Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000050150 (Nhedc1)
Chromosomal location
Chr 3: 135011001 - 135060788 (+)
Description
Na+/H+ exchanger domain containing 1 Gene [Source:MGI Symbol;Acc:MGI:1921696]
RefSeq_dna
NM_028946 
RefSeq_peptide
NP_083222.2 
UniGene
Mm.85000 Mm.399070 
MGI
MGI:1921696 
Uniprot/SWISSPROT
Q8C0X2 
Uniprot/SPTREMBL
B5AFL0 
Human Ortholog
ENSG00000183704 (AC134882.2-201)
Omim not available
UniTrap UNI34329
Vector Insertion
Chr 3: 135011738 - 135017974
Public Clones IST10282E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21798
Vector Insertion
Chr 3: 135018036 - 135020420
Public Clones not available
Private Clones OST317557 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20050
Vector Insertion
Chr 3: 135020719 - 135034808
Public Clones not available
Private Clones OST374242 (lexicon) OST64911 (lexicon) OST62417 (lexicon) OST57982 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27333
Vector Insertion
Chr 3: 135037366 - 135045649
Public Clones not available
Private Clones OST62996 (lexicon)
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24211
Vector Insertion
Chr 3: 135045826 - 135053385
Public Clones not available
Private Clones OST230889 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37311
Vector Insertion
Chr 3: 135057945 - 135060559
Public Clones CMHD-GT_464D2-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000090209
Sequence
GACCTCCTGCACGCGACGACGGTTGCTGGTCCCTGAGCGGGTGAGAGTTGCTAAAGGAAGTGTAG CAGTTCTTGCAAATAAGAAAGAAGAGATCTTTCC

