Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049940 (Pgrmc2)
Chromosomal location
Chr 3: 40870263 - 40886947 (-)
Description
progesterone receptor membrane component 2 Gene [Source:MGI (curated);Acc:Pgrmc2-001]
UniGene
Mm.40321 Mm.413635 Mm.476447 
MGI
MGI:1918054 
Uniprot/SWISSPROT
Q80UU9 
Human Ortholog
ENSG00000164040 (PGRMC2)
Omim not available
UniTrap UNI33049
Vector Insertion
Chr 3: 40874201 - 40886948
Public Clones (sanger) IST12086A10 (tigm) IST12566F7 (tigm) IST14442H12 (tigm) IST10123G3 (tigm)
IST11974B5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000058578
Sequence
GGCGGGAGGAGGAAGGCGCTGGCGGGCAGTGATGGCGGCGGGTGATGGGGACGTAAAGCTAAGCACCCTGGGGAGCGGCGGGGAGAGTGGCGGCGACGGG

AGCCCGGGTGGCGCCGGAGCGACGGCGGCGAGGAGCAGTTGGGTGGCGGCGCTGCTGGCGACGGGCGGGGAGATGCTGCTGAACGTGGCGCTGGTGGCGC

TGGTGCTGCTGGGGGCCTACCGGCTGTGGGTGCGCTGGGGGCGGCGTGGTCTGTGCTCGGGACCCGGGGCGGGCGAGGAGAGCCCGGCCGCCACGCTGCC

GCGCATGAAGAAGCGGGACTTCAGCCTGGAGCAGCTGCGCCAGTACGACGGGGCGCGCACGCCGCGCATCCTGCTCGCGGTCAATGGGAAAGTCTTCGAC

GTGACCAAAGGCAGCAAGTTCTACGGCCCCG - UNI33049 - CGGGTCCATATGGCATCTTTGCTGGCAGGGACGCCTCCAGGGGGCTGGCGACATT

CTGCCTGGATAAGGATGCACTTAGAGATGAATATGACGACCTCTCAGATTTGAACGCAGTGCAAATGGAGAGTGTTCGAGAATGGGAAATGCAGTTTAAA

G - UNI33049 - AAAAATATGATTATGTAGGCAGACTCCTAAAGCCAGGGGAGGAGCCATCAGAGTACACAGATGAGGAGGACACCAAGGATCACAG

TAAACAGGACTGAACTTTGTGAGCAACCAAAGCCAGGGGCCTTCAGAACTGCAGCTCGTACCCCTTTCAGAGAATGTCCAGTCTTTGGGTGTGATGCTCC

TGCTGTGAGAAACACCTCACCAGCGTGAACAAGATAATCTGCCTGACTGAAGATCTGAGGATGAGGCGTTGGTTGTGCTGCCAGGTGAATTTGTTGCCGT

TGGTTGTAATGTCTGGTGGGCTTCATCATCCTAAACAGGAGACAGGACCTTCTTAACAGCAAGAAAGTCACCGGGTCGTTTTTCCCCCTCCCCTGCCCCA

CCTTCCCCTCCTCCCCTTCTCTCTCTGCCTTCCTTTCTTTCCCCCACCCCTCCCATGTCTCTCTTAAAACAAAAAAGTATCAAAGACAACCAGATAGGTA

TTTGCTACTCAGTGTGCAGATCTCTGGAAAGCAAGGGATACTGTTTCACAGGCTGTGTTTTATTTGTGTTAAGGGAAGAGCCCTGGGCAGGGAAGAGGGG

TTGCATATTCATTTAAGAAGTTCAGGCTACTGAAACATTCAAACGTGAATTCCCAAACTTTTCTTTCCGGGCTTTGTCAGAGAAGGGGGTAAATGTCCTT

CTAAGAAAGATCTGGAAGTTAGAGGAATATCCAGCGGATTGAAGTCAGCAGTTCCCAGCAACGATAATTTGAAACCAGTTTTATTTCTTTCCCTTCCTTC

CGCTAGGTCAAATCAATATTAATTGTGCCTTATTTCACTTCCATAAACTTGAATTACTTTTTGGGAAAGCCCCTCTGTGAATTGAGAAGTCACTACAAGC

AGCATTGAGCCTGAGGCTGATGTCATTCTGTGTGTAGAATGGAAGAGGAGTACTCAGTGTTAACTGCCATATGTTAGAACACAAACATAGCTAGCATTGT

GATGGCCAAATGCATCCCCTGGGCTCTTTTCTTTTCCAAGAAAAATTGAAAAACCAACTACTCTTCCCCAACAGCTGCCTAATTTTAGGAGTCTGACCCT

CACTCGTCACTGGTGTGGGTAGCAGGGCCGTGGTATGAATGTCTGTGTGAGTGAGTCTGGATGTCTGTGAGAGCACCTTGGGGGAAACTTCCTGCGATGC

TGTAAATACGAGTACCGTTTTAATAAAGCATGTACAATAAACCAAATAAGCTCGAGTCGGACTCTAAATACAGAGCCGTGAGCCAGTGTGTCATGTACTA

ATACTGCATTTGATTCACGATGAGGGGGAAACCCTCTTAGAAATGAAAATCAGGCCCTGACTAGCCAAGCTGTCCGTGTCCCATGCTCAGTGTAACTTCC

AAGGCAGGTCCACCTCTGTGGGTGGTTCAGGTAAGAAGGGATATTACAGTGGACAGTGCTCTCAGGCCTCGCTGCCACTCAGTGTGCTGGAAGCACCAGC

CTTCCAAAGTAGGAACTGACATAGAAACACAGTATTGTACCCATAGCCAGTAAATCCCGTTCTTGTCAGTTAAAAAAGTTCTATTTCAAAGCCTGCTTAG

TTTGGGTTTTGGCTTCATTATGGTGGACTCTTAGTCAGGGACAGATTGCTCTCACAGAGAAAAGCCCCAAGGAGGTGGCATTAAAGACGTGTTCCTGACG

GGTGCAGTGCAAGCAGAAGCTCGGGTTCGATGGGAAGCAGAGGGCGAGCGGTGCTACACTCGTAGCATGCTGGAATAGCCTCCAGAAGTGTGCTTGTCAC

CACATCCTGTCTGAAGAACTCAAGGAGACTGAAGAGTGTTGGGAAGTGCTTCCTTTATATGTAAAACACTTTCTAAAAGCAAATTGTTATATATTATCTA

TCCTCTGGTGTAGTAAATTGGTGTATCTGAACCATTGAGCCTAATAATCTGCGATTGCGAGAAGCCGCAGGTATTCATGCAGTAAAAAACAATGCATTTT

GGTTTTTAAAAGGAAGTGGTTTTGTGTTTTGGACTTTAAATAAACTGTGTTCGTAGATAATTTCTTAATTCCAGTCAAATGTCTCATTGTTAGGTAGTGT

GGTACCCAGACCTAGAGGGTCTGTAACCGGCCTGACTGATGGGGGCGGGGGGTTAGGACACGTTTCTTTTCTTTTTTTTCTTTTTCTTATCCTTCAGTGT

TAGAATTCAGACACAGGGCTTCACATATTGCTCAACCATTTACATCCCAGCTCCAAAGTATACATTCTTCCTATCCACTGAGCCTAAATCTGTTTGTGGT

TCCTCCAATCAAACGTACGATTGGACATGTTTGAGAAACACTGCATCCACCTTTTGAAGTTGTGTGGTCCATGTTTGCCATACAATAAAAGTTGAACTT
Translation
MAAGDGDVKLSTLGSGGESGGDGSPGGAGATAARSSWVAALLATGGEMLLNVALVALVLLGAYRLWVRWGRRGLCSGPGAGEESPAATLPRMKKRDFSLE

QLRQYDGARTPRILLAVNGKVFDVTKGSKFYGPA - UNI33049 - AGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFK

E - UNI33049 - EKYDYVGRLLKPGEEPSEYTDEEDTKDHSKQD

For any suggestions or comments, please send an email to unitrap@crg.es