Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000050043 (Txndc14)
Chromosomal location
Chr 2: 84511473 - 84518985 (-)
Description
thioredoxin domain containing 14 Gene [Source:MGI (curated);Acc:Txndc14-001]
RefSeq_dna
NM_025868 
RefSeq_peptide
NP_080144.1 
UniGene
Mm.239765 Mm.415954 Mm.371621 Mm.452349 
MGI
MGI:1914208 
Uniprot/SWISSPROT
Q9D710 
Human Ortholog
ENSG00000213593 (TXNDC14)
Omim not available
UniTrap UNI34083
Vector Insertion
Chr 2: 84518007 - 84518986
Public Clones IST14098D1 (tigm) IST10389E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20543
Vector Insertion
Chr 2: 84516315 - 84518007
Public Clones CMHD-GT_243H2-3 (cmhd)
Private Clones OST359299 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32009
Vector Insertion
Chr 2: 84513656 - 84515639
Public Clones IST10001G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000053664
Sequence
GAGAGTAGGCAGGAAAGATGGCTGTCCTTGCGCCTCTGATTGCTTTGGTGTACTCGGTGCCGCGGCTTTCTCGATGGCTGGCCCGACCTTATTGCCTTCT

GTCTGCTCTGCTTTCCATTGCTTTCCTCCTCGTGAGGAAACTGCCACCGATTTGCAATGGTCTCCCCACGCAACGCGAAGATGGCAACCCGTGTGACTTT

GACTGG - UNI20543 - - UNI34083 - AGAGAAGTGGAGATCCTGATGTTCCTCAGTGCCATTGTGATGATGAAGAACCGCAGATCCA TCACT

GTGGAGCAACATGTAGGCAACATCTTTATGTTTAGTAAAGTGGCCAACGCCATCCTTTTCTTCCGACTGGATATTCGAATGGGTCTGCTATACCTCACAC

TCTGCATAG - UNI32009 - TGTTCCTGATGACCTGCAAGCCCCCGCTGTACATGGGTCCTGAGTATATCAAGTACTTCAATGATAAAACCATTGAT

 - UNI32009 - GAGGAGCTGGAGCGAGACAAGAGGGTCACTTGGATTGTGGAGTTCTTTGCCAACTGGTCTAATGATTGCCAATCCTTTGCTCCCAT

CTATGCGGACTTGTCCCTCAA - UNI32009 - GTACAACTGTTCAGGGCTAAATTTTGGGAAGGTAGATGTTGGACGCTACACTGACGTTAGCACAC

G GTACAAAGTGAGCACATCACCCCTCACCAGACAGCTCCCTACCCTGATTCTGTTCCAAGGCGGCAAGGAGGTCATTCGTCGGCCGCAGATTGACAAGA

AAGGACGAGCTGTCTCTTGGACCTTTTCTGAG GAGAATGTGATTCGAGAATTCAACTTGAATGAGCTATACCAACGAGCCAAGAAGCACTCAAAGGGTG

