Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049764 (Zfp280b)
Chromosomal location
Chr 10: 75495399 - 75505879 (+)
Description
zinc finger protein 280b Gene [Source:MGI Symbol;Acc:MGI:1927865]
RefSeq_dna
NM_177475 
RefSeq_peptide
NP_803426.2 
UniGene
Mm.80609 Mm.381932 
MGI
MGI:1927865 
Uniprot/SPTREMBL
A8E4K9 Q3TZW5 Q3UMQ7 Q505F4 Q8CD71 
Human Ortholog
ENSG00000198477 (ZNF280B)
Omim not available
UniTrap UNI12044
Vector Insertion
Chr 10: 75495495 - 75500978
Public Clones E326A02 (ggtc) D160A01 (ggtc) (ggtc) W221A03 (ggtc) E123A08 (ggtc)
D029E07 (ggtc) D160D01 (ggtc) IST10439D3 (tigm) IST13394C6 (tigm)
IST10111C4 (tigm) IST12776B4 (tigm) IST13439E8 (tigm)
Private Clones OST447611 (lexicon) OST283440 (lexicon) OST271886 (lexicon) OST236613 (lexicon)
OST233839 (lexicon) OST210223 (lexicon) OST186838 (lexicon) OST41342 (lexicon)
OST41331 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000061617
Sequence
GAGCGGCGGGGCCCTGGAGGTCGTGGTGCGGGGCTTCCCGCGCAGCGCCTCGCGGGCCGGGGCGTCCGGGGGAGGCTCAGGTACGCCTGCCGGGAG - U

