Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049800 (Sertad2)
Chromosomal location
Chr 11: 20443256 - 20553026 (+)
Description
SERTA domain containing 2 Gene [Source:MGI (curated);Acc:Sertad2-001]
RefSeq_dna
NM_001038625 NM_021372 
RefSeq_peptide
NP_067347.2 NP_001033714.1 
UniGene
Mm.396846 Mm.339676 
MGI
MGI:1931026 
Uniprot/SWISSPROT
Q9JJG5 
Uniprot/SPTREMBL
Q3UGZ1 Q6ZQI8 Q91VV6 
Human Ortholog
ENSG00000179833 (SERTAD2)
Omim not available
UniTrap UNI31514
Vector Insertion
Chr 11: 20443764 - 20531979
Public Clones (ggtc) IST14596H7 (tigm) IST14280A8 (tigm) IST14393H5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31752
Vector Insertion
Chr 11: 20532277 - 20547157
Public Clones (ggtc) 3SE306E09 (ggtc) 3SE311D01 (ggtc) IST10938H1 (tigm) IST10178B3 (tigm)
IST14451H1 (tigm) IST14455E4 (tigm) IST14579F3 (tigm) IST14416C2 (tigm)
IST13241B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17159
Vector Insertion
Chr 11: 20547356 - 20547804
Public Clones D123C11 (ggtc)
Private Clones OST448309 (lexicon) OST437497 (lexicon) OST420652 (lexicon) OST347667 (lexicon)
OST308739 (lexicon) OST230691 (lexicon) OST230528 (lexicon) OST227075 (lexicon)
OST226840 (lexicon) OST215658 (lexicon) OST200852 (lexicon) OST196768 (lexicon)
OST169844 (lexicon) OST169005 (lexicon) OST128214 (lexicon) OST115185 (lexicon)
OST107703 (lexicon) OST105537 (lexicon) OST100953 (lexicon) OST98734 (lexicon)
OST42377 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37640
Vector Insertion
Chr 11: 20547804 - 20549069
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109585
Sequence
AGCAGGTTCCTTTTGTCCTGAAGCAGTTTATCCAATCACAGCTGAGGCTGGGAAACTAAGCCGAGCGGAACCCCAGGCCAGGAACCATTTGAAAGGCAGT

