Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049969 (Plekhf2)
Chromosomal location
Chr 4: 10915810 - 10934717 (-)
Description
pleckstrin homology domain containing, family F (with FYVE domain) member 2 Gene [Source:MGI (curated);Acc:Plekhf2-001]
RefSeq_dna
NM_175175 
RefSeq_peptide
NP_780384.1 
UniGene
Mm.34351 Mm.410004 Mm.413417 
MGI
MGI:1919051 
Uniprot/SWISSPROT
Q91WB4 
Uniprot/SPTREMBL
A2AIL3 A8Y5N8 
Human Ortholog
ENSG00000175895 (PLEKHF2)
Omim not available
UniTrap UNI428
Vector Insertion
Chr 4: 10918502 - 10934539
Public Clones (sanger) DD0686 (sanger) D119H09 (ggtc) 5SE287H12 (ggtc) P089F11 (ggtc)
P120A06 (ggtc) D021C10 (ggtc) E088D01 (ggtc) P148E03 (ggtc) D095E03 (ggtc)
3SE287H12 (ggtc) M007C04 (ggtc) E120C02 (ggtc) E087A08 (ggtc) P143H10 (ggtc)
D079C10 (ggtc) E091A08 (ggtc) CMHD-GT_171D7-3 (cmhd) CMHD-GT_132F5-3 (cmhd)
CMHD-GT_542B3-3 (cmhd) CMHD-GT_311A03-3 (cmhd) CMHD-GT_181A2-3 (cmhd) CMHD-GT_118E2-3 (cmhd)
CMHD-GT_401F9-3 (cmhd) CMHD-GT_494G9-3 (cmhd) CMHD-GT_175A4-3 (cmhd) CMHD-GT_155C3-3 (cmhd)
CMHD-GT_542B3-3S (cmhd) CMHD-GT_318H09-3 (cmhd) CMHD-GT_307D10-3 (cmhd) PST6994-NR (escells)
PST12600-NL (escells) PST23652-NR (escells) PST10527-NR (escells) PST23639-NR (escells)
PST12600-NR (escells) PST26026-NR (escells) IST10047B2 (tigm) IST10923D10 (tigm)
Private Clones OST430247 (lexicon) OST423731 (lexicon) OST277438 (lexicon) OST260803 (lexicon)
OST230867 (lexicon) OST224348 (lexicon) OST195214 (lexicon) OST194168 (lexicon)
OST191582 (lexicon) OST183424 (lexicon) OST183035 (lexicon) OST157746 (lexicon)
OST148521 (lexicon) OST131646 (lexicon) OST86288 (lexicon) OST67935 (lexicon)
OST62931 (lexicon) OST43589 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000054776
Sequence
CTGGAGGGGCGGTGAAGTCACCTGCGAGCGGCTGCGCCCGCCGCGTCCGGATCGCGCCGGCCTCGCGGGGCCCCACGCAACCCTGCGAGGCTGGGGTCGG