NI12044 - GTGGCAGTGTGTGTGCAGTGCCGTGTGGCCACACTCATCAGGAGCCACATCAGAAATGGAGCAGCCATTCACGGTAGATGATGAAGACGA

ACAAGATCCAGAACCACAGCCGAGGTCAGGAGAACCCATTCAAGTCCTCGATGACGATGCTGCTGAAGATGCAGAGCTGATCTTCGTAGGGGTGGAGAAG

GTAAAGGAAGATGCTGAGCTTATCTTTGTTGGGGTGACTTCAGCTTCCCAGCCAGCCAACTCGAACATTTTGAACAGAGTCACCCCAGGTTCACGGTTAA

AAAGAAAGCATGACCGACTTAGAGCAACCACGACTCAGAGGTTGCAGCCCTCACGTCCTGCCGCCCCCACATCAGAGGCCGTGGTTGTCTTGCCAGCATC

TCCAGCTGAATCAAGGTCGACGGATAGTCCTATTGCTATTGAGCCTTTGTCCGAGTCTGATTATAGAAGTAGTTCACCACAGGTTGTGCCTAGTAGCTCT

TCCAAGTGCTGTTCGCCTCTGGTCACACTCTCAAGTTCAGAGAATAGTCCAGTAAAGGCAGCGCTTTCAGGAGGAGATCTGAATGAAAATTTGTATGTAT

CGAAGTGCCATTTTTCCATAAATCCACAGAGGCCTGACCATAGTATTGAGATTGTAGAACCACTTTCTTCAGCTTTGCCCCCTTCAGGTACCTTCCATAC

CTCGAATATGCAACAGAGGACACCTTCCTTTGATGCTCCCAACTCTCTGAGCCGTCTTGTGAATGGGGCACCTCCTTCAGAGGACTCTGCCCACCCTCGT

CAGGACAGTGGATTGGCGGAAGCAGACTTTTCAAGTCCAGCAAGTCAAGAGACTTTTGATCCCAAGAAAGGAAGTTTGACCCTGTTACTTAGTGACTTTT

ATTATGGACAGTATAAAGGAGATGGGAAGCCGGAGCAGAAGACTCACACAACCTTTAAATGCCCCAGCTGCTTGAAAGCTCTAAAAAATGTTAAATTCAT

GAACCACACCAAGCATCATTTGGAGCTCGAGAGGCAGGGGAGTGAGGACGCCTGGGAGAGCCACACCACCTGTCTGCGCTGCCACCGGCAGTTCGATTCC

CCGTTCCAGCTGGAGTGCCACATCGACCGAGTGCACACGTCACCGGACCCTTCCGTGGTCTGCAAAATCTGTGAGTTGTCCTTTGAGACCGACCAAGTCC

TTTTACAGCACATGAAAGACAATCACAAGCCTGGGGAGATGCCCTATGTGTGCCAGGTCTGTAAGTACAGGTCGTCAGGCTTCGCGGACGTGGAGACACA

CTTTACAAAGTGCCATGTAAACACTAAGAACCTGCTTTGTCCATTTTGTCTTAAGATCTTCAAAACTGGGATGCCATACATGTGCCATTACAGGGGCCAC

TGGGAAAGGAGCGGCCACCAGTGCTCCAAGTGCCGACTACAGTTTTTAACCTTCAAGGAGAAAATGGAGCACAAGACTCAGTGCCACCAAATGTTTAAGA

AGCCTAAGCAGCTGGAAGGGCTGCCTCCCGAGACGAAGGTCGTGATCCAGGTGTCCCTGCAGCCCGTGGAGTCAGAATCTGTGAAGGTAGCATCGATCAC

TGTGAGCACAACTGACTGGGAGCCTTCTAACCCCCGACCTCAAGGCAGACTTTCACAGAAGCCCCATTAATTCTAACCTCAGTCAGAATGAGAGACAGAG

TACAAGCCTGTAGTACGTCGGTTAATCGCTGGTACCTAAGATGATGAATTGATGAACAGTTGGGTTTTTGTGTGTGTGTGTGTGATAATGCAGGGTTTTG

TCTGTTTATTTTTTGAGGGTTTCTTTTGTTCTCATTTAGTGCTGGCGCTGGATCGGAGGCTTCACAAATAATAAGCAAGTGCTCACCCCTCCCCCTCCCC

GGCTAAGGCATTTTCTGAATGAACTGTGAGTGCCATTTGAAATCCATCTGGTTTTCATATTAAGTATTTGGCTTGACAGGAGGAAGGTGTCTGTGTCCCT

GTGAATGGAAAACAAGTTAAACCTATTTATTAGTATTTCATCTAACCCTAAAGTTTGAGAGTTCTTTAAAGGTTTGACGTTTGGTGGGCAGGCTCACAAG

GCCCCACCTCTCCCTGAAGATCTGCGGGCAGTTAATACTTGCGAAGGGAGGGAGAGAGACATTGTTTTTGTTTCTTTTTTGAGAGACATCATCTTAAGTG

GTATAGCATGGGTAAGTGGGCAGGCATACGTCCTTTTCAGTCTTGAAGCCAAAGAAGGAATCCTGCCTGAATGCCTTTACCTAAAAGAGTATCCAAGGAG

GCCAAGCCATTCCTGTAAAACGCCCGTGTCTGTGAAAGACCCCTGCAAACATTCAAAGCACAGCTCTGTATTCTCAGCGCCACATGAAGCAGCAGCAACG

GTAGTTAGAAAACTGGGGCGGAGCCCACGACCATGGACTTTGTTTCGCTTGATGCGTAGGGTAGCCAGAGTTATCCACGCTGGTCCGTTTTGGCTCGCTC

TGTTTGAAGAACTGGTCATATCCTCATGGACCACATCAGTAAAGCAAGTTGACCTTTCCTGAGGAAAGAAGCCCCGGCATTTGCGGTTTGAAGTATATTG

AACTTGAGTTATAACTGAAAAGGTTTGGGAAAATGGCATCTGTCCAGTTTATGACTTGGGCTGAACTTAGTTCTACTCTCAAGCTGTAATAAGAACTTGC

CCAATAATACTGGACATAGCGTGGAAACCAGAGCAGGGTGGCTAGAATTTAAACCCTCTCTGTGGTCTTTGTTTTTCAGTCCACGTGTGTGGTTGAGTGT