GTCAGCTCAGCCTCTGTGGATACCCGACAGGCAAGAAGGCTTTGTGCACGTGAGGAAGGAAGAAACATTTTGAGAGTACACACGGTTCTACCAGAATT -

 UNI17159 - ATATATGTTGGGTAAAGGAGGAAAACGGAAGTTTGATGAGCATGAAGATGGGCTGGAAGGCAAAATCGTGTCCCCCTCCGACGGTCCA

TCCAGGGTGTCTTACACCTTACAGCGCCAGACTATCTTCAACATTTCCCTTATGAAACTGTATAACCACAGGCCTCTGACAGAGCCCAGCTTGCAGAAGA

CTGTCTTAATTAACAACATGTTGAGGCGGATCCAGGAGGAACTCAAGCAGGAAGGCAGCCTGAGGCCTGCATTCACCCCCTCTTCCCAGCCGAGCAACTC

ACTGAGCGACAGCTACCAGGAGGCCCCGCCTCCTGCTCCTCACCCCTGTGACCTCGGAAGCACTACACCCTTGGAGGCCTGCCTCACCCCTGCCTCCCTG

CTCGAGGACGACAACGATGACACTTTTTGCACTTTGCAGGCTGTGCACCCTGCAGCTCCCACTAGACTCTCTTCTGCAGCCCTCCCAGCAGAGAAGGACA

GCTTCTCCTCCGCCTTGGATGAGATCGAGGAGCTCTGTCCCACATCTACCTCCACAGAGGCTGCCCACACAGCAGCCCCTGAGGGCCCGAAAGGAACCTC

CAGTGAGTCCAGTGTCCAGAAACCTGAGGGGCCCGAGGAAGGCCGCACAGATGACTCACGATTCATGGACTCTCTGCCTGGGAATTTTGAAATAACAACG

TCCACGGGTTTCCTGACAGACTTGACCCTGGATGACATCTTGTTTGCTGACATTGATACATCCATGTACGATTTTGACCCCTGCACATCTGCATCGGGGA

CAGCCTCAAAGATGGCCCCTGTGTCAGCTGATGACCTCCTCAAGACCCTGGCTCCTTACAGCAATCAGCCTGTTGCCCCAAGTCAGCCTTTCAAAATGGA

TCTCACGGAGCTGGACCACATCATGGAGGTGCTTGTTGGCTCCTGAGACCTGGGCCCACGTGACTGCGCCCAGCCAGGCTCTGCACCCTTGCAGCCCCGA

CAGTTTCTCCGCACTGTGCATGGACCCTTGCTTGCCTTTTTCAGAGAAAAAGAAAATTTTACAAAAGGATCACACTAGTATTTTCTTCAAGCAGAGTTGG

AGTGCCTTCATTCGAGTATGCCCACTTGTAACACACTCTTCTGAGTGGGTTCCTCAGAGCCCTGCTGCCCTGGCGTAGGAGAGAAGACATTTGAAGACTG

TGTTGCTAATGTTGAAAGGTGAACAGGAACAGTTCAAGTGAAGCACAAGGATTAAGTTGGAAAAGCTGTAAATTGC
Translation
 - UNI17159 - MLGKGGKRKFDEHEDGLEGKIVSPSDGPSRVSYTLQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEELKQEGSLRPAF

TPSSQPSNSLSDSYQEAPPPAPHPCDLGSTTPLEACLTPASLLEDDNDDTFCTLQAVHPAAPTRLSSAALPAEKDSFSSALDEIEELCPTSTSTEAAHTA

APEGPKGTSSESSVQKPEGPEEGRTDDSRFMDSLPGNFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSASGTASKMAPVSADDLLKTLAPYSNQPV

APSQPFKMDLTELDHIMEVLVGS
Transcript ENSMUST00000109586
Sequence
AGAGGCTCGCAGGCGGACGTCACTCCCGCACGGCGAGTGCTGGAGCACGAGCTGTACCTCTCTCGGCCCGGGCGTCCACTCCGCCCGCCTCCTGCTTCCT