ATCACGACTGACAGCAAAATTAACCCACTGGGCAGATGGTATTTGTACAAATCGTGAATCCGGAGAGGTGAACCTTCACGTGCACCTGTAATTGCAGATG

TGTTCCAGGATTGGTCTCTGATTTTCGGAAGGCTCTCATTCCTTCCCCCACACCCCTGACCAGGATTCCTCTTGGCTTTATCGCAGCGGACAAGCACTCA

ACACCAATGCTTTTTAAGGATTAAGGGCTGTAATTGCACACACAGTGTGTCAGACACTGCGCTCTCCTGAGTCCTGACCGTGCTCTGTGGTGGCGCTCTT

CTTGGAATTCTTCCCTATTAAGATGCCATAAAAGCTTGTCACCTTTAGGTTTTAAAGTTCCCTGCTGAAACGTAAGATATCTTAAGACTGCAGACAAACT

CCTGAAAGATGAG - UNI34329 - TGAGCACGACGTAGAATCAAACAAGAAGGATGATGGTTTCCAATCATCTGTAACTGTTGAG - UNI21798 

- ATGTCCAAAGATCCTGATAGTTTTCATGAAGAAACTGTGGAACCAAAACCAGAACTGAAGGAACCGGAACCAAAGGAACCAGAACCGAAGGAACCAGA

AAGGAAGGAACCAGAAAGGAAGGAACCAGAAAGGAAGGAACCAGAAAGGAAGGAACCAGAAAGGAAGGTACCAGGAAGAAGGGAAACACAAACGAAGGAA

ACACAAACAACCGAAATAGAAAGGAAGGAAACAAAAAAGAAGAGAGGGACAAATAGTTACTGTCCTCCACAAGGAACAATAAATAAAACAATTACAGATG

 - UNI20050 - GAGCTGCACTCATTGCACTATGGACTCTACTCTGGGCCCTTATAGGTCAAGAAGTTCTCCCTGGTGGAAATTTGTTTGGACTTGTA

GTTATTTTTTACAGTGCTTTCCTTGGGGGTAAAATTTTAGAATTCATTAGAATACCTGTAGTGCCTCCCCTCCCACCTCTCATTG GGATGTTACTGGCT

GGTTTCACCATCAGGAATGTTCCGATTATTTATGAATTTGTCCATATTCCTACCACATGGTCTTCAGCTTTAAGAAACACTGCCCTTACTATTATCCTAG

TACGAGCTGGGCTTGGACTGGATCCACAG GCCTTGAAGCATCTGAAGGGAGTCTGTCTGCGCTTGTCATTTGGTCCATGCTTCCTAGAAGCCTGCTCAG

CCGCTCTCTTCTCCCACTTCATTATGAACTTTCCTTGGCAATGGGGGTTCCTACTAGG - UNI27333 - TTTTGTCCTAGGCGCTGTCTCTCCTGCT

GTTGTCGTCCCCAACATGCTAATGTTGCAGGAGAATGGGTATGGTGTTGAGAAAGGCATCCCGACCTTGCTGGTGGCAGCTAGCAGCATGGACGACATTG

TGGCCATCACTGGATTCAACACATTCTTGAGCATAGTCTTTTCCTCGG - UNI24211 - GTAGTGTGATTAGCAACATCCTATCGTCCTTGCGGGAC

GTTCTTATTGGGGTGCTGGTAGGAATTGTTATGGGAGTTTTTGTTCAGTATTTTCCAAGTGGAGATCAG GCTGCCAGCACATTGGCTTACATGGATCTG

GAGGACTGGTCACACTAGTATTGTCGTTCATGGCAGCAAAAAGATGGGCTGAAGAGAAG ATGAACTTGTTTAATTTATGCTTCATTATTATTATGACCT

CCACCACCATCATCACATTCATTTATGGGAAGGGGCATGGAAGTCAGAGGACAACCTACAGAAGTCACTTGTTTCTTTCCTGGGACTCAAAGCCAAGTTG

CCAAGCTTTGTGGCAGGAGCTATACCCACTGCGACAGTTTACCCACCCAACTGATGGCATAAAAACCATGGTACAAAGAGGGAACATATGTATAAAGATC

AAAGCATAGATGAATGCAAAAGTCCCTACCCCCTAAATATTCAGCTTATTCCCATAAATAGATCATTTTAAGCAATACTGTGTGTGTGTATATATACACA

CATATATATACATATATTTCATTTTAAAAATAAAAATATTACAGCC
Translation
  - UNI34329 -  - UNI21798 - MSKDPDSFHEETVEPKPELKEPEPKEPEPKEPERKEPERKEPERKEPERKEPERKVPGRRETQTKETQTTE

IERKETKKKRGTNSYCPPQGTINKTITDG - UNI20050 - GAALIALWTLLWALIGQEVLPGGNLFGLVVIFYSAFLGGKILEFIRIPVVPPLPPLI

G GMLLAGFTIRNVPIIYEFVHIPTTWSSALRNTALTIILVRAGLGLDPQ ALKHLKGVCLRLSFGPCFLEACSAALFSHFIMNFPWQWGFLLG - UNI

27333 - GFVLGAVSPAVVVPNMLMLQENGYGVEKGIPTLLVAASSMDDIVAITGFNTFLSIVFSSG - UNI24211 - GSVISNILSSLRDVLIGV

LVGIVMGVFVQYFPSGDQ AASTLAYMDLEDWSH 
Transcript ENSMUST00000078568
Sequence
GGTTGGGTCCTTGGCTCTCCTGACCTCCTGCACGCGACGACGGTTGCTGGTCCCTGAGCGGGTGAGAGTTGCTAAAGGAAGTGTAG CAGTTCTTGCAAA