GAGACATGTCAGAAGAGAAGCCTGTGGACCCTGCTCCCACTACTGTGCCAGATGGGGAAAACAAGAAGGACAAATAGGATCCTGCATTGTTTTTGCTTCC

TCTCCTGTCAATTTCAGGAACCTTTGAGGCCCAGTTCCAGCTATAACCACAATCCTTGCCTGAGGCCTTTTGATTTCTGTTTGGCTGTGCCTGGGTAGGG

GCACTGTGCCTGCTTCTGATTTTGAAAGAAGCATCCTGGAAACCATGAAGTATTCTACTATGAAGGGCGCATCTGCCCTGGTCAGCTGTTTCTCGAAGGG

AGTGATCTTATCGATAGAGGTAGAAATGGTTTCCCTCCAAGGTTGGGTCAATGTGTAAATTGCTATTCAACACTTGGATATTACCAGTCTGTGGTTTAAT

TATTCCTCCTAGTGAGCTTGCAAAGCATAGACTAAATTAAACCCTAATGTTAGATGTCAGTATAAAGCCCTTAGAATTTTTCCTCAAGGACCCCTTCTTC

CTTTAGGCCTTTCTGTCTTGATCTGTGCATTAAGAAATTTAAGTTTGGGGCTGGAGAAATGGCCCATCGATTAAGAAAGAGCACTGGTGGCTGCTTTTCC

AGAGATCCTGAGTTCAATTCCCAGCAACCACATGATGGTTCATAATGGGATCTGATGCCCTCTTCTGGCATGCAGGCAGAATACTATATATAGTAAGTAA

ATCGTAAAGAGAAAGGAATTTAAGGGGTTGGAGAGATGACTCAGTGGCTAAGAGAATTGGCTGTTCTTCCAGAGGACCCAGGTTTGATTCCTAGCAGCAC

ATAGAGGCTAAACCACCTGTAACTCTAGTCTCAGGGGCTCCAACATCCGCCCTTGACCTTGGCTGGCACTGTATGCATGTAGTGCACAAACACGTGACGG

AGGAACACATAAAAGGCTTGTATGTGTTATCATTTAAGGTCACTGTTCCCAATTAAAAGCCTTCAACCATGATTTTCATCATTGGAAATAGAATTGAATG

GCCACCCTGTGTTGTGGGAACTGAGAAGGGCAATATAAACCTGAGAGGTTCCTTTGTGTGGTGGGGCCTGAAGAAGAAAGCCCCACGGCTGGACAGCTGT

TCTCTCCTCCTATCCCACCGCTTCCCCTAATAAAGGGACTGTTCTTTTG
Translation
MAVLAPLIALVYSVPRLSRWLARPYCLLSALLSIAFLLVRKLPPICNGLPTQREDGNPCDFDW - UNI20543 - - UNI34083 - REVEILMFLS

AIVMMKNRRSI ITVEQHVGNIFMFSKVANAILFFRLDIRMGLLYLTLCIV - UNI32009 - VFLMTCKPPLYMGPEYIKYFNDKTID - UNI320

09 - EELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLK - UNI32009 - KYNCSGLNFGKVDVGRYTDVSTR RYKVSTSPLTRQLPTLILFQG

GKEVIRRPQIDKKGRAVSWTFSE ENVIREFNLNELYQRAKKHSKGGDMSEEKPVDPAPTTVPDGENKKDK
Transcript ENSMUST00000111665
Sequence
ACCCCAGAAAATCAAGTTATCCCTTAGGGTTGTGAATCGCCAAAGGGCTTCTGACACTGTTGCCCACTGGCCCCGCGTAGCCCTGTTATCTCACACCTAG