CCAGGCTGCCCGCCGCCTCCACCATTGTATAATGTTCCCGACTCGCAAGCAGAGGACGCCGGAGTCGTAGCTCCGGCCTCGCCGAGCTCCCTGCTACCGT

CGGCCCCGCGGCGGGGGCGCCCCGCATGGAGCGGGCATAGCTTGAGGGGTGGGCGGAAACCCCTCCGATGCGTTAGCTCCTGGTGGACCTGCTTGTG - 

UNI17159 - - UNI31752 - ATATATGTTGGGTAAAGGAGGAAAACGGAAGTTTGATGAGCATGAAGATGGGCTGGAAGGCAAAATCGTGTCCCCC

TCCGACGGTCCATCCAGGGTGTCTTACACCTTACAGCGCCAGACTATCTTCAACATTTCCCTTATGAAACTGTATAACCACAGGCCTCTGACAGAGCCCA

GCTTGCAGAAGACTGTCTTAATTAACAACATGTTGAGGCGGATCCAGGAGGAACTCAAGCAGGAAGGCAGCCTGAGGCCTGCATTCACCCCCTCTTCCCA

GCCGAGCAACTCACTGAGCGACAGCTACCAGGAGGCCCCGCCTCCTGCTCCTCACCCCTGTGACCTCGGAAGCACTACACCCTTGGAGGCCTGCCTCACC

CCTGCCTCCCTGCTCGAGGACGACAACGATGACACTTTTTGCACTTTGCAGGCTGTGCACCCTGCAGCTCCCACTAGACTCTCTTCTGCAGCCCTCCCAG

CAGAGAAGGACAGCTTCTCCTCCGCCTTGGATGAGATCGAGGAGCTCTGTCCCACATCTACCTCCACAGAGGCTGCCCACACAGCAGCCCCTGAGGGCCC

GAAAGGAACCTCCAGTGAGTCCAGTGTCCAGAAACCTGAGGGGCCCGAGGAAGGCCGCACAGATGACTCACGATTCATGGACTCTCTGCCTGGGAATTTT

GAAATAACAACGTCCACGGGTTTCCTGACAGACTTGACCCTGGATGACATCTTGTTTGCTGACATTGATACATCCATGTACGATTTTGACCCCTGCACAT

CTGCATCGGGGACAGCCTCAAAGATGGCCCCTGTGTCAGCTGATGACCTCCTCAAGACCCTGGCTCCTTACAGCAATCAGCCTGTTGCCCCAAGTCAGCC

TTTCAAAATGGATCTCACGGAGCTGGACCACATCATGGAGGTGCTTGTTGGCTCCTGAGACCTGGGCCCACGTGACTGCGCCCAGCCAGGCTCTGCACCC

TTGCAGCCCCGACAGTTTCTCCGCACTGTGCATGGACCCTTGCTTGCCTTTTTCAGAGAAAAAGAAAATTTTACAAAAGGATCACACTAGTATTTTCTTC

AAGCAGAGTTGGAGTGCCTTCATTCGAGTATGCCCACTTGTAACACACTCTTCTGAGTGGGTTCCTCAGAGCCCTGCTGCCCTGGCGTAGGAGAGAAGAC

ATTTGAAGACTGTGTTGCTAATGTTGAAAGGTGAACAGGAACAGTTCAAGTGAAGCACAAGGATTAAGTTGGAAAAGCTGTAAATTGCATGTGCATATTT

GTCTATTTTTTCTATAAGTTTTATTGCAAGAGGTAAAAAAAAAAAAGAATATATATCTATATTATTTGGATAATCTCAGTACCTTTTCTGGCGTTTTGCC

CTGTGTAAGTTGACTTGGCAATTCAGCCTTTTTAGAGGCATTAACTACTCGTAAGTGTTGCATTTACATGGCTGTTTAGAAAACTGCTGCCCAAATTTAT

TTTATATTTTTGTACAGATTCTGCAGTTTATGATATTGTTTTTCTAAACACAAATGCTGTTTATACCTATGAAATAGCTATTTTGATAGGATTTGCTCAC

ATAGTTCCTGCAAACATGAGATGTACAAGTTGCACTTGTACTTTTATAGGACTTGTAATGTTTTATATGTGTGTGGTGCAAGAGAGAACTGGATCACGTC

AGTCTGCAGTTGATGTCCCCACTGCAAATACACACAGCGCTTTCATAAAGGGCCAGGTGATCTGACACCCAAATTTCACAAGCACCAGCCCCTGGCACGG

