clones IST10382C11 (tigm) IST14330D9 (tigm) IST10609D10 (tigm) IST14446A3 (tigm)
IST13054C6 (tigm) IST14413B2 (tigm) IST11552A9 (tigm) IST12875D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28723
Vector Insertion
Chr 11: 3896911 - 3897055
Public Clones not available
Private Clones OST22569 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109981
Sequence
GAGCATTCTTGTCTCTGACTGCAGAGGCAGCCTGGGTGTTGGGAGAGGAAAAGGGCAGACAGTCACGGCCCAAG - UNI28723 - - UNI32839 -

 GGGTTTCCTGAGATGACTCTGCTGCCAAAGAAGCCCTGCAAGTCCAAGGCCAAGGGGTTACTGCTGGGAGCTCTCTTCACCAGTTTCCTATTGCTGCTG

TACTCCTATGTGGTACCTCCACTGTATCCCAACATGGCCTTCAC - UNI28723 - GACCTCAGAGGCTGCAGCACCCTGCTCCCCTATTCCCAATGA

GCCAGTGGCAGCCACTCCCGCCAACGGCTCAGCAGGAGGGTGTCAACCTCGGCGAGATATTGTGTTCATGAAGACGCACAAGACCGCCAGCAGCACACTG

CTCAACATCCTGTTCCGCTTCGGCCAGAAGCACGAGCTCAAGTTCGCTTTCCCCAATGGCCGAAACGACTTCCACTACCCGTCGTACTTTGCACGAAGCC

TGGTGCAGGACTACCGGCCTGGGGCGTGCTTCAACATCATCTGCAACCACATGCGCTTCCACTATGAGGAAGTGCGCGGGCTGGTGCGGCCGGGTGCCAC

CTTCATCACCGTCATCCGCGACCCTGCTCGTCTCTTCGAGTCTTCCTTCCACTACTTTGGATCCGTGGTGCCGCTCACCTGGAAGCTGTCGAGCCGCGAC

AAGCTGGCCGAGTTCCTGCAGGACCCCGATCGCTACTACGACCCGAGCAGCTACAACGCGCACTACCTCCGCAACCTGCTCTTCTTCGATCTGGGCTATG

ATAGTAGCCTGGACCCGGCCAGCCCGCGCGTGCAGGAGCACATCCTGGAGGTGGAGCGCCGCTTCCACTTGGTGCTACTGCAGGAGTACTTCGACGAATC

CCTGGTGCTGCTCCGAGAGCTGCTGTGCTGGGACCTGGAGGACGTGCTGTATTTCAAGCTCAATGCGCGGCGCGACTCGCCGGTTCCGCGGCTCTCTGGC

GAGCTGTACCGCCGAGCCACCGCCTGGAACCTGCTGGACGTGCGCCTCTACCGTCACTTCAACGCCAGCTTCTGGCGAAAGGTGGAAGCTTTCGGGCGTG

AGCGCATGGCGCGCGAGGTAGCCGAGCTGCGCCAAGCGAACGAGCACATGCGCCACATCTGCATAGATGGCGGCCAAGCAGTTGGTGCTGAGGCCATCCA

GGACTCGGCCATGCAGCCCTGGCAACCCCTGGGCATCAAGTCCATCCTGGGTTACAACCTCAAGAAGAGCATCGGGCCACAACACGAGCAGCTCTGCCGG

CGCATGCTCACGCCCGAAATCCAGTACCTGTCTGACCTCGGTGCCAATCTCTGGGTCACCAAGCTCTGGAAGTTCCTTAGGGACTTTCTAAGGTGGTGAT

GTATCCTGCCCACCTCCTGTTTGGCTTCCTGATGCAGCAAGGCCGGGCAGGGAGCCTCTGGCACCTAGCCTTCCCTAGCCACACCTAGTGCCACCCTGGG

GTCCCTAGGGTCATAGCTGTCTGGGACTAGTCTCTCTGCAGGAGAGAGCCTAACGGAGAGGTATTTAACTAATTATGCCATTTTTTTTTTATTAAATCCC

CTTTATTTCCAGCCTCCTCTTACAAGGGGAGACGCAGAAGT
Translation
 - UNI28723 - - UNI32839 - MTLLPKKPCKSKAKGLLLGALFTSFLLLLYSYVVPPLYPNMAFT - UNI28723 - TTSEAAAPCSPIPNE

PVAATPANGSAGGCQPRRDIVFMKTHKTASSTLLNILFRFGQKHELKFAFPNGRNDFHYPSYFARSLVQDYRPGACFNIICNHMRFHYEEVRGLVRPGAT

FITVIRDPARLFESSFHYFGSVVPLTWKLSSRDKLAEFLQDPDRYYDPSSYNAHYLRNLLFFDLGYDSSLDPASPRVQEHILEVERRFHLVLLQEYFDES

LVLLRELLCWDLEDVLYFKLNARRDSPVPRLSGELYRRATAWNLLDVRLYRHFNASFWRKVEAFGRERMAREVAELRQANEHMRHICIDGGQAVGAEAIQ

DSAMQPWQPLGIKSILGYNLKKSIGPQHEQLCRRMLTPEIQYLSDLGANLWVTKLWKFLRDFLRW
Transcript ENSMUST00000078757
Sequence
GGGCCGGGCCAGGCTGCTGGCCTCACCTGGCGAGTGTTGAGAGCGGGGTGCGGCAGCCGCTGCGGCGGCGGGGCGGGGGCATGGACCAGGCCTGCCAGCG

CGCCGGGTCCCGGCGAGTGCGCCCCGCCGCCCAGTGAGCGCCACGGCGGCGGCGGGGGCCGGGGCCGACCCCTGCCACCCGGAGCCCAAGGAGAACAGGG

CAAAG - UNI28723 - - UNI31801 - - UNI32839 - GGGTTTCCTGAGATGACTCTGCTGCCAAAGAAGCCCTGCAAGTCCAAGGCCAAGG

GGTTACTGCTGGGAGCTCTCTTCACCAGTTTCCTATTGCTGCTGTACTCCTATGTGGTACCTCCACTGTATCCCAACATGGCCTTCAC - UNI28723 

- GACCTCAGAGGCTGCAGCACCCTGCTCCCCTATTCCCAATGAGCCAGTGGCAGCCACTCCCGCCAACGGCTCAGCAGGAGGGTGTCAACCTCGGCGAG

ATATTGTGTTCATGAAGACGCACAAGACCGCCAGCAGCACACTGCTCAACATCCTGTTCCGCTTCGGCCAGAAGCACGAGCTCAAGTTCGCTTTCCCCAA

TGGCCGAAACGACTTCCACTACCCGTCGTACTTTGCACGAAGCCTGGTGCAGGACTACCGGCCTGGGGCGTGCTTCAACATCATCTGCAACCACATGCGC

TTCCACTATGAGGAAGTGCGCGGGCTGGTGCGGCCGGGTGCCACCTTCATCACCGTCATCCGCGACCCTGCTCGTCTCTTCGAGTCTTCCTTCCACTACT

TTGGATCCGTGGTGCCGCTCACCTGGAAGCTGTCGAGCCGCGACAAGCTGGCCGAGTTCCTGCAGGACCCCGATCGCTACTACGACCCGAGCAGCTACAA

CGCGCACTACCTCCGCAACCTGCTCTTCTTCGATCTGGGCTATGATAGTAGCCTGGACCCGGCCAGCCCGCGCGTGCAGGAGCACATCCTGGAGGTGGAG

CGCCGCTTCCACTTGGTGCTACTGCAGGAGTACTTCGACGAATCCCTGGTGCTGCTCCGAGAGCTGCTGTGCTGGGACCTGGAGGACGTGCTGTATTTCA

AGCTCAATGCGCGGCGCGACTCGCCGGTTCCGCGGCTCTCTGGCGAGCTGTACCGCCGAGCCACCGCCTGGAACCTGCTGGACGTGCGCCTCTACCGTCA

CTTCAACGCCAGCTTCTGGCGAAAGGTGGAAGCTTTCGGGCGTGAGCGCATGGCGCGCGAGGTAGCCGAGCTGCGCCAAGCGAACGAGCACATGCGCCAC

ATCTGCATAGATGGCGGCCAAGCAGTTGGTGCTGAGGCCATCCAGGACTCGGCCATGCAGCCCTGGCAACCCCTGGGCATCAAGTCCATCCTGGGTTACA

ACCTCAAGAAGAGCATCGGGCCACAACACGAGCAGCTCTGCCGGCGCATGCTCACGCCCGAAATCCAGTACCTGTCTGACCTCGGTGCCAATCTCTGGGT

CACCAAGCTCTGGAAGTTCCTTAGGGACTTTCTAAGGTGGTGATGTATCCTGCCCACCTCCTGTTTGGCTTCCTGATGCAGCAAGGCCGGGCAGGGAGCC

TCTGGCACCTAGCCTTCCCTAGCCACACCTAGTGCCACCCTGGGGTCCCTAGGGTCATAGCTGTCTGGGACTAGTCTCTCTGCAGGAGAGAGCCTAACGG

AGAGGTATTTAACTAATTATGCCATTTTTTTTTTATTAAATCCCCTTTATTTCCAGCCTCCTCTTACAAGGGGAGACGCAGAAGTAAAGAAATTTTATGT

GTG
Translation
 - UNI28723 - - UNI31801 - - UNI32839 - MTLLPKKPCKSKAKGLLLGALFTSFLLLLYSYVVPPLYPNMAFT - UNI28723 - TT

SEAAAPCSPIPNEPVAATPANGSAGGCQPRRDIVFMKTHKTASSTLLNILFRFGQKHELKFAFPNGRNDFHYPSYFARSLVQDYRPGACFNIICNHMRFH

YEEVRGLVRPGATFITVIRDPARLFESSFHYFGSVVPLTWKLSSRDKLAEFLQDPDRYYDPSSYNAHYLRNLLFFDLGYDSSLDPASPRVQEHILEVERR

FHLVLLQEYFDESLVLLRELLCWDLEDVLYFKLNARRDSPVPRLSGELYRRATAWNLLDVRLYRHFNASFWRKVEAFGRERMAREVAELRQANEHMRHIC

IDGGQAVGAEAIQDSAMQPWQPLGIKSILGYNLKKSIGPQHEQLCRRMLTPEIQYLSDLGANLWVTKLWKFLRDFLRW
Transcript ENSMUST00000063004
Sequence
GGCATGGACCAGGCCTGCCAGCGCGCCGGGTCCCGGCGAGTGCGCCCCGCCGCCCAGTGAGCGCCACGGCGGCGGCGGGGGCCGGGGCCGACCCCTGCCA