CGGGACAGGCTAGCCACACCCTCACCTGAACTACAATCTGAGTGGCTACTCTTGGCCTACTACTCACCTGGCAATTCCCGCATCAG - UNI34083 - 

CATCCAATAAGAGATCTACATCCGGGTCTGGAGGCGTTGCATCTGATATTTGGTCCAATAGAAGCCTTGCTGGTGGGGGCGGAGGACGAAGATTTGGGGA

GCGGGAGTGAGCCTGCGAGAGAGTAGGCAGGAAAGATGGCTGTCCTTGCGCCTCTGATTGCTTTGGTGTACTCGGTGCCGCGGCTTTCTCGATGGCTGGC

CCGACCTTATTGCCTTCTGTCTGCTCTGCTTTCCATTGCTTTCCTCCTCGTGAGGAAACTGCCACCGATTTGCAATGGTCTCCCCACGCAACGCGAAGAT

GGCAACCCGTGTGACTTTGACTGG - UNI20543 - - UNI34083 - AGAGAAGTGGAGATCCTGATGTTCCTCAGTGCCATTGTGATGATGAAGA

ACCGCAGATCCA TCACTGTGGAGCAACATGTAGGCAACATCTTTATGTTTAGTAAAGTGGCCAACGCCATCCTTTTCTTCCGACTGGATATTCGAATGG

GTCTGCTATACCTCACACTCTGCATAG - UNI32009 - TGTTCCTGATGACCTGCAAGCCCCCGCTGTACATGGGTCCTGAGTATATCAAGTACTTC

AATGATAAAACCATTGAT - UNI32009 - GAGGAGCTGGAGCGAGACAAGAGGGTCACTTGGATTGTGGAGTTCTTTGCCAACTGGTCTAATGATTG

CCAATCCTTTGCTCCCATCTATGCGGACTTGTCCCTCAA - UNI32009 - GTACAACTGTTCAGGGCTAAATTTTGGGAAGGTAGATGTTGGACGCT

ACACTGACGTTAGCACACG GTACAAAGTGAGCACATCACCCCTCACCAGACAGCTCCCTACCCTGATTCTGTTCCAAGGCGGCAAGGAGGTCATTCGTC

GGCCGCAGATTGACAAGAAAGGACGAGCTGTCTCTTGGACCTTTTCTGAG GAGAATGTGATTCGAGAATTCAACTTGAATGAGCTATACCAACGAGCCA

AGAAGCACTCAAAGGGTGGAGACATGTCAGAAGAGAAGCCTGTGGACCCTGCTCCCACTACTGTGCCAGATGGGGAAAACAAGAAGGACAAATAGGATCC

TGCATTGTTTTTGCTTCCTCTCCTGTCAATTTCAGGAACCTTTGAGGCCCAGTTCCAGCTATAACCACAATCCTTGCCTGAGGCCTTTTGATTTCTGTTT

GGCTGTGCCTGGGTAGGGGCACTGTGCCTGCTTCTGATTTTGAAAGAAGCATCCTGGAAACCATGAAGTATTCTACTATGAAGGGCGCATCTGCCCTGGT

CAGCTGTTTCTCGAAGGGAGTGATCTTATCGATAGAGGTAGAAATGGTTTCCCTCCAAGGTTGGGTCAATGTGTAAATTGCTATTCAACACTTGGATATT

ACCAGTCTGTGGTTTAATTATTCCTCCTAGTGAGCTTGCAAAGCATAGACTAAATTAAACCCTAATGTTAGATGTCAGTATAAAGCCCTTAGAATTTTTC

CTCAAGGACCCCTTCTTCCTTTAGGCCTTTCTGTCTTGATCTGTGCATTAAGAAATTTAAGTTTGGGGCTGGAGAAATGGCCCATCGATTAAGAAAGAGC

ACTGGTGGCTGCTTTTCCAGAGATCCTGAGTTCAATTCCCAGCAACCACATGATGGTTCATAATGGGATCTGATGCCCTCTTCTGGCATGCAGGCAGAAT

ACTATATATAGTAAGTAAATCGTAAAGAGAAAGGAATTTAAGGGGTTGGAGAGATGACTCAGTGGCTAAGAGAATTGGCTGTTCTTCCAGAGGACCCAGG

TTTGATTCCTAGCAGCACATAGAGGCTAAACCACCTGTAACTCTAGTCTCAGGGGCTCCAACATCCGCCCTTGACCTTGGCTGGCACTGTATGCATGTAG

TGCACAAACACGTGACGGAGGAACACATAAAAGGCTTGTATGTGTTATCATTTAAGGTCACTGTTCCCAATTAAAAGCCTTCAACCATGATTTTCATCAT

TGGAAATAGAATTGAATGGCCACCCTGTGTTGTGGGAACTGAGAAGGGCAATATAAACCTGAGAGGTTCCTTTGTGTGGTGGGGCCTGAAGAAGAAAGCC

CCACGGCTGGACAGCTGTTCTCTCCTCCTATCCCACCGCTTCCCCTAATAAAGGGACTGTTCTTTTGA
Translation
 - UNI34083 - MAVLAPLIALVYSVPRLSRWLARPYCLLSALLSIAFLLVRKLPPICNGLPTQREDGNPCDFDW - UNI20543 - - UNI3408

3 - REVEILMFLSAIVMMKNRRSI ITVEQHVGNIFMFSKVANAILFFRLDIRMGLLYLTLCIV - UNI32009 - VFLMTCKPPLYMGPEYIKYFN

DKTID - UNI32009 - EELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLK - UNI32009 - KYNCSGLNFGKVDVGRYTDVSTR RYKVSTS

PLTRQLPTLILFQGGKEVIRRPQIDKKGRAVSWTFSE ENVIREFNLNELYQRAKKHSKGGDMSEEKPVDPAPTTVPDGENKKDK
Transcript ENSMUST00000111664
Sequence
AATAGAAGCCTTGCTGGTGGGGGCGGAGGACGAAGATTTGGGGAGCGGGAGTGAGCCTGCGAGAGAGTAGGCAGGAAAGATGGCTGTCCTTGCGCCTCTG