TCACCCGCCAGCACTGTGACTTCCAAAGCCAGAGCCCTGTCTGCTCATCAAACATGCATTAAGCAGTTGGCGGGGAGATGGCTGTGTTTCTTGGGGTAGG

GAGGGCGGAGTTGATGTGGCAGGCTCCTTAGCTCCCTCTTTTGAACAGAGGCTGCATCATCTTATTTAAGAGTGGACTCAGCAGGGTGTGGTGGCACACC

CCTGTAATTCCAGCATTTGGGAGGCAGGGGCAGGCAGATTTTTGTGAGTTCCAGTCCAGCCAGAACTATACAGTGAGAAAACCCTGTCTCAAGGTGGGGG

TGGGGAGGGAGGGGGAACAGGGGGATAAAAAACAAAACAAAACTGTATTTATGCCAAGTTGCTATTTTAATTGTTTTTATTTTAAATTTTTGAAATGAAA

ACCCCAGTCTTTGTCTTTTGGCATAGCTTTTATGACGAGACCACAATTTTACACAACAAAATTTTACAACAAGCAACTGACCTTTTGCTGGAGGTGAGCC

CCACTTCAGTACTTAGTTCCCCAGAAGGCATCCATCGTGTTGCTGAGCTGCCTCTCCCATGTCCTTTCCCTGGAGCTTTTGTTCCCTCTGTTGCTAAGAG

CTGCAAATGGCATCTTTCTGATCAGCACAGTGAGCTAGCTCTGCGCACCTCCGCCAGCCGGGACGCGCTCGCTCGCTCTCCTGACATCTGTGACTAGAGC

CGCAGTCCACCGCCTTATGTCATGGTGTCCAATCTGGTTGCTTTCCTTAATTAACTGCTAATTTAACTACACTTTACAAAGCTGTTATTCCCAAATACAT

AGAGAGGAATTTCTATGCACGTCTCTGGCCTTCCCCTACCCCCATGTGCTAGCCCCTCCAGCGGCTCTTTCTTTAGTGATCCCCCCAACACGTGCACTCA

TGAGATGCAGTCGTTTGTTTTAGTGTATCAGGCCTGTTGCTGAAACCGCCTTTCTGTTTCATGGCTCGCTCTTGCAGTGTGGTATTTGAGCTGTTGAGTG

CAGGTTACAACCTATATGGCTTCTTTAGAAATAACTTTTATATTTATTTAAAAAAACTTAAATTATGGGATTTTGTTTTTGTTTTTGGTTGTCTTTGTTG

GTCATTTGTCAATATACAGTCACCAACCAACTCTGCTCACTTCTTGCCATGGATAAAATGGGCCTTTCTGGCCAATTAAAAAGATAAATTTTATAAATGG

CACTTTAAAACAAGCCATAAATAGATTTATTTTTATAATGCACATGGCAAGCAAATGCATTTGTGATGAAGGAACTGCTCATCCAAGCAGAAGATTTGTG

GATGGTGCGATTAATATCTTTTTACCTTTTCTTCACTGGAATGTGTCTGACAGGCTGACTGTCAGCTCTGGAGCAGCGGGAGGCTGATCCAGCTGTGCTC

CTACAGGCACCTCCAGCCTTTCACCAGCCCCTTCACGCGTGTGTCTCCTTTCTTGTAGGGCAGGGACCACACGTAGGGGAGGTTGTCATGCACACTTGCA

AGTGTCTCTGTGCCTGTCCATCTTAAGAACTTGTCTGTCTTGTAGAGAGCAGGTCTGCCCGTACTCTGTGTGTTTTAGAACTGGAGGATCCTGTGAACTG

GCCACATGCCACACACATCTGCATACATGTGCATATACAGTAGTGTTGATGATTCCCAGCAAAAATGGCACAAAGCAGTTGATTGCCATTGTCAAAAACT

GATTTACAGTAACTTAGAACAACTGTACTTTTGTTGGATTAGCAAATCATGTGTTTAAACAATCCCATATGTTGGGCAACAGTTCAAATAAGCACAGAGA

AGCATTGCCCAAACTTGGTTCTCAAACTCTAGTGCATTTGTAAGGCTGGGCTTCAAAATCAAAACACCCACCCCCAACACCGGCAGGCAGAGTGCTAATT

CCTGAAACATCCATGGGAAGCCAATGGCCCTGTTTTCAGGAAGAGCAAGCCCACCAAGAGTTAAGACTGTCTTTGTGTCCTATTTATACTAAGCCATGTC

CCAACAGGGAAGAGTTTGGAACCAGAGTGAGAGCTCCCAGTCCCAGTTTGAGTGGGGGAATGTGCTTCTAGACGCTTCCTGGCAGTAGTGGCTCACCTTC

ACAAAGACAGTCTTGTGGCATCCGAGCCAGGCAGACAGCCTGGGGTGCCTGGGCCTGACAAGCTTGTTGACAATGACGTGCAATGACGTGACAAGGTGAG

AGCAGAATCCTGAGAGACTTAAAGGGATGGTTTTCCCCATAAGTTATTTATTCTTTTTTTTTTTCTGTGTAAATATATTTATTTTATTGTGGCACTCTAA

TAACATCCTGGTGGTATGGTGCAGAATGTATGGTAGGAATGTATTTCTTGTAGGGATGTAGATCTGTGTGTATTAAAAGGGGGAGCCAAGCCAGCCCCCA

CCTGTCTCTTCATCAGATACAGTCCACATTCATTTTTAACTCTCATCTCCAATATGGGTCTATTTAAAATATGCAAAAAGGTATGGATGAGGAATGTTTT

AATACCTCCAAATTTTTAAAAAAATCAAGCATAAAAGAGTTGATAATTTTTTAAAGTTTTCTTAGTAGCACTTTCTCTTGATGACAGAAGGGCAACACAT

AGGCACCCACCTTCATACCAAAGGGTGAGAAATGGCCACAGCCTCCTACACCACTCCAGTGTCTTTAGCAATTGAGCTTTCTATCGCCATAGCCCCAACC

ATCCTGAGGTCAATCAAGGAAAATTTCTTTACGACGTAAGCTCCAAAGAGCCAAAGTATCAACTCACGGATCATTTTTAAAGCCTAAATTTCTTACCACC

TTTGCAGTAAACAATGAATTATGAACACTGCAAGGGCAGCCTTCTTAAATGACAGACACAAAGACTGCTTGTGCAGCAATCGCTACTCTACTCTCTGAAT

TGTCTTAATTGTGAAACCTTGCTCTTACAGATTGAACCTTTTTACATTTCTGAAAATAGCAGAAAGAGCATATTTGACTTGTCCTAGCTGTAAGTGGTTG

GTTCTTGTTGCTGCCCGGCCCCTGGATGCCAGCAGGGTGTGCATCCGCCCGTGTGCAACTGTCTCCAGTGCTTCCAAGGGTGACTCTACATGGCTCTTGG

CCAGGATCAAACGCTCTTGCAGACAAAGCCAGTATAGATTTTAGACTTCTTTTGGGGAATTTGGGAGAGAAGAGTAGTCCATATGTACAGCTAAAGTGGT

GACAGTGTACATGGGGACGTGTTGGTGCGTGGGTTTTGAGGAAGGACGTGTGACCTTTCCCCACAGACCTGAGAGCTGTGCCTTTTCTATGCAATATTAC

AGACGTCACATCAGAACCCAGAGGGCTGTGTTCAATATAGATTCATTCAGGCTGTATTCTAAACAATTGGACAGATTAAATGTACATGGAAATGAGCAGT

CTTTTGTAGTTTTATATTATACAATAAACAGTTAAAAGATGAAACA
Translation
 - UNI17159 - - UNI31752 - MLGKGGKRKFDEHEDGLEGKIVSPSDGPSRVSYTLQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQ

EELKQEGSLRPAFTPSSQPSNSLSDSYQEAPPPAPHPCDLGSTTPLEACLTPASLLEDDNDDTFCTLQAVHPAAPTRLSSAALPAEKDSFSSALDEIEEL

CPTSTSTEAAHTAAPEGPKGTSSESSVQKPEGPEEGRTDDSRFMDSLPGNFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSASGTASKMAPVSADD

LLKTLAPYSNQPVAPSQPFKMDLTELDHIMEVLVGS
Transcript ENSMUST00000093292
Sequence
ATCAATCCAATTAAATGTCTTGAGCGAGCCGAGCGGGCGGTGCTCCCCGCCGCCGGCCGCCCCTGCTCTCGGCGCCCCGCTATCCATGGCTGGCTGGCTG