GGAGCAGGCGGAGTCCGCGCCCGGAGTCGGCGACTAGGAGGACTCGCACCCTCGGCGCCGCCGCCCGCGCGGGGTCGG - UNI428 - GTTATTAGCA

AAAGATGGTGGATCGCCTGGCAAACAGTGAGGCGAATACTAGACGCATAAGTATTGTGGAGAGCTGTTTTGGAGCCGCTGGTCAGCCCTTGACCATCCCT

GGGCGAGTGCTTATTGGAGAAGGAGTGTTGACTAAGTTGTGCAGAAAGAAGCCTAAAGCAAGGCAGTTTTTCTTATTTAATGATATTCTAGTATACGGCA

ATATTGTTATCCAGAAGAAAAAATACAACAAACAGCATATTATTCCCTTGGAAAATGTCACCATTGATTCCATCAAAGATGAAGGGGAATTACGGAATGG

ATGGCTTATTAAGACACCGACTAAGTCGTTTGCAGTTTATGCTGCCACTGCCACGGAGAAGTCAGAGTGGATGAATCACATAAATAAGTGTGTCACTGAT

TTACTCTCCAAAAGTGGGAAGACGCCCAGCAACGAGCATGCTGCTGTCTGGGTTCCTGACTCTGAGGCCACCGTGTGTATGCGCTGTCAGAAAGCAAAAT

TCACACCAGTCAATCGGCGGCACCATTGCCGCAAATGTGGCTTTGTTGTTTGTGGTCCCTGCTCTGAAAAGCGATTTCTTCTTCCCAGCCAGTCTTCTAA

GCCTGTGCGGATTTGTGACTTCTGCTATGACCTGCTTTCCACGGGGGACATGGCCGCGTGTCAGCCGACTAGATCAGACTCTTATAGTCAGTCGTTGAAG

TCTCCTTTAAATGATGCATCTGATGACGACGACGATGATGATAGCAGTGACTAAGGATATGCTGTGAAGTATTTAATTGACTGCCTGAGAGTCAGCTTTG

GGGGCGCTCTCAGTTTGCTTTAGCCATGACTGCCTGAGAAGTCTTAACCTCTGTGCCTCTCTGTATCCTATGGAAAGCAGCCCCATGCTTTCTGCTCCCC

TCTGCACTCTCTCACAGGGACAAACTTGCAGATACATCCGATAGGGTCTTGGCTTTCTACTGTCCTTATTTCTAGATTATTTCCTTGTAAGTTGGAAAGA

ATGTTTATTTAACAGATCTTGTATTACATTTATTTCCCCCTGATGTGGAAAATCTAAAAGCACAGAATGATGGGAACAAGAGTATGATGTGCTTGGTATC

TGGCTTTTCCCCAAGCAGTCGATGTCAAGGTTACGACACCAGTGACAGAGCATGGTTTGGAAATCCTTTATTCTCTTTTCTCAATACCAAGTGGTGCCTT

ACTGTGGCAGCAGTGTCACTGTCACTGAAATAAACGTAAGCCCTACCTTCTTTCTTGTTTGATTGATTTAGACACACTGGTGCTCTTACAGGTGGAGAAT

GAGTGTTTGATGGATATAGGTAAGCATATTTATTTGACAGCTATGAGGAACTAAATTTAGAGGTTTCTCCAATCTTATATGAATATTTTTCATAAAATAG

TTGTGATTATATTTTTACATCTTTTATGCACCAAATTATAATGGTCACATATGTTTAGCCCGTTGCCACTGTTCGGGATTCGATTTGAAACTCATCACTA

GTATAGAAGTGGCATATCCCACTAGCTTCTACTTTCCTGATATATTTTTACAAATAACTTTATTTGCTTTACATTATTTCTAAAAGGAAAAATCTGAGGA

AACCCTTATATTTTCCAACAGGGTTCCTCTGTGTAGCTTTGCTTATCCTGGAACTCGATTTGTTGACCAGGCTGGCCTTGAATTCTCAAAAATCCATCTG

CCTCTGCCTTTGCCTCCCCAGGCACCACTACCACCTGACAAAAATGAAAAGTCTTAAGAAAATCCTCCCAGGAGAACATGGAGTCTTAGAGATCTGGAAG

AGATCGGAGTTTGACTAGGTTTCCTGTCTGCAAGTCAATTTTTTTTGTGAAATTATCTTGATTTACAACGTGGTATTGTATTTTACAGAGTTCATGAAGC

CCCAAACAATTTTTATTTTTGTAAAACAATTGTATGTTTAATCTGTTTCTGAAATCATTTTGCAATATATGGAAATAGAGTAGCAGTTGATATTTCTAAA

TTGTGACCATTGTCCGAGATTGCTTTGAGAACTGGTAGTTATTCTCTTTATGTTTGGAGGCAGCCATTAGGCTGTAGGCCTGCTTACTGCATAGCACTGG

ACGTGCCAGGCACATTCTGGCCCCTGGCATGCTTAAGTAACTAGGTTTTCAAATGTGGGAAACCAAGCTGAAAGGTCTGTTTTGTTTTGTTGTTGTTTTG

TTTTGGTTTGTTTTTTTTTTTTTTTCAGAGTTCTTTTCAAACCCAGTTTCCCTTTTTCAAACTTTAAAACCTGCATAATTCTGCAGATGTCCTAGGGTTT

GAGTCAGTAACTTGTGAATGAAAGTCATTGGTATTTGGCTTTGTGGTTACAGTACTAATTTTACTTTGCTGCTCAGTTTTGAAAGTGTGTGAGCTACATA

GGTCTCCCTGTAGGAAATGTGAAAAAAAGCACAATAGAACCAGGCTAGGGGCTTTGTTCCTGCTTTTTGTTTTGTTTGGTTTTACTATCAGATGGATGGA

TTTGTGTTTGTCTCAGAGCAGCATATACATGCAGTCAGTAAGCATGTTTGAAAGGACCATAAAAACCAGAGAAATGCTGATGGGAACTTGGAAGTTCAGA

AACCAAGGGGAAATGTCCTGAGATAACATTTGCATTGTCGACCTCAGTTGACTGTTTTTACAATAAAAATATTTTGCAGCTT
Translation
 - UNI428 - MVDRLANSEANTRRISIVESCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENVTID

SIKDEGELRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSE

KRFLLPSQSSKPVRICDFCYDLLSTGDMAACQPTRSDSYSQSLKSPLNDASDDDDDDDSSD

For any suggestions or comments, please send an email to unitrap@crg.es