ATTGCTTTGGTGTACTCGGTGCCGCGGCTTTCTCGATGGCTGGCCCGACCTTATTGCCTTCTGTCTGCTCTGCTTTCCATTGCTTTCCTCCTCGTGAGGA

AACTGCCACCGATTTGCAATGGTCTCCCCACGCAACGCGAAGATGGCAACCCGTGTGACTTTGACTGG - UNI20543 - - UNI34083 - AGAGA

AGTGGAGATCCTGATGTTCCTCAGTGCCATTGTGATGATGAAGAACCGCAGATCCA - UNI32009 - TGTTCCTGATGACCTGCAAGCCCCCGCTGT

ACATGGGTCCTGAGTATATCAAGTACTTCAATGATAAAACCATTGAT - UNI32009 - GAGGAGCTGGAGCGAGACAAGAGGGTCACTTGGATTGTG

GAGTTCTTTGCCAACTGGTCTAATGATTGCCAATCCTTTGCTCCCATCTATGCGGACTTGTCCCTCAA - UNI32009 - GTACAACTGTTCAGGGCT

AAATTTTGGGAAGGTAGATGTTGGACGCTACACTGACGTTAGCACACG GTACAAAGTGAGCACATCACCCCTCACCAGACAGCTCCCTACCCTGATTCT

GTTCCAAGGCGGCAAGGAGGTCATTCGTCGGCCGCAGATTGACAAGAAAGGACGAGCTGTCTCTTGGACCTTTTCTGAG GAGAATGTGATTCGAGAATT

CAACTTGAATGAGCTATACCAACGAGCCAAGAAGCACTCAAAGGGTGGAGACATGTCAGAAGAGAAGCCTGTGGACCCTGCTCCCACTACTGTGCCAGAT

GGGGAAAACAAGAAGGACAAATAGGATCCTGCATTGTTTTTGCTTCCTCTCCTGTCAATTTCAGGAACCTTTGAGGCCCAGTTCCAGCTATAACCACAAT

CCTTGCCTGAGGCCTTTTGATTTCTGTTTGGCTGTGCCTGGGTAGGGGCACTGTGCCTGCTTCTGATTTTGAAAGAAGCATCCTGGAAACCATGAAGTAT

TCTACTATGAAGGGCGCATCTGCCCTGGTCAGCTGTTTCTCGAAGGGAGTGATCTTATCGATAGAGGTAGAAATGGTTTCCCTCCAAGGTTGGGTCAATG

TGTAAATTGCTATTCAACACTTGGATATTACCAGTCTGTGGTTTAATTATTCCTCCTAGTGAGCTTGCAAAGCATAGACTAAATTAAACCCTAATGTTAG

ATGTCAGTATAAAGCCCTTAGAATTTTTCCTCAAGGACCCCTTCTTCCTTTAGGCCTTTCTGTCTTGATCTGTGCATTAAGAAATTTAAGTTTGGGGCTG

GAGAAATGGCCCATCGATTAAGAAAGAGCACTGGTGGCTGCTTTTCCAGAGATCCTGAGTTCAATTCCCAGCAACCACATGATGGTTCATAATGGGATCT

GATGCCCTCTTCTGGCATGCAGGCAGAATACTATATATAGTAAGTAAATCGTAAAGAGAAAGGAATTTAAGGGGTTGGAGAGATGACTCAGTGGCTAAGA

GAATTGGCTGTTCTTCCAGAGGACCCAGGTTTGATTCCTAGCAGCACATAGAGGCTAAACCACCTGTAACTCTAGTCTCAGGGGCTCCAACATCCGCCCT

TGACCTTGGCTGGCACTGTATGCATGTAGTGCACAAACACGTGACGGAGGAACACATAAAAGGCTTGTATGTGTTATCATTTAAGGTCACTGTTCCCAAT

TAAAAGCCTTCAACCATGATTTTCATCATTGGAAATAGAATTGAATGGCCACCCTGTGTTGTGGGAACTGAGAAGGGCAATATAAACCTGAGAGGTTCCT

TTGTGTGGTGGGGCCTGAAGAAGAAAGCCCCACGGCTGGACAGCTGTTCTCTCCTCCTATCCCACCGCTTCCCCTAATAAAGGGACTGTTCTTTTGA
Translation
MAVLAPLIALVYSVPRLSRWLARPYCLLSALLSIAFLLVRKLPPICNGLPTQREDGNPCDFDW - UNI20543 - - UNI34083 - REVEILMFLS

AIVMMKNRRSM - UNI32009 - MFLMTCKPPLYMGPEYIKYFNDKTID - UNI32009 - EELERDKRVTWIVEFFANWSNDCQSFAPIYADLSL

K - UNI32009 - KYNCSGLNFGKVDVGRYTDVSTR RYKVSTSPLTRQLPTLILFQGGKEVIRRPQIDKKGRAVSWTFSE ENVIREFNLNELYQRA

KKHSKGGDMSEEKPVDPAPTTVPDGENKKDK

For any suggestions or comments, please send an email to unitrap@crg.es