TATTCCTCCCGGTGCGCCCTCTTCCCGCATCTCGCCAGCCTCGGCAACTTCCCTTCAGCTAGCCTCTGCCCCCAGGCCGCCACGGCATGGGCTAGACCCC

GAGCCGCTTCTTGCCGTCTCCCGTCCAGTCCGTGTGCGGTATCGCCCCTTTAGCCTGTCTCGCCCATCCCCGCCGTTTCCCCGACAGTCAGTCCATCCCT

CGGTCGGCTTTCCTCCGCGGGGCAGCGGTGGAGGACCAGCGGGCTCCGTAGGAGCGGGAGCCCCCACCCCGCTCCTCCTCCCGCTCCTCCGCGCTCTCAC

TCGTCGGGATCCCCGTCCCACACCTAGGGACGCGCCGACCGACGTCCTCTCCCCGCGGCCGTACGACCCGCCCGGGGGCTGGACCCGGCGCCCACTTCTT

CGCGGAAG - UNI17159 - - UNI31514 - - UNI31752 - ATATATGTTGGGTAAAGGAGGAAAACGGAAGTTTGATGAGCATGAAGATGGG

CTGGAAGGCAAAATCGTGTCCCCCTCCGACGGTCCATCCAGGGTGTCTTACACCTTACAGCGCCAGACTATCTTCAACATTTCCCTTATGAAACTGTATA

ACCACAGGCCTCTGACAGAGCCCAGCTTGCAGAAGACTGTCTTAATTAACAACATGTTGAGGCGGATCCAGGAGGAACTCAAGCAGGAAGGCAGCCTGAG

GCCTGCATTCACCCCCTCTTCCCAGCCGAGCAACTCACTGAGCGACAGCTACCAGGAGGCCCCGCCTCCTGCTCCTCACCCCTGTGACCTCGGAAGCACT

ACACCCTTGGAGGCCTGCCTCACCCCTGCCTCCCTGCTCGAGGACGACAACGATGACACTTTTTGCACTTTGCAGGCTGTGCACCCTGCAGCTCCCACTA

GACTCTCTTCTGCAGCCCTCCCAGCAGAGAAGGACAGCTTCTCCTCCGCCTTGGATGAGATCGAGGAGCTCTGTCCCACATCTACCTCCACAGAGGCTGC

CCACACAGCAGCCCCTGAGGGCCCGAAAGGAACCTCCAGTGAGTCCAGTGTCCAGAAACCTGAGGGGCCCGAGGAAGGCCGCACAGATGACTCACGATTC

ATGGACTCTCTGCCTGGGAATTTTGAAATAACAACGTCCACGGGTTTCCTGACAGACTTGACCCTGGATGACATCTTGTTTGCTGACATTGATACATCCA

TGTACGATTTTGACCCCTGCACATCTGCATCGGGGACAGCCTCAAAGATGGCCCCTGTGTCAGCTGATGACCTCCTCAAGACCCTGGCTCCTTACAGCAA

TCAGCCTGTTGCCCCAAGTCAGCCTTTCAAAATGGATCTCACGGAGCTGGACCACATCATGGAGGTGCTTGTTGGCTCCTGAGACCTGGGCCCACGTGAC

TGCGCCCAGCCAGGCTCTGCACCCTTGCAGCCCCGACAGTTTCTCCGCACTGTGCATGGACCCTTGCTTGCCTTTTTCAGAGAAAAAGAAAATTTTACAA

AAGGATCACACTAGTATTTTCTTCAAGCAGAGTTGGAGTGCCTTCATTCGAGTATGCCCACTTGTAACACACTCTTCTGAGTGGGTTCCTCAGAGCCCTG

CTGCCCTGGCGTAGGAGAGAAGACATTTGAAGACTGTGTTGCTAATGTTGAAAGGTGAACAGGAACAGTTCAAGTGAAGCACAAGGATTAAGTTGGAAAA

GCTGTAAATTGCATGTGCATATTTGTCTATTTTTTCTATAAGTTTTATTGCAAGAGGTAAAAAAAAAAAAGAATATATATCTATATTATTTGGATAATCT

CAGTACCTTTTCTGGCGTTTTGCCCTGTGTAAGTTGACTTGGCAATTCAGCCTTTTTAGAGGCATTAACTACTCGTAAGTGTTGCATTTACATGGCTGTT

TAGAAAACTGCTGCCCAAATTTATTTTATATTTTTGTACAGATTCTGCAGTTTATGATATTGTTTTTCTAAACACAAATGCTGTTTATACCTATGAAATA

GCTATTTTGATAGGATTTGCTCACATAGTTCCTGCAAACATGAGATGTACAAGTTGCACTTGTACTTTTATAGGACTTGTAATGTTTTATATGTGTGTGG

TGCAAGAGAGAACTGGATCACGTCAGTCTGCAGTTGATGTCCCCACTGCAAATACACACAGCGCTTTCATAAAGGGCCAGGTGATCTGACACCCAAATTT

CACAAGCACCAGCCCCTGGCACGGTCACCCGCCAGCACTGTGACTTCCAAAGCCAGAGCCCTGTCTGCTCATCAAACATGCATTAAGCAGTTGGCGGGGA

GATGGCTGTGTTTCTTGGGGTAGGGAGGGCGGAGTTGATGTGGCAGGCTCCTTAGCTCCCTCTTTTGAACAGAGGCTGCATCATCTTATTTAAGAGTGGA

CTCAGCAGGGTGTGGTGGCACACCCCTGTAATTCCAGCATTTGGGAGGCAGGGGCAGGCAGATTTTTGTGAGTTCCAGTCCAGCCAGAACTATACAGTGA

GAAAACCCTGTCTCAAGGTGGGGGTGGGGAGGGAGGGGGAACAGGGGGATAAAAAACAAAACAAAACTGTATTTATGCCAAGTTGCTATTTTAATTGTTT

TTATTTTAAATTTTTGAAATGAAAACCCCAGTCTTTGTCTTTTGGCATAGCTTTTATGACGAGACCACAATTTTACACAACAAAATTTTACAACAAGCAA

CTGACCTTTTGCTGGAGGTGAGCCCCACTTCAGTACTTAGTTCCCCAGAAGGCATCCATCGTGTTGCTGAGCTGCCTCTCCCATGTCCTTTCCCTGGAGC

TTTTGTTCCCTCTGTTGCTAAGAGCTGCAAATGGCATCTTTCTGATCAGCACAGTGAGCTAGCTCTGCGCACCTCCGCCAGCCGGGACGCGCTCGCTCGC

TCTCCTGACATCTGTGACTAGAGCCGCAGTCCACCGCCTTATGTCATGGTGTCCAATCTGGTTGCTTTCCTTAATTAACTGCTAATTTAACTACACTTTA

CAAAGCTGTTATTCCCAAATACATAGAGAGGAATTTCTATGCACGTCTCTGGCCTTCCCCTACCCCCATGTGCTAGCCCCTCCAGCGGCTCTTTCTTTAG

TGATCCCCCCAACACGTGCACTCATGAGATGCAGTCGTTTGTTTTAGTGTATCAGGCCTGTTGCTGAAACCGCCTTTCTGTTTCATGGCTCGCTCTTGCA

GTGTGGTATTTGAGCTGTTGAGTGCAGGTTACAACCTATATGGCTTCTTTAGAAATAACTTTTATATTTATTTAAAAAAACTTAAATTATGGGATTTTGT

TTTTGTTTTTGGTTGTCTTTGTTGGTCATTTGTCAATATACAGTCACCAACCAACTCTGCTCACTTCTTGCCATGGATAAAATGGGCCTTTCTGGCCAAT

TAAAAAGATAAATTTTATAAATGGCACTTTAAAACAAGCCATAAATAGATTTATTTTTATAATGCACATGGCAAGCAAATGCATTTGTGATGAAGGAACT

GCTCATCCAAGCAGAAGATTTGTGGATGGTGCGATTAATATCTTTTTACCTTTTCTTCACTGGAATGTGTCTGACAGGCTGACTGTCAGCTCTGGAGCAG

CGGGAGGCTGATCCAGCTGTGCTCCTACAGGCACCTCCAGCCTTTCACCAGCCCCTTCACGCGTGTGTCTCCTTTCTTGTAGGGCAGGGACCACACGTAG

GGGAGGTTGTCATGCACACTTGCAAGTGTCTCTGTGCCTGTCCATCTTAAGAACTTGTCTGTCTTGTAGAGAGCAGGTCTGCCCGTACTCTGTGTGTTTT

AGAACTGGAGGATCCTGTGAACTGGCCACATGCCACACACATCTGCATACATGTGCATATACAGTAGTGTTGATGATTCCCAGCAAAAATGGCACAAAGC

AGTTGATTGCCATTGTCAAAAACTGATTTACAGTAACTTAGAACAACTGTACTTTTGTTGGATTAGCAAATCATGTGTTTAAACAATCCCATATGTTGGG

CAACAGTTCAAATAAGCACAGAGAAGCATTGCCCAAACTTGGTTCTCAAACTCTAGTGCATTTGTAAGGCTGGGCTTCAAAATCAAAACACCCACCCCCA

ACACCGGCAGGCAGAGTGCTAATTCCTGAAACATCCATGGGAAGCCAATGGCCCTGTTTTCAGGAAGAGCAAGCCCACCAAGAGTTAAGACTGTCTTTGT

GTCCTATTTATACTAAGCCATGTCCCAACAGGGAAGAGTTTGGAACCAGAGTGAGAGCTCCCAGTCCCAGTTTGAGTGGGGGAATGTGCTTCTAGACGCT

TCCTGGCAGTAGTGGCTCACCTTCACAAAGACAGTCTTGTGGCATCCGAGCCAGGCAGACAGCCTGGGGTGCCTGGGCCTGACAAGCTTGTTGACAATGA

CGTGCAATGACGTGACAAGGTGAGAGCAGAATCCTGAGAGACTTAAAGGGATGGTTTTCCCCATAAGTTATTTATTCTTTTTTTTTTTCTGTGTAAATAT

ATTTATTTTATTGTGGCACTCTAATAACATCCTGGTGGTATGGTGCAGAATGTATGGTAGGAATGTATTTCTTGTAGGGATGTAGATCTGTGTGTATTAA

AAGGGGGAGCCAAGCCAGCCCCCACCTGTCTCTTCATCAGATACAGTCCACATTCATTTTTAACTCTCATCTCCAATATGGGTCTATTTAAAATATGCAA

AAAGGTATGGATGAGGAATGTTTTAATACCTCCAAATTTTTAAAAAAATCAAGCATAAAAGAGTTGATAATTTTTTAAAGTTTTCTTAGTAGCACTTTCT

CTTGATGACAGAAGGGCAACACATAGGCACCCACCTTCATACCAAAGGGTGAGAAATGGCCACAGCCTCCTACACCACTCCAGTGTCTTTAGCAATTGAG

CTTTCTATCGCCATAGCCCCAACCATCCTGAGGTCAATCAAGGAAAATTTCTTTACGACGTAAGCTCCAAAGAGCCAAAGTATCAACTCACGGATCATTT

TTAAAGCCTAAATTTCTTACCACCTTTGCAGTAAACAATGAATTATGAACACTGCAAGGGCAGCCTTCTTAAATGACAGACACAAAGACTGCTTGTGCAG

CAATCGCTACTCTACTCTCTGAATTGTCTTAATTGTGAAACCTTGCTCTTACAGATTGAACCTTTTTACATTTCTGAAAATAGCAGAAAGAGCATATTTG

ACTTGTCCTAGCTGTAAGTGGTTGGTTCTTGTTGCTGCCCGGCCCCTGGATGCCAGCAGGGTGTGCATCCGCCCGTGTGCAACTGTCTCCAGTGCTTCCA

AGGGTGACTCTACATGGCTCTTGGCCAGGATCAAACGCTCTTGCAGACAAAGCCAGTATAGATTTTAGACTTCTTTTGGGGAATTTGGGAGAGAAGAGTA

GTCCATATGTACAGCTAAAGTGGTGACAGTGTACATGGGGACGTGTTGGTGCGTGGGTTTTGAGGAAGGACGTGTGACCTTTCCCCACAGACCTGAGAGC

TGTGCCTTTTCTATGCAATATTACAGACGTCACATCAGAACCCAGAGGGCTGTGTTCAATATAGATTCATTCAGGCTGTATTCTAAACAATTGGACAGAT

TAAATGTACATGGAAATGAGCAGTCTTTTGTAGTTTTATATTATACAATAAACAGTTAAAAGATGAAACA
Translation
 - UNI17159 - - UNI31514 - - UNI31752 - MLGKGGKRKFDEHEDGLEGKIVSPSDGPSRVSYTLQRQTIFNISLMKLYNHRPLTEPSLQ

KTVLINNMLRRIQEELKQEGSLRPAFTPSSQPSNSLSDSYQEAPPPAPHPCDLGSTTPLEACLTPASLLEDDNDDTFCTLQAVHPAAPTRLSSAALPAEK

DSFSSALDEIEELCPTSTSTEAAHTAAPEGPKGTSSESSVQKPEGPEEGRTDDSRFMDSLPGNFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSAS

GTASKMAPVSADDLLKTLAPYSNQPVAPSQPFKMDLTELDHIMEVLVGS

For any suggestions or comments, please send an email to unitrap@crg.es