GTGAAGCTTGCAATTTGATGCCCTGGTGCTTTTCCCCCACTTGGTGCTAGGGATTAAACCCGAGCGAGGGCTCTGCCATTGAACCAGATCCCTAGTCACA

CTTTGTGTCTTGTCTCCTATTTAAGTGGTTCTAATGTCTGTATAAGTTCCCTTTGTTGGATGTGTAATTTCCTAGTTGATCACACTAATACTGCTTGGGT

CTTACTTGAAGCACTTTTGTGTGCAAGATATGTCCTAAATGAAGACTTGCCTTCTCCTGCCTATCATACTACTTAGCTGGTCACCAGCCTCTGGAGGAAC

AACTTCTCCTAGAACCGTAGAGCATCCTCTGAGGATTGGTCTTCAACAGCTTCAGGAGCGCTAGCTCTTTCTGTACATCTCTAGGGCTGTGTCCTTGAGC

CTGGCCGGGGCTACCTGTTGTCCTCCAGCCCAGGTGACCAGCTGCCGCTGCCCATCCCTCCAGGCGTCTGGGTATATGCTGGTTAGAGACACTGGTCCTG

TTCCTTTCTTTAAAGGTATCTTGTTGGGTGTGGTAGCACACACTGGTAATAAGAGCTCTTGGGAGGCTGGGGCAGGAAGATTTAAAGTTCAGAGTCAGCC

TGGGCTCTTCAGTGAGTTCCAAATTACACAGGAAACAAAAGAGGCAGTGTGGATAAGTTCCTTAGATAATGTCCCTGTTCCATTTTTCCCTTCCTCGGTT

TAGTGAAATTTCCCTAGATTCCATGAACAAATGGGAAGAGGTTATCCCCAGGCCTTGGTCTCTCCAGACTGAGGGAGGGACAGAGGTTGTGAGTATCTTT

TGTTTGCTCCGTGCTTGACCATTGATTGACTGTGATCTGCCTTTTTACTATTTTGATGGGTCTTTTCAGTGTTTTTTTTTTTGGCCACATCACACTTTTT

AGCCTGTACCATTCCTTTAGGTATGGAAAGGGTATTTGTCCCACTTGTTCTGGTGAAAAATCCCGTTTATGAAATAAGTCTGCAGACTCATATAAACATT

ACTGTCTATAGTAAACTTAAGAACTGTCTTAGACCTGTGTCGAGTGTCTCCAGCCCTGCCTGTCGCAGTAGTTTTCTGTGTCACTAAAGCATGCTCCTAA

AGAGGACAGAATTGTTTACTGCTAAGGGAGGCCCCAGGGCTCTGGCTCCTGCCTACCGCTTCTGTCCCCTGCGCTGCCCGACCCAACCTGACCTGTCCAC

TGCTGCTGCACTGTTTTGACCCCCCACTGATCTTGCTATTCCTCAGTAAATTCCCATTTTCCCCTGGTGCAGAGGCTGCCTGGGCTGCTGTCACAGCGCT

TTCCCTAAGCCTGCATGGCTGCTACCTCACTCGTGGTTATGAAGCTTACTAAGATTTTTAGAGTGACTAGAAATGTCCCCTGCTTCTGAAGCCTCGTTTA

CTCCTTCTCTTGGAAGGCGACTTACCTCTCCCCGACTTACCCCGCCTCTGCAGTCTAGCTACATTTCCTAGTCACAGACTCTGAGGAAGAAATCGTTAGC

AAGAGCTTTGGCTCTGTCTTAGAAGTGAGCTAGCTTAAGTGCATTTTTGTGCCTCTTAATACAAAGACGTAGAGTGAGCTGAGTCTCTGGACGCTTTGTT

TTATACCGACAGCTCCATCTATTTTGAAAGCAGTGTCACTTTGTTCTGTTTACACGTGTATTAAATATTTGTCAAGATTACTATTTTGTTACTCTGTGAA

GTTGGCTGCTTGATTTACCAAATGAAAGTTATTTTGATGTTGCCAAAGTTATTTATAAGAACTAGCAATTAGAGGAATAAAAAAGCATTTTGTGGAAACC

TTTTCTGTCTTTTTTTTTTTTTTTTACTTTGTGCACTGTGTATTTTAGGTTAATTTTTGTTTTGTGTCTTCTGCAGTTGAGTTTATTTTACTGGTTATAA

CTTCTAGTGATATGTTCAATAAAGCTAATTAGGCTTCTTTAATTTCATTTTTAAATCTTATTTATTATTGTGTGTATGACTTGTGTGTGGGTGTATCTGT

GCCACCACACATGTATACAGGTCAGATACATTTTGGGGTTGGTTCTCTTACTCTGGGATCCAAAGATCGAACTCTGGCTGGTAAACCCCCCCCCCCCCCC

GCTTTTAAAAA
Translation
 - UNI12044 - MEQPFTVDDEDEQDPEPQPRSGEPIQVLDDDAAEDAELIFVGVEKVKEDAELIFVGVTSASQPANSNILNRVTPGSRLKRKHDRLR

ATTTQRLQPSRPAAPTSEAVVVLPASPAESRSTDSPIAIEPLSESDYRSSSPQVVPSSSSKCCSPLVTLSSSENSPVKAALSGGDLNENLYVSKCHFSIN

PQRPDHSIEIVEPLSSALPPSGTFHTSNMQQRTPSFDAPNSLSRLVNGAPPSEDSAHPRQDSGLAEADFSSPASQETFDPKKGSLTLLLSDFYYGQYKGD

GKPEQKTHTTFKCPSCLKALKNVKFMNHTKHHLELERQGSEDAWESHTTCLRCHRQFDSPFQLECHIDRVHTSPDPSVVCKICELSFETDQVLLQHMKDN

HKPGEMPYVCQVCKYRSSGFADVETHFTKCHVNTKNLLCPFCLKIFKTGMPYMCHYRGHWERSGHQCSKCRLQFLTFKEKMEHKTQCHQMFKKPKQLEGL

PPETKVVIQVSLQPVESESVKVASITVSTTDWEPSNPRPQGRLSQKPH

For any suggestions or comments, please send an email to unitrap@crg.es