Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000050144 (Slc25a44)
Chromosomal location
Chr 3: 88214421 - 88229061 (-)
Description
solute carrier family 25, member 44 Gene [Source:MGI Symbol;Acc:MGI:2444391]
RefSeq_peptide
NP_848811.1 
UniGene
Mm.301740 
MGI
MGI:2444391 
Uniprot/SWISSPROT
Q8BGF9 
Uniprot/SPTREMBL
Q05DJ3 Q3TE12 Q3TMC4 Q3TNN4 
Human Ortholog
ENSG00000160785 (SLC25A44)
Omim not available
UniTrap UNI28198
Vector Insertion
Chr 3: 88225061 - 88228649
Public Clones not available
Private Clones OST37469 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31175
Vector Insertion
Chr 3: 88214420 - 88220012
Public Clones IST12268C2 (tigm) IST14549C6 (tigm) IST11869D10 (tigm) IST11722F3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107536
Sequence
ATCTCAGTTTCCGGTTCCGGCAATACCGGGATCCCAGTGGAGATGGAGGAAGATGCGAACCGAGTCTGGCTGTCGCTGGGACTGGAGGATAGCGCGGGGG

CTGCGGTCTAGGAGTCCCAGTCTCAGACGCGGCTAAAGCGCTGGGGTCTGAGAAGGAAAGCGACCACGGTGCTTAGGTGTCTTGAAGGATCAGAGGTACC

TAAGGTTCAACCTGTCGAGGAGGCAGTGGATATCTGTCTGTTCTGCGGGGCTGCATCGCCATGGGAAGCCGCTCTGCAGTTTTGGCAACGAAAGGCAAGT

CCCCCGAGGCATCTCGTCCTGGCCGAGGAGCATGAGAGACTGACAGCTAGAGAAGCCTGACGAGGGGTATGCCCGGGGACTCTGAATTGGCCGTGCAAGA

GCCTGACAGAAG - UNI28198 - GTCTCCGGGCACAATGGAGGACAAACGGAACATCCAGATCATCGAGTGGGAGCACCTGGACAAGAAGAAGTTCT

ATGTGTTTGGTGTTGCTATGACAATGATGATCAGGGTCAGCGTGTACCCGTTCACCCTCATCCGCACCCGCCTGCAGGTCCAGAAGGGCAAGAGCCTCTA

CCACGGGACCTTCGATGCCTTTGTCAAGATCCTGCGAGCAGATGGAGTGGCGGGCCTCTACCGGGGGTTCCTGGTCAACACCTTCACACTCATCTCCGGC

CAGTGCTATGTCACCACTTACGAGCTCACCCGGAAGTTTGTGGCAGACTACAGCCAGAGTAACACAGTCAAATCACTCGTAGCCGGGGGCTCGGCCTCCC

TTGTGGCCCAGAGCATCACGGTGCCGATCGATGTTGTCTCCCAACATCTGATGATGCAGCGGAAGGGTGAGAAAATGGGTCGCTTCCAAGTGCACGGGAA

CCTAGAGGGACAAGGGGTGATTGCCTTTGGCCAGACTAAGGACATCATCAGGCAGATCCTTCGGGCTGACGGTCTCCGAGGCTTCTACCGGGGCTATGTG

GCCTCGCTGCTAACGTACATCCCAAACAGTGCTGTCTGGTGGCCCTTCTACCACTTCTATGCAG CTCAGTTGAG CCAAACCTGTCCA TCTTCTTGTC

CCAG GCTAA - UNI31175 - GAGTGCCCTCACATTGTCTTTCAAGCCATCTCTGGGCCCCTGGCTGCAGCCACTGCCTCCATCCTCACCAATCCCA

TGGATGTCATCAGAACCCGTGTGCAGGT
Translation
 - UNI28198 - MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFVKILRADGVAGLYRGFLVNTFTLIS

GQCYVTTYELTRKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLMMQRKGEKMGRFQVHGNLEGQGVIAFGQTKDIIRQILRADGLRGFYRGY

VASLLTYIPNSAVWWPFYHFYAA AQLS SQTCP SSCPR RLR - UNI31175 - RVPSHCLSSHLWAPGCSHCLHPHQSHGCHQNPCAG
Transcript ENSMUST00000057935
Sequence
ATCTCAGTTTCCGGTTCCGGCAATACCGGGATCCCAGTGGAGATGGAGGAAGATGCGAACCGAGTCTGGCTGTCGCTGGGACTGGAGGATAGCGCGGGGG

CTGCGGTCTAGGAGTCCCAGTCTCAGACGCGGCTAAAGCGCTGGGGTCTGAGAAGGAAAGCGACCACGGTGCTTAGGTGTCTTGAAGGATCAGAGGTACC

TAAGGTTCAACCTGTCGAGGAGGCAGTGGATATCTGTCTGTTCTGCGGGGCTGCATCGCCATGGGAAGCCGCTCTGCAGTTTTGGCAACGAAAGGCAAGT

CCCCCGAGGCATCTCGTCCTGGCCGAGGAGCATGAGAGACTGACAGCTAGAGAAGCCTGACGAGGGGTATGCCCGGGGACTCTGAATTGGCCGTGCAAGA

GCCTGACAGAAG - UNI28198 - GTCTCCGGGCACAATGGAGGACAAACGGAACATCCAGATCATCGAGTGGGAGCACCTGGACAAGAAGAAGTTCT

ATGTGTTTGGTGTTGCTATGACAATGATGATCAGGGTCAGCGTGTACCCGTTCACCCTCATCCGCACCCGCCTGCAGGTCCAGAAGGGCAAGAGCCTCTA

CCACGGGACCTTCGATGCCTTTGTCAAGATCCTGCGAGCAGATGGAGTGGCGGGCCTCTACCGGGGGTTCCTGGTCAACACCTTCACACTCATCTCCGGC

CAGTGCTATGTCACCACTTACGAGCTCACCCGGAAGTTTGTGGCAGACTACAGCCAGAGTAACACAGTCAAATCACTCGTAGCCGGGGGCTCGGCCTCCC

TTGTGGCCCAGAGCATCACGGTGCCGATCGATGTTGTCTCCCAACATCTGATGATGCAGCGGAAGGGTGAGAAAATGGGTCGCTTCCAAGTGCACGGGAA

CCTAGAGGGACAAGGGGTGATTGCCTTTGGCCAGACTAAGGACATCATCAGGCAGATCCTTCGGGCTGACGGTCTCCGAGGCTTCTACCGGGGCTATGTG

GCCTCGCTGCTAACGTACATCCCAAACAGTGCTGTCTGGTGGCCCTTCTACCACTTCTATGCAG AGCAGCTGTCGCGCCTGTGCCCTCAGGAGTGCCCT

CACATTGTCTTTCAAGCCATCTCTGGGCCCCTGGCTGCAGCCACTGCCTCCATCCTCACCAATCCCATGGATGTCATCAGAACCCGTGTGCAG - UNI3

1175 - GTTGAAGGCAAGAGCTCCATCGTCCTGACCTTCAGGCAGCTGATGGCAGAGGAGGGGCCTTGGGGCCTCATGAAGGGCCTCTCGGCAAGAATC

ATCTCGGCTACACCCTCCACCATCGTCATCGTGGTGGGCTACGAGAGCCTCAAGAAGCTCAGCCTGCGACCTGAGCTGGTGGACTCGAGACACTGGTAGA

GAGCGGTGGATGGAGAGGCTGTGGTTTCACACATTACTCTGGGCCAGGGCAGAGCAGAGAGGATAACTGACCCTGTGAATACCACCACCACACACCCATC

CTGCTCCAGGTTGTCTGTCAGGGATAAGAGAGGAGACTTTGGACTGCTCCTTCTGCAGAGGTTCTGTGCCTGGCTTCCCTCATCCCCATCATTTGATTTC

CCCTGCAGATCTGGGCCCCTCACTCGGTCCTTATACTCAGTCATGGCCACAGGACCCCGTTAGCCCCTCTGGCACCCCTCTCTGACCTTCCCTCAGGCCT

GGAGAAGAGCTGCTCCTCGTTTGCTTGTCCCCTGCTTCTTCTCGAGCCTCAGGCCAAGGCTCTGAGTAGCTGCCTGGGGTCTATTTATTTTTTTATGCCT

GCTTATTTTAAATTTGGGACCTGAGTTGTTCACTGCTTTGTCCTGCCTTTGGGGGGACAAATCGGAGCAGCACACACTCTGCAGGGCGTTCATCTTCTAG

GGGAGTTACTAGGAGGGAGGAATGCTAAGGCTTCCTATGTGTAGCTGAACATCTGTGAATGAGCCAACTCACCCTCATAGCTCAGTCTGCTGTCAGACCC

CACTCCTTGGAGAAGTGGAAAACTGTGACACAGATCCCAATTCTTTATCCCCCTTCCCTGTCCCTCAGGCCCGGGAACCGCATGAGCTGCTGGCCTTCAT

TGGCCCAGGTGACTACAGTAGAGGGGCATAGTTATAAGTGGGTCAGACTTACTAGAGAACACTGTCCTTGGAACTTTGCCCTGAAGCCAGGTTGGGAAAG

AGCCACTGGCTTGGATGTGTGTTCCTCACTCTTATCTCCTCAGGCCAGCTGAGCCAAGCCCTGGAGGTACAACGGAGGTTCTGAGCCCGAGGCAGCAGTG

CCACAGGCACACCTGCCACCCAGATGAATAGCAACAGGTGTCTCACAGTGGGACTCTGGAATATGAACTATCCTTTTTTTTCTTGTCCTTGGTTGTGAAG

TATCATCCCAGTCATGGTACCCTGTGCTGGCAACAGAAAAAAAAAAAAAATACAGTCAGGAAGGCACCCAAGGCCAGGTCCACCTGGTTACCAGCCTCTT

ACTGCCAAAACCATTGATGCTTTCCTCAGGAGCGTCCCTCTTCCCTGCCTCTACTGAGCCTGTGTTGGTGGCAGAGAGGCACATCCAGGAATGGGAGGGA

AGAAAGCAGGCAGATCTTGCTCTTCAGCCTGGGAGATGCTTGGGAAATGCCATGGTGCCAAATTGGAAGGTGCTAACTGAAGCCTTCATGTTTCTCACGG

CTGCTCCACATTCTTCCATCCTGACTTGACCCAGTCTCCACACACACACCTCCTACTACTCGCTGTAGTCTGTATTTGTTTCCTTCTGAGCCCTCTACTA

ATGTCTCAGCATTTTGGTTTGTTTTTTGAGACAGGGTCTCATATATCCCAGGCTGGGTTTGAATTCATTATGTAGCAGAGGGTAGCCTAGAACTCTTCAT

CTTCCTCCACCTCCTAAGTTCCAGGTTTACAGGACGCCGCCAGGCCCCACTTCCTGCACTTTATTGAGAGAGCCCTTCAATCTTGCCCATAGTCATCTGA

AGGGTGAAGCCCACAGATCATTTTAAATCCTTTCGCTCCTCACCTCTACCTTAAGACCTATCAATACAGTGGAGCAAGGGCCCCTCTCAGGCTTTCACTA

TCAAGACCTTTGTGATTGGACAGCTCTGCTCTTTGGTCTTTCCTAACGGGGCAGAGTGTGGACATAGGTTCCTCCCACCTTTCATACCTTAGGTTACTCC

TTCCCGACTTTTCTTGTCCGGTGTTTAAGCCTCTCCCTTTCTTGTCCTATCTCCCTTTCCTTCTTTCCCCTTGTGTTTGAAAGGACCTTGGATATAAAGG

TAAAAGGCACCCCCGTGTCGGAACTCCTACTCTCCCAAGGTCAGGGTCTGGGATTGGCCTTGGTGAAGATGAGCCAGTGGGCGGCCATTTTTCCAAAACT

GGAGACCAAAACAGCTAGAAATGTTGACCCATTGGTCAACACACAAATTAGAAACTCGGCAAGACAGGAGGGCTGGATAGAGGCACATGGGAAAGAATGC

ACATTCAGCATTAGCTAGAAATGGACTCGAGGAGATTAGCTGCGAATATTCACTGTTGCACTGTATGAGATCTTTGAAATGTAATTAAAAGTTTTTATTG

AGCCCC
Translation
MPGDSELAVQEPDRR - UNI28198 - RSPGTMEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFVKILR

ADGVAGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLMMQRKGEKMGRFQVHGNLEGQGVIAFGQT

KDIIRQILRADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAE EQLSRLCPQECPHIVFQAISGPLAAATASILTNPMDVIRTRVQ - UNI31175 -

 VEGKSSIVLTFRQLMAEEGPWGLMKGLSARIISATPSTIVIVVGYESLKKLSLRPELVDSRHW

For any suggestions or comments, please send an email to unitrap@crg.es