CCCGGAGCCCAAGGAGAACAGGGCAAAG TGCCTCTCACTGGGCTCCAAGGAAGAACAAACAAGCACTTGCAGGAAAGCAGTGACTCACAGGACAATGGC

AATGGGGGACTCTAGGCCCCCTCAGTGGCTTGGGGCAAGCTTCTTGCTTTGGTTTGACTCCATGAAATGTGAATGACTAGAGAAGACACAGCGGGATGGA

GCAGAAGTACCCCAAAGGTTACCAGACTGGAGACCTGGAGTCATCAG - UNI28723 - - UNI31801 - - UNI32839 - GGGTTTCCTGAGA

TGACTCTGCTGCCAAAGAAGCCCTGCAAGTCCAAGGCCAAGGGGTTACTGCTGGGAGCTCTCTTCACCAGTTTCCTATTGCTGCTGTACTCCTATGTGGT

ACCTCCACTGTATCCCAACATGGCCTTCAC - UNI28723 - GACCTCAGAGGCTGCAGCACCCTGCTCCCCTATTCCCAATGAGCCAGTGGCAGCCA

CTCCCGCCAACGGCTCAGCAGGAGGGTGTCAACCTCGGCGAGATATTGTGTTCATGAAGACGCACAAGACCGCCAGCAGCACACTGCTCAACATCCTGTT

CCGCTTCGGCCAGAAGCACGAGCTCAAGTTCGCTTTCCCCAATGGCCGAAACGACTTCCACTACCCGTCGTACTTTGCACGAAGCCTGGTGCAGGACTAC

CGGCCTGGGGCGTGCTTCAACATCATCTGCAACCACATGCGCTTCCACTATGAGGAAGTGCGCGGGCTGGTGCGGCCGGGTGCCACCTTCATCACCGTCA

TCCGCGACCCTGCTCGTCTCTTCGAGTCTTCCTTCCACTACTTTGGATCCGTGGTGCCGCTCACCTGGAAGCTGTCGAGCCGCGACAAGCTGGCCGAGTT

CCTGCAGGACCCCGATCGCTACTACGACCCGAGCAGCTACAACGCGCACTACCTCCGCAACCTGCTCTTCTTCGATCTGGGCTATGATAGTAGCCTGGAC

CCGGCCAGCCCGCGCGTGCAGGAGCACATCCTGGAGGTGGAGCGCCGCTTCCACTTGGTGCTACTGCAGGAGTACTTCGACGAATCCCTGGTGCTGCTCC

GAGAGCTGCTGTGCTGGGACCTGGAGGACGTGCTGTATTTCAAGCTCAATGCGCGGCGCGACTCGCCGGTTCCGCGGCTCTCTGGCGAGCTGTACCGCCG

AGCCACCGCCTGGAACCTGCTGGACGTGCGCCTCTACCGTCACTTCAACGCCAGCTTCTGGCGAAAGGTGGAAGCTTTCGGGCGTGAGCGCATGGCGCGC

GAGGTAGCCGAGCTGCGCCAAGCGAACGAGCACATGCGCCACATCTGCATAGATGGCGGCCAAGCAGTTGGTGCTGAGGCCATCCAGGACTCGGCCATGC

AGCCCTGGCAACCCCTGGGCATCAAGTCCATCCTGGGTTACAACCTCAAGAAGAGCATCGGGCCACAACACGAGCAGCTCTGCCGGCGCATGCTCACGCC

CGAAATCCAGTACCTGTCTGACCTCGGTGCCAATCTCTGGGTCACCAAGCTCTGGAAGTTCCTTAGGGACTTTCTAAGGTGGTGATGTATCCTGCCCACC

TCCTGTTTGGCTTCCTGATGCAGCAAGGCCGGGCAGGGAGCCTCTGGCACCTAGCCTTCCCTAGCCACACCTAGTGCCACCCTGGGGTCCCTAGGGTCAT

AGCTGTCTGGGACTAGTCTCTCTGCAGGAGAGAGCCTAACGGAGAGGTATTTAACTAATTATGCCATTTTTTTTTTATTAAATCCCCTTTATTTCCAGCC

TCCTCTTACAAGGGGAGACGCAGAAGT
Translation
  - UNI28723 - - UNI31801 - - UNI32839 - MTLLPKKPCKSKAKGLLLGALFTSFLLLLYSYVVPPLYPNMAFT - UNI28723 - T

TSEAAAPCSPIPNEPVAATPANGSAGGCQPRRDIVFMKTHKTASSTLLNILFRFGQKHELKFAFPNGRNDFHYPSYFARSLVQDYRPGACFNIICNHMRF

HYEEVRGLVRPGATFITVIRDPARLFESSFHYFGSVVPLTWKLSSRDKLAEFLQDPDRYYDPSSYNAHYLRNLLFFDLGYDSSLDPASPRVQEHILEVER

RFHLVLLQEYFDESLVLLRELLCWDLEDVLYFKLNARRDSPVPRLSGELYRRATAWNLLDVRLYRHFNASFWRKVEAFGRERMAREVAELRQANEHMRHI

CIDGGQAVGAEAIQDSAMQPWQPLGIKSILGYNLKKSIGPQHEQLCRRMLTPEIQYLSDLGANLWVTKLWKFLRDFLRW

For any suggestions or comments, please send an email to unitrap@crg.es