TAAGAAAGAAGAGATCTTTCCATCACGACTGACAGCAAAATTAACCCACTGGGCAGATGGTATTTGTACAAATCGTGAATCCGGAGAGGTGAACCTTCAC

GTGCACCTGTAATTGCAGATGTGTTCCAGGATTGGTCTCTGATTTTCGGAAGGCTCTCATTCCTTCCCCCACACCCCTGACCAGGATTCCTCTTGGCTTT

ATCGCAGCGGACAAGCACTCAACACCAATGCTTTTTAAGGATTAAGGGCTGTAATTGCACACACAGTGTGTCAGACACTGCGCTCTCCTGAGTCCTGACC

GTGCTCTGTGGTGGCGCTCTTCTTGGAATTCTTCCCTATTAAGATGCCATAAAAGCTTGTCACCTTTAGGTTTTAAAGTTCCCTGCTGAAACGTAAGATA

TCTTAAGACTGCAGACAAACTCCTGAAAGATGAG - UNI34329 - TGAGCACGACGTAGAATCAAACAAGAAGGATGATGGTTTCCAATCATCTGTA

ACTGTTGAG - UNI21798 - ATGTCCAAAGATCCTGATAGTTTTCATGAAGAAACTGTGGAACCAAAACCAGAACTGAAGGAACCGGAACCAAAGGA

ACCAGAACCGAAGGAACCAGAAAGGAAGGAACCAGAAAGGAAGGAACCAGAAAGGAAGGAACCAGAAAGGAAGGAACCAGAAAGGAAGGTACCAGGAAGA

AGGGAAACACAAACGAAGGAAACACAAACAACCGAAATAGAAAGGAAGGAAACAAAAAAGAAGAGAGGGACAAATAGTTACTGTCCTCCACAAGGAACAA

TAAATAAAACAATTACAGATG - UNI20050 - GAGCTGCACTCATTGCACTATGGACTCTACTCTGGGCCCTTATAGGTCAAGAAGTTCTCCCTGGT

GGAAATTTGTTTGGACTTGTAGTTATTTTTTACAGTGCTTTCCTTGGGGGTAAAATTTTAGAATTCATTAGAATACCTGTAGTGCCTCCCCTCCCACCTC

TCATTG GGATGTTACTGGCTGGTTTCACCATCAGGAATGTTCCGATTATTTATGAATTTGTCCATATTCCTACCACATGGTCTTCAGCTTTAAGAAACA

CTGCCCTTACTATTATCCTAGTACGAGCTGGGCTTGGACTGGATCCACAG GCCTTGAAGCATCTGAAGGGAGTCTGTCTGCGCTTGTCATTTGGTCCAT

GCTTCCTAGAAGCCTGCTCAGCCGCTCTCTTCTCCCACTTCATTATGAACTTTCCTTGGCAATGGGGGTTCCTACTAGG - UNI27333 - TTTTGTC

CTAGGCGCTGTCTCTCCTGCTGTTGTCGTCCCCAACATGCTAATGTTGCAGGAGAATGGGTATGGTGTTGAGAAAGGCATCCCGACCTTGCTGGTGGCAG

CTAGCAGCATGGACGACATTGTGGCCATCACTGGATTCAACACATTCTTGAGCATAGTCTTTTCCTCGG - UNI24211 - GTAGTGTGATTAGCAAC

ATCCTATCGTCCTTGCGGGACGTTCTTATTGGGGTGCTGGTAGGAATTGTTATGGGAGTTTTTGTTCAGTATTTTCCAAGTGGAGATCAG GAGAGACTT

ACGCAGAGGCGAGCCTTCCTAGTTCTGAGTATGTGTATTTCTGCTGTCTTAGGCTGCCAGCACATTGGCTTACATGGATCTGGAGGACTGGTCACACTAG

TATTGTCGTTCATGGCAGCAAAAAGATGGGCTGAAGAGAAG GTTGGAATCCAAAAAATTGTTGCAAACACATGGAATGTTTTTCAGCCGCTTCTTTTTG

GCTTAGTTGGAACAGAAGTATCTGTTGAATCTCTTGAATCAAAAACCATTG GCATGTGCCTTGCTACCTTGGGTTTGGCACTATCTGTTCGAATTTTAT

CCACTTTTGTACTGATGTCTTTTGCTAACTTCCGTTTTAAGGAGAAAGTATTTATTGCTTTATCATGGATCCCTAAAGCTACAGTCCAG - UNI37311

 - GCTGTCTTAGGACCTCTGGCTCTAGAAACAGCAAGGGTCATGGCACCCCACTTGGAAGGATACGCGAAGGCTGTGATGACAGTGGCCTTCCTAGCCA

TCCTGATTACAGCTCCAAATGGAGCCCTCCTCATCGGCATACTGGGACCCAAAATCCTTGAACAGAGTGAGGTGACATTCCCTTTGAAAGTTGAGCTCTC

GAACTTCCATCATTAAAAAGCTTGCCATCATC
Translation
 MS - UNI34329 - SEHDVESNKKDDGFQSSVTVE - UNI21798 - MSKDPDSFHEETVEPKPELKEPEPKEPEPKEPERKEPERKEPERKEPE

RKEPERKVPGRRETQTKETQTTEIERKETKKKRGTNSYCPPQGTINKTITDG - UNI20050 - GAALIALWTLLWALIGQEVLPGGNLFGLVVIFYS

AFLGGKILEFIRIPVVPPLPPLIG GMLLAGFTIRNVPIIYEFVHIPTTWSSALRNTALTIILVRAGLGLDPQ ALKHLKGVCLRLSFGPCFLEACSAAL

FSHFIMNFPWQWGFLLG - UNI27333 - GFVLGAVSPAVVVPNMLMLQENGYGVEKGIPTLLVAASSMDDIVAITGFNTFLSIVFSSG - UNI242

11 - GSVISNILSSLRDVLIGVLVGIVMGVFVQYFPSGDQ ERLTQRRAFLVLSMCISAVLGCQHIGLHGSGGLVTLVLSFMAAKRWAEEK VGIQKIV

ANTWNVFQPLLFGLVGTEVSVESLESKTIG GMCLATLGLALSVRILSTFVLMSFANFRFKEKVFIALSWIPKATVQ - UNI37311 - AVLGPLALE

TARVMAPHLEGYAKAVMTVAFLAILITAPNGALLIGILGPKILEQSEVTFPLKVELSNFHH
Transcript ENSMUST00000116272
Sequence
GGTTGGGTCCTTGGCTCTCCTGACCTCCTGCACGCGACGACGGTTGCTGGTCCCTGAGCGGGTGAGAGTTGCTAAAGGAAGTGTAG CAGTTCTTGCAAA

TAAGAAAGAAGAGATCTTTCCATCACGACTGACAGCAAAATTAACCCACTGGGCAGATGGTATTTGTACAAATCGTGAATCCGGAGAGGTGAACCTTCAC

GTGCACCTGTAATTGCAGATGTGTTCCAGGATTGGTCTCTGATTTTCGGAAGGCTCTCATTCCTTCCCCCACACCCCTGACCAGGATTCCTCTTGGCTTT

ATCGCAGCGGACAAGCACTCAACACCAATGCTTTTTAAGGATTAAGGGCTGTAATTGCACACACAGTGTGTCAGACACTGCGCTCTCCTGAGTCCTGACC

GTGCTCTGTGGTGGCGCTCTTCTTGGAATTCTTCCCTATTAAGATGCCATAAAAGCTTGTCACCTTTAGGTTTTAAAGTTCCCTGCTGAAACGTAAGATA

TCTTAAGACTGCAGACAAACTCCTGAAAGATGAG - UNI34329 - TGAGCACGACGTAGAATCAAACAAGAAGGATGATGGTTTCCAATCATCTGTA

ACTGTTGAG - UNI21798 - ATGTCCAAAGATCCTGATAGTTTTCATGAAGAAACTGTGGAACCAAAACCAGAACTGAAGGAACCGGAACCAAAGGA

ACCAGAACCGAAGGAACCAGAAAGGAAGGAACCAGAAAGGAAGGAACCAGAAAGGAAGGAACCAGAAAGGAAGGAACCAGAAAGGAAGGTACCAGGAAGA

AGGGAAACACAAACGAAGGAAACACAAACAACCGAAATAGAAAGGAAGGAAACAAAAAAGAAGAGAGGGACAAATAGTTACTGTCCTCCACAAGGAACAA

TAAATAAAACAATTACAGATG - UNI20050 - GAGCTGCACTCATTGCACTATGGACTCTACTCTGGGCCCTTATAGGTCAAGAAGTTCTCCCTGGT

GGAAATTTGTTTGGACTTGTAGTTATTTTTTACAGTGCTTTCCTTGGGGGTAAAATTTTAGAATTCATTAGAATACCTGTAGTGCCTCCCCTCCCACCTC

TCATTG GGATGTTACTGGCTGGTTTCACCATCAGGAATGTTCCGATTATTTATGAATTTGTCCATATTCCTACCACATGGTCTTCAGCTTTAAGAAACA

CTGCCCTTACTATTATCCTAGTACGAGCTGGGCTTGGACTGGATCCACAG GCCTTGAAGCATCTGAAGGGAGTCTGTCTGCGCTTGTCATTTGGTCCAT

GCTTCCTAGAAGCCTGCTCAGCCGCTCTCTTCTCCCACTTCATTATGAACTTTCCTTGGCAATGGGGGTTCCTACTAGG - UNI27333 - TTTTGTC

CTAGGCGCTGTCTCTCCTGCTGTTGTCGTCCCCAACATGCTAATGTTGCAGGAGAATGGGTATGGTGTTGAGAAAGGCATCCCGACCTTGCTGGTGGCAG

CTAGCAGCATGGACGACATTGTGGCCATCACTGGATTCAACACATTCTTGAGCATAGTCTTTTCCTCGG - UNI24211 - GTAGTGTGATTAGCAAC

ATCCTATCGTCCTTGCGGGACGTTCTTATTGGGGTGCTGGTAGGAATTGTTATGGGAGTTTTTGTTCAGTATTTTCCAAGTGGAGATCAG GCTGCCAGC

ACATTGGCTTACATGGATCTGGAGGACTGGTCACACTAG
Translation
 MS - UNI34329 - SEHDVESNKKDDGFQSSVTVE - UNI21798 - MSKDPDSFHEETVEPKPELKEPEPKEPEPKEPERKEPERKEPERKEPE

RKEPERKVPGRRETQTKETQTTEIERKETKKKRGTNSYCPPQGTINKTITDG - UNI20050 - GAALIALWTLLWALIGQEVLPGGNLFGLVVIFYS

AFLGGKILEFIRIPVVPPLPPLIG GMLLAGFTIRNVPIIYEFVHIPTTWSSALRNTALTIILVRAGLGLDPQ ALKHLKGVCLRLSFGPCFLEACSAAL

FSHFIMNFPWQWGFLLG - UNI27333 - GFVLGAVSPAVVVPNMLMLQENGYGVEKGIPTLLVAASSMDDIVAITGFNTFLSIVFSSG - UNI242

11 - GSVISNILSSLRDVLIGVLVGIVMGVFVQYFPSGDQ AASTLAYMDLEDWSH

For any suggestions or comments, please send an email to unitrap@crg.es