Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000050379 (Sept6)
Chromosomal location
Chr X: 34443352 - 34531684 (-)
Description
septin 6 Gene [Source:MGI (curated);Acc:Sept6-003]
RefSeq_dna
NM_019942 
RefSeq_peptide
NP_064326.2 
UniGene
Mm.260036 Mm.470184 
MGI
MGI:1888939 
Uniprot/SWISSPROT
Q9R1T4 
Uniprot/SPTREMBL
A2A3W1 Q3UUU4 
Human Ortholog
ENSG00000125354 (SEPT6)
Omim not available
UniTrap UNI22651
Vector Insertion
Chr X: 34486562 - 34486750
Public Clones not available
Private Clones OST288964 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33980
Vector Insertion
Chr X: 34443351 - 34453250
Public Clones IST14947C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115232
Sequence
ATGGCAGACAGCAG GAGCTCTTCTGTTTCCTGTGCAGCAGCTCCCGTTGCGGAGGCACCCGAAGCAGCCCTGGCGGACCAAGGAGCGATGGCAGCGGCC

GATATAGCTCGCCAGGTG GGCGAAGATTGTCGAACTGTCCCCCTGGCTGGACATGTGGGGTTCGACAGCTTGCCTGACCAGCTGGTGAATAAGTCAGTC

AGCCAGGGCTTCTGCTTCAACATCCTGTGCGTGG GGGAGACAGGTTTGGGCAAGTCCACGCTCATGGATACCCTGTTTAACACCAAGTTTGAAGGGGAG

CCAGCGACCCACACACAGCCAGGGGTTCAGCTCCAGTCCAATACCTACGACCTCCAGGAGAGCAACGTGGGGTTGAAACTCACAATTGTGAGCACTGTAG

GCTTTGGGGATCAGATCAACAAGGAGGACAG - UNI22651 - CTACAAGCCCATCGTGGAATTCATTGATGCTCAGTTTGAGGCCTACCTACAAGAG

GAGCTGAAGATCCGAAGAGTACTGCACTCCTACCATGACTCCCGAATCCATGTCTGCTTGTATTTCATTGCCCCGACAGGACATTCGCTTAAGTCTCTGG

ACCTAGTGACCATGAAGAAGCTGGATAGTAAG - UNI22651 - GTGAACATCATTCCCGTTATTGCCAAGTCAGATGCCATTTCTAAGAGTGAGCTG

GCAAAGTTCAAGATCAAAATCACCAGCGAACTTGTGAGCAATGGAGTCCAGATCTATCAGTTCCCCACAGACGATGAGTCGGTGAGCGAGATCAATGGAA

CCATGAAT GCCCACCTGCCGTTTGCTGTTGTTGGCAGCACAGAAGAAGTGAAGATAGGCAACAAGATGATGCGGGCTCGGCAGTATCCTTGGGGGACTG

TGCAGG TTGAAAACGAGGCTCACTGCGACTTTGTGAAGCTGCGGGAGATGCTGATTCGGGTCAACATGGAGGATCTGCGGGAGCAGACCCACGCCCGGC

ACTATGAATTGTACCGCCGCTGTAAGCTGGAGGAGATGGGCTTCAAGGACACCGACCCTGACAGCAAACCATTCAG TTTGCAGGAGACATATGAGGCAA

AGAGAAATGAGTTCCTTGGGGAGCTCCAGAAGAAAGAAGAGGAGATGAGGCAGATGTTTGTCCAGAGAGTCAAAGAGAAAGAAGCGGAGCTCAAGGAGGC

TGAAAAAGAG CTGCATGAGAAATTTGACCGTCTGAAGAAACTGCACCAGGAAGAGAAGAAGAAGCTGGAGGATAAGAAGAAATGTCTGGATGAGGAAAT

GAACGCCTTCAAGCAGAGAAAGGCGGCAGCTGAGCTGCTCCAGTCTCAGGGCTCTCAGGCTGGGGGCTCACAGACTCTGAAAAGGGACAAAGAGAAGAAG

AA TTAACTCTGCTGTTTGCTGCATGCTGCATGACACCCAGGGTCCTG TTTGGGCTTCCTGTAGACGCGCCCTTTCCTGTGCAACAGAGCTGGGCTTCC

CTCTCTTTATTTCCCCCCTTAACATGCTTAGAGGGCATACACCCCATGCCTTCCCTTTTTCTTCCTