Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000050199 (Lgr4)
Chromosomal location
Chr 2: 109757804 - 109854412 (+)
Description
leucine-rich repeat-containing G protein-coupled receptor 4 Gene [Source:MGI (curated);Acc:Lgr4-002]
RefSeq_dna
NM_172671 
RefSeq_peptide
NP_766259.2 
UniGene
Mm.277351 
MGI
MGI:1891468 
Uniprot/SWISSPROT
A2ARI4 
Uniprot/SPTREMBL
Q8BZR7 A2ARI3 
Human Ortholog
ENSG00000205213 (LGR4)
Omim not available
UniTrap UNI1452
Vector Insertion
Chr 2: 109758463 - 109810848
Public Clones (sanger) CD0570 (sanger) LST032 (baygenomics) LST020 (baygenomics) RST357 (baygenomics)
5SD071D12 (ggtc) CMHD-GT_326E9-3 (cmhd) IST10070H3 (tigm) IST10914H1 (tigm)
IST14216B8 (tigm) IST15002H7 (tigm) IST14723E1 (tigm)
Private Clones OST385829 (lexicon) OST357914 (lexicon) OST291563 (lexicon) OST287414 (lexicon)
OST279764 (lexicon) OST176504 (lexicon) OST175783 (lexicon) OST100068 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25702
Vector Insertion
Chr 2: 109810921 - 109829861
Public Clones IST14722F1 (tigm)
Private Clones OST169723 (lexicon) OST166794 (lexicon) OST100672 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21007
Vector Insertion
Chr 2: 109829934 - 109831260
Public Clones not available
Private Clones OST346023 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30473
Vector Insertion
Chr 2: 109831333 - 109836710
Public Clones CMHD-GT_298G12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8920
Vector Insertion
Chr 2: 109841156 - 109842622
Public Clones RST612 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19095
Vector Insertion
Chr 2: 109848823 - 109851407
Public Clones not available
Private Clones OST404885 (lexicon)
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000046548
Sequence
AGAAGGGAAAAGGACGCGCGGAGCGGGAGCCGCCTCGGGGAGAGCGCGGACAACCAGGGTGTTTGTGAGAGCTGGGGCGGGGGTTGGGACGCCTGGCCGG

CATGGCTGGAGGCTGCGCTCCGCAACCTTGAGGAGCTGTGCGGCTGGAGGAGGCCCGGGACAGGAGGCGGCGGCGATGGCAGCGCGCGGCCCGGGCAGCC

GCTCTGGGCCGGGTCGGCTGGCCTGAGCCGCGGGGCTGCCGGTGCGCGTCCATGGAGCAGCGGGAAGGGAGAAACTGCGGAGCGCCGCGTCCTAACGCTC

CGGCGGCAGACTGCTGAAGGAAGCGAGCGCACGCGGACCGCCGAGGGACGGCGCCCGGGCCCCGAGCCCCGCAGGCCGGCTGCCCCTGGTGCGGCGCGGT

GCGGCGGAGGGCAGCGGAGGCGAGTCGAGCGAGAGGAGCCGCGGGAGAGGCGGGCGCGGGCGGCGGCCGCAGCAATGCCGGGCCCGCTGCGGCTGCTCTG

CTTCTTCGCCCTGGGGCTGCTCGGCTCGGCCGGGCCCAGCGGCGCGGCGCCACCTCTCTGCGCTGCGCCCTGCAGCTGCGACGGCGACCGTCGGGTGGAC

TGCTCCGGGAAGGGGTTGACGGCGGTACCGGAGGGGCTCAGCGCCTTCACCCAAGCACT - UNI1452 - GGATATCAGTATGAACAATATCACTCAG

TTACCAGAAGATGCATTTAAGAATTTTCCTTTTCTAGAGGAGCT - UNI25702 - ACAACTGGCTGGTAACGACCTTTCTTTTATCCACCCAAAAGC

CTTGTCTGGGTTGAAAGAACTCAAAGTCCT - UNI21007 - AACCCTCCAGAACAATCAGTTGAAAACAGTACCCAGTGAAGCCATTCGTGGACTGA

GTGCTTTGCAGTCTCT - UNI30473 - ACGCTTAGATGCCAACCATATTACCTCAGTCCCGGAGGACAGTTTTGAAGGGCTCGTTCAGTTGCGGCAT

CTGTGGCTGGATGACAACATCTTGACGGAAGTGCCTGTGCGTCCGCTCAGCAACCTGCCAACCCTGCAGGCGCTGACCTTGGCTCTCAACAACATCTCAA

GCATCCCCGACTTCGCATTCACCAACCTTTCAAGCTTGGTAGTGCT GCATCTTCATAACAATAAAATTAAAAGCCTCAGTCAACACTGTTTTGATGGAC

TAGATAACCTGGAAACCCT GGACTTGAATTATAATAACTTGGATGAATTTCCTCAGGCTATTAAAGCCCTTCCCAGCCTTAAAGAGCT GGGATTTCAC

AGTAATTCTATTTCTGTTATCCCGGATGGAGCATTTGCTGGTAATCCACTGCTAAGAACTAT CCATTTGTATGATAATCCTCTGTCTTTTGTGGGGAAC

TCAGCATTTCACAACCTGTCTGATCTGCATTCCTT AGTCATTCGTGGTGCAAGCCTGGTGCAGTGGTTCCCCAATCTGGCCGGAACTGTCCATCTGGAG

AGTCT - UNI8920 - AACCTTGACAGGGACAAAAATAAGCAGCATACCTGATGATCTGTGCCAAAACCAAAAGATGCTGCGGACTCT GGACTTATC

TTATAACGATATAAGAGACCTTCCAAGTTTTAATGGTTGTCGTGCATTGGAAGAAAT TTCATTGCAGCGTAATCAAATCTCCCTGATAAAGGAAACTAC

TTTTCAAGGCCTAACATCCCTAAGGATTCT AGATCTGAGTAGAAACCTGATTCGTGAAATTCACAGTGGAGCTTTTGCGAAGCTTGGGACAATTACTAA

CCT GGATGTGAGTTTCAATGAATTAACCTCATTTCCTACGGAAGGCCTGAATGGGCTCAATCAACTTAAACTTGTGGGTAACTTCCAGCTGAAAGATGC

CTTGGCAGCCAGAGACTTTGCCAATCTCAG GTCTCTATCAGTACCATATGCTTATCAGTGTTGTGCATTTTGGGGGTGTGACTCTTATGCAAATTTAAA

CACAGAAGATAACAGCCCCCAAGACCACAGTGTGACAAAAGAGAAAG GTGCTACAGATGCAGCAAATGCCACCAGCACTGCTGAAAGTGAAGAACATAG

CCAAATAATCATCCATTGTACACCTTCAACAG - UNI19095 - GTGCTTTTAAGCCCTGTGAATATTTACTGGGAAGCTGGATGATTCGCCTTACAG

TGTGGTTCATTTTCCTGGTCGCCTTGCTTTTCAACCTGCTTGTCATTTTAACAGTGTTTGCGTCTTGTTCATCACTGCCTGCCTCCAAGCTCTTCATAGG

CTTGATTTCTGTGTCTAACTTACTCATGGGCATCTATACTGGCATCCTTACTTTTCTTGATGCTGTGTCCTGGGGCCGATTTGCTGAATTTGGCATTTGG

TGGGAAACTGGCAGCGGCTGCAAGGTAGCTGGGTCTCTGGCAGTCTTCTCCTCAGAGAGCGCCGTATTCCTGTTAACCCTGGCAGCCGTGGAAAGAAGCG

TTTTTGCAAAGGATGTAATGAAAAATGGGAAAAGCAGTCACCTCCGACAGTTCCAGGTGGCTGCCCTCGTAGCTTTGCTGGGTGCTGCAATAGCAGGCTG

CTTCCCCCTTTTTCACGGAGGGCAATATTCTGCATCACCCTTGTGCTTGCCATTTCCTACAGGAGAGACACCATCATTAGGATTCACTGTGACCCTAGTG

CTATTAAACTCACTAGCATTTTTATTGATGGCCATTATCTACACTAAACTCTACTGCAACTTAGAGAAAGAAGACCCGTCAGAAAACTCCCAGTCTAGCA

TGATTAAGCACGTTGCTTGGCTCATCTTCACAAACTGCATCTTCTTCTGCCCTGTTGCATTTTTCTCATTCGCACCATTGATCACGGCAATCTCCATCAG

CCCCGAGATAATGAAGTCTGTTACGCTGATATTCTTCCCGCTGCCTGCTTGCCTGAATCCAGTCCTGTACGTTTTCTTCAACCCAAAGTTTAAAGACGAC

TGGAAGCTCCTGAAGCGGCGTGTCACCAGGAAACACGGATCAGTCTCAGTCTCCATCAGCAGCCAAGGCGGTTGTGGGGAACAGGATTTCTACTACGACT

GTGGCATGTATTCCCACTTGCAGGGTAACCTGACTGTCTGTGACTGCTGTGAGTCATTTCTTCTGACAAAACCAGTATCGTGCAAACACTTAATAAAATC

GCACAGTTGTCCTGTATTGACAGTGGCCTCTTGCCAGAGGCCAGAGGCCTACTGGTCTGATTGTGGCACACAGTCGGCCCATTCTGACTATGCAGATGAA

GAGGATTCCTTTGTCTCGGACAGCTCTGACCAGGTGCAGGCCTGTGGACGAGCCTGCTTCTACCAGAGTCGCGGATTCCCTCTGGTGCGCTATGCTTATA

ATCTACCGAGAGTCAGAGACTGAACTCCTGTCCGCGACTGTTTTCCTCCATCAACCAATCACAGCTCATACCTTGAGCTGTCTGTCTTTTGACCTTTCAT

CTGGGAAGGACTTGTGTAATCACTTCCTGGTGTCACGCAGAAGAGGAGGAAGGTGGCAGTTTATTTTTCAAGTCAGAAGTCTGTGAAGAATGGGAGCCTA

AAGTATAAATTGTTGAAAAACATTGTGATGCCCCAGCAGTGTATGCTCTATTGGAAATAAATGCGACTTAAAAATGATTTGATGTATGGCATAGCAATAT

AAAATTAGTTGTTTTTTTTTTTTCTTTTCTGATCCATCAGGTGCAAAGTTCAAATTATTTCTGAATTAAGCACAAAATAAAGGACAGCTGTTAATATATT

TTAAGTGAAAATGTGAATTTATAAAACTAAGAAAATGTCTTGCTAATTTTACCTAATGATTCATCATTAATCTCAGGATGACTTACTTCAGGGCCAAAAA

AGGGACTATCTCCCAGCAAGAGCTAGGAAGAGTTCAAACAGGCATTACCTTCACATGTTTTCTGTGTCCATAAATTGAAAGGTTTTGTTCAAATGATTTA

TAAATCTAAAACCTGAAGATGGTTTTGAGAAGGATGTTAACAGCTGTTAGATTTTTTTTTTTAATAGCAGAACATTTGTTTTTGTTCATTGCACATTGCT

CTGATGAAATCCCAGTGATTCCCCTCTCAGTGTTTGACAATCGCAGCACAGAGCACAGGGACACAGCAAAAGGCTGATTGCCACGTGGGTTTAAGTAGAG

GTGACTGAGTAGTAAGTACCACTGAGCTTTTCATAGTATCCAAGGGATTTGATGGCTCTAAGTAATGTCCTCATCTGGACTGGCAATGTCCTAATGTCAC

TGGCTGCTCTGACATTTCCAAATTTGTTGAAGTTATCTATCATTCTGATTATACAGGAAGCACACTTGAGTCTTTTTTTTTTTTTTTTTTTTTTGCAATT

GTAAGATAATAATGACTCAAAGCACTTAAATTGATTTTTTAGTGAGCTGTTGTATGAGAACTTCCATACATTGTTTGCATGCTGTAATTTAAAAAAACAA

CAAAACCATTCAGTAGCTCAGCTGCGGTGTGCTGTGGTTCAACGAGACACATACTAGGAGTGGGGGAGTCAAACCTTGTCCTATGTCTTTACATTTTCTA

AATTTACTTGACTCTTACCTATAGGCTTCTGATGTGGAAGACTTAACACTGTGCTAAGTCAGTAGCAAACCCACTGCCATCTTAGTTATACTGGTTGAAC

AAAAACTTAAGCTAGATTGCAGTTTGATTAAACTGTACATACTGTGCATATGATGAAGTTTATCTTGTGTAAATTATTTTTAGAACACGAGTTGGGCAAT

GAGGCTTCTGTTCACTGTTTAATTAAAGCTACCTCCTAAACTCTAGTGGCTGCCAGTAGCACAATGGTTAATTGTGGTTTAGATACATGTTCTTGGTTTT

GATTTTTTTTTTATCCTTGCCTTGTAAATAGTCTTGGTTGTACATTGTCAGTGGAATAAAAACAGAATCTTTGTATATCAAAATCACGTAGTTTGTATAA

AATGTGGGAGGGATTTATTTACTGTGCTTGTAATTTTGTAAGGTCATCTATTTACAACATAAATATAATGTTTGTATATTTACACATCTGATAAATATTA

AATCATAACTTGGTAAGAAAATCCCAATTAAAGGCTTTCTTCCTAAAATTC
Translation
MPGPLRLLCFFALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQAL - UNI1452 - LDISMNNITQLPEDAFKNFPFLEEL

 - UNI25702 - LQLAGNDLSFIHPKALSGLKELKVL - UNI21007 - LTLQNNQLKTVPSEAIRGLSALQSL - UNI30473 - LRLDANHI

TSVPEDSFEGLVQLRHLWLDDNILTEVPVRPLSNLPTLQALTLALNNISSIPDFAFTNLSSLVVL LHLHNNKIKSLSQHCFDGLDNLETL LDLNYNNL

DEFPQAIKALPSLKEL LGFHSNSISVIPDGAFAGNPLLRTI IHLYDNPLSFVGNSAFHNLSDLHSL LVIRGASLVQWFPNLAGTVHLESL - UNI8

920 - LTLTGTKISSIPDDLCQNQKMLRTL LDLSYNDIRDLPSFNGCRALEEI ISLQRNQISLIKETTFQGLTSLRIL LDLSRNLIREIHSGAFAK

LGTITNL LDVSFNELTSFPTEGLNGLNQLKLVGNFQLKDALAARDFANLR RSLSVPYAYQCCAFWGCDSYANLNTEDNSPQDHSVTKEKG GATDAAN

ATSTAESEEHSQIIIHCTPSTG - UNI19095 - GAFKPCEYLLGSWMIRLTVWFIFLVALLFNLLVILTVFASCSSLPASKLFIGLISVSNLLMGIY

TGILTFLDAVSWGRFAEFGIWWETGSGCKVAGSLAVFSSESAVFLLTLAAVERSVFAKDVMKNGKSSHLRQFQVAALVALLGAAIAGCFPLFHGGQYSAS

PLCLPFPTGETPSLGFTVTLVLLNSLAFLLMAIIYTKLYCNLEKEDPSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPEIMKSVTLIFF

PLPACLNPVLYVFFNPKFKDDWKLLKRRVTRKHGSVSVSISSQGGCGEQDFYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPVLTVASCQ

RPEAYWSDCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVRD
Transcript ENSMUST00000111037
Sequence
AGAAGGGAAAAGGACGCGCGGAGCGGGAGCCGCCTCGGGGAGAGCGCGGACAACCAGGGTGTTTGTGAGAGCTGGGGCGGGGGTTGGGACGCCTGGCCGG

CATGGCTGGAGGCTGCGCTCCGCAACCTTGAGGAGCTGTGCGGCTGGAGGAGGCCCGGGACAGGAGGCGGCGGCGATGGCAGCGCGCGGCCCGGGCAGCC

GCTCTGGGCCGGGTCGGCTGGCCTGAGCCGCGGGGCTGCCGGTGCGCGTCCATGGAGCAGCGGGAAGGGAGAAACTGCGGAGCGCCGCGTCCTAACGCTC

CGGCGGCAGACTGCTGAAGGAAGCGAGCGCACGCGGACCGCCGAGGGACGGCGCCCGGGCCCCGAGCCCCGCAGGCCGGCTGCCCCTGGTGCGGCGCGGT

GCGGCGGAGGGCAGCGGAGGCGAGTCGAGCGAGAGGAGCCGCGGGAGAGGCGGGCGCGGGCGGCGGCCGCAGCAATGCCGGGCCCGCTGCGGCTGCTCTG

CTTCTTCGCCCTGGGGCTGCTCGGCTCGGCCGGGCCCAGCGGCGCGGCGCCACCTCTCTGCGCTGCGCCCTGCAGCTGCGACGGCGACCGTCGGGTGGAC

TGCTCCGGGAAGGGGTTGACGGCGGTACCGGAGGGGCTCAGCGCCTTCACCCAAGCACT - UNI1452 - - UNI25702 - ACAACTGGCTGGTAA

CGACCTTTCTTTTATCCACCCAAAAGCCTTGTCTGGGTTGAAAGAACTCAAAGTCCT - UNI21007 - AACCCTCCAGAACAATCAGTTGAAAACAG

TACCCAGTGAAGCCATTCGTGGACTGAGTGCTTTGCAGTCTCT - UNI30473 - ACGCTTAGATGCCAACCATATTACCTCAGTCCCGGAGGACAGT

TTTGAAGGGCTCGTTCAGTTGCGGCATCTGTGGCTGGATGACAACATCTTGACGGAAGTGCCTGTGCGTCCGCTCAGCAACCTGCCAACCCTGCAGGCGC

TGACCTTGGCTCTCAACAACATCTCAAGCATCCCCGACTTCGCATTCACCAACCTTTCAAGCTTGGTAGTGCT GCATCTTCATAACAATAAAATTAAAA

GCCTCAGTCAACACTGTTTTGATGGACTAGATAACCTGGAAACCCT GGACTTGAATTATAATAACTTGGATGAATTTCCTCAGGCTATTAAAGCCCTTC

CCAGCCTTAAAGAGCT GGGATTTCACAGTAATTCTATTTCTGTTATCCCGGATGGAGCATTTGCTGGTAATCCACTGCTAAGAACTAT CCATTTGTAT

GATAATCCTCTGTCTTTTGTGGGGAACTCAGCATTTCACAACCTGTCTGATCTGCATTCCTT AGTCATTCGTGGTGCAAGCCTGGTGCAGTGGTTCCCC

AATCTGGCCGGAACTGTCCATCTGGAGAGTCT - UNI8920 - AACCTTGACAGGGACAAAAATAAGCAGCATACCTGATGATCTGTGCCAAAACCAA

AAGATGCTGCGGACTCT GGACTTATCTTATAACGATATAAGAGACCTTCCAAGTTTTAATGGTTGTCGTGCATTGGAAGAAAT TTCATTGCAGCGTAA

TCAAATCTCCCTGATAAAGGAAACTACTTTTCAAGGCCTAACATCCCTAAGGATTCT AGATCTGAGTAGAAACCTGATTCGTGAAATTCACAGTGGAGC

TTTTGCGAAGCTTGGGACAATTACTAACCT GGATGTGAGTTTCAATGAATTAACCTCATTTCCTACGGAAGGCCTGAATGGGCTCAATCAACTTAAACT

TGTGGGTAACTTCCAGCTGAAAGATGCCTTGGCAGCCAGAGACTTTGCCAATCTCAG GTCTCTATCAGTACCATATGCTTATCAGTGTTGTGCATTTTG

GGGGTGTGACTCTTATGCAAATTTAAACACAGAAGATAACAGCCCCCAAGACCACAGTGTGACAAAAGAGAAAG GTGCTACAGATGCAGCAAATGCCAC

CAGCACTGCTGAAAGTGAAGAACATAGCCAAATAATCATCCATTGTACACCTTCAACAG - UNI19095 - GTGCTTTTAAGCCCTGTGAATATTTAC

TGGGAAGCTGGATGATTCGCCTTACAGTGTGGTTCATTTTCCTGGTCGCCTTGCTTTTCAACCTGCTTGTCATTTTAACAGTGTTTGCGTCTTGTTCATC

ACTGCCTGCCTCCAAGCTCTTCATAGGCTTGATTTCTGTGTCTAACTTACTCATGGGCATCTATACTGGCATCCTTACTTTTCTTGATGCTGTGTCCTGG

GGCCGATTTGCTGAATTTGGCATTTGGTGGGAAACTGGCAGCGGCTGCAAGGTAGCTGGGTCTCTGGCAGTCTTCTCCTCAGAGAGCGCCGTATTCCTGT

TAACCCTGGCAGCCGTGGAAAGAAGCGTTTTTGCAAAGGATGTAATGAAAAATGGGAAAAGCAGTCACCTCCGACAGTTCCAGGTGGCTGCCCTCGTAGC

TTTGCTGGGTGCTGCAATAGCAGGCTGCTTCCCCCTTTTTCACGGAGGGCAATATTCTGCATCACCCTTGTGCTTGCCATTTCCTACAGGAGAGACACCA

TCATTAGGATTCACTGTGACCCTAGTGCTATTAAACTCACTAGCATTTTTATTGATGGCCATTATCTACACTAAACTCTACTGCAACTTAGAGAAAGAAG

ACCCGTCAGAAAACTCCCAGTCTAGCATGATTAAGCACGTTGCTTGGCTCATCTTCACAAACTGCATCTTCTTCTGCCCTGTTGCATTTTTCTCATTCGC

ACCATTGATCACGGCAATCTCCATCAGCCCCGAGATAATGAAGTCTGTTACGCTGATATTCTTCCCGCTGCCTGCTTGCCTGAATCCAGTCCTGTACGTT

TTCTTCAACCCAAAGTTTAAAGACGACTGGAAGCTCCTGAAGCGGCGTGTCACCAGGAAACACGGATCAGTCTCAGTCTCCATCAGCAGCCAAGGCGGTT

GTGGGGAACAGGATTTCTACTACGACTGTGGCATGTATTCCCACTTGCAGGGTAACCTGACTGTCTGTGACTGCTGTGAGTCATTTCTTCTGACAAAACC

AGTATCGTGCAAACACTTAATAAAATCGCACAGTTGTCCTGTATTGACAGTGGCCTCTTGCCAGAGGCCAGAGGCCTACTGGTCTGATTGTGGCACACAG

TCGGCCCATTCTGACTATGCAGATGAAGAGGATTCCTTTGTCTCGGACAGCTCTGACCAGGTGCAGGCCTGTGGACGAGCCTGCTTCTACCAGAGTCGCG

GATTCCCTCTGGTGCGCTATGCTTATAATCTACCGAGAGTCAGAGACTGAACTCCTGTCCGCGACTGTTTTCCTCCATCAACCAATCACAGCTCATACCT

TGAGCTGTCTGTCTTTTGACCTTTCATCTGGGAAGGACTTGTGTAATCACTTCCTGGTGTCACGCAGAAGAGGAGGAAGGTGGCAGTTTATTTTTCAAGT

CAGAAGTCTGTGAAGAATGGGAGCCTAAAGTATAAATTGTTGAAAAACATTGTGATGCCCCAGCAGTGTATGCTCTATTGGAAATAAATGCGACTTAAAA

ATGATTTGATGTATGGCATAGCAATATAAAATTAGTTGTTTTTTTTTTTTCTTTTCTGATCCATCAGGTGCAAAGTTCAAATTATTTCTGAATTAAGCAC

AAAATAAAGGACAGCTGTTAATATATTTTAAGTGAAAATGTGAATTTATAAAACTAAGAAAATGTCTTGCTAATTTTACCTAATGATTCATCATTAATCT

CAGGATGACTTACTTCAGGGCCAAAAAAGGGACTATCTCCCAGCAAGAGCTAGGAAGAGTTCAAACAGGCATTACCTTCACATGTTTTCTGTGTCCATAA

ATTGAAAGGTTTTGTTCAAATGATTTATAAATCTAAAACCTGAAGATGGTTTTGAGAAGGATGTTAACAGCTGTTAGATTTTTTTTTTTAATAGCAGAAC

ATTTGTTTTTGTTCATTGCACATTGCTCTGATGAAATCCCAGTGATTCCCCTCTCAGTGTTTGACAATCGCAGCACAGAGCACAGGGACACAGCAAAAGG

CTGATTGCCACGTGGGTTTAAGTAGAGGTGACTGAGTAGTAAGTACCACTGAGCTTTTCATAGTATCCAAGGGATTTGATGGCTCTAAGTAATGTCCTCA

TCTGGACTGGCAATGTCCTAATGTCACTGGCTGCTCTGACATTTCCAAATTTGTTGAAGTTATCTATCATTCTGATTATACAGGAAGCACACTTGAGTCT

TTTTTTTTTTTTTTTTTTTTTGCAATTGTAAGATAATAATGACTCAAAGCACTTAAATTGATTTTTTAGTGAGCTGTTGTATGAGAACTTCCATACATTG

TTTGCATGCTGTAATTTAAAAAAACAACAAAACCATTCAGTAGCTCAGCTGCGGTGTGCTGTGGTTCAACGAGACACATACTAGGAGTGGGGGAGTCAAA

CCTTGTCCTATGTCTTTACATTTTCTAAATTTACTTGACTCTTACCTATAGGCTTCTGATGTGGAAGACTTAACACTGTGCTAAGTCAGTAGCAAACCCA

CTGCCATCTTAGTTATACTGGTTGAACAAAAACTTAAGCTAGATTGCAGTTTGATTAAACTGTACATACTGTGCATATGATGAAGTTTATCTTGTGTAAA

TTATTTTTAGAACACGAGTTGGGCAATGAGGCTTCTGTTCACTGTTTAATTAAAGCTACCTCCTAAACTCTAGTGGCTGCCAGTAGCACAATGGTTAATT

GTGGTTTAGATACATGTTCTTGGTTTTGATTTTTTTTTTATCCTTGCCTTGTAAATAGTCTTGGTTGTACATTGTCAGTGGAATAAAAACAGAATCTTTG

TATATCAAAATCACGTAGTTTGTATAAAATGTGGGAGGGATTTATTTACTGTGCTTGTAATTTTGTAAGGTCATCTATTTACAACATAAATATAATGTTT

GTATATTTACACATCTGATAAATATTAAATCATAACTTGGTAAGAAAATCCCAATTAAAGGCTTTCTTCCTAAAATTC
Translation
MPGPLRLLCFFALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQAL - UNI1452 - - UNI25702 - LQLAGNDLSFIH

PKALSGLKELKVL - UNI21007 - LTLQNNQLKTVPSEAIRGLSALQSL - UNI30473 - LRLDANHITSVPEDSFEGLVQLRHLWLDDNILTE

VPVRPLSNLPTLQALTLALNNISSIPDFAFTNLSSLVVL LHLHNNKIKSLSQHCFDGLDNLETL LDLNYNNLDEFPQAIKALPSLKEL LGFHSNSIS

VIPDGAFAGNPLLRTI IHLYDNPLSFVGNSAFHNLSDLHSL LVIRGASLVQWFPNLAGTVHLESL - UNI8920 - LTLTGTKISSIPDDLCQNQK

MLRTL LDLSYNDIRDLPSFNGCRALEEI ISLQRNQISLIKETTFQGLTSLRIL LDLSRNLIREIHSGAFAKLGTITNL LDVSFNELTSFPTEGLNG

LNQLKLVGNFQLKDALAARDFANLR RSLSVPYAYQCCAFWGCDSYANLNTEDNSPQDHSVTKEKG GATDAANATSTAESEEHSQIIIHCTPSTG - U

NI19095 - GAFKPCEYLLGSWMIRLTVWFIFLVALLFNLLVILTVFASCSSLPASKLFIGLISVSNLLMGIYTGILTFLDAVSWGRFAEFGIWWETGS

GCKVAGSLAVFSSESAVFLLTLAAVERSVFAKDVMKNGKSSHLRQFQVAALVALLGAAIAGCFPLFHGGQYSASPLCLPFPTGETPSLGFTVTLVLLNSL

AFLLMAIIYTKLYCNLEKEDPSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPEIMKSVTLIFFPLPACLNPVLYVFFNPKFKDDWKLLK

RRVTRKHGSVSVSISSQGGCGEQDFYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPVLTVASCQRPEAYWSDCGTQSAHSDYADEEDSFV

SDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVRD

For any suggestions or comments, please send an email to unitrap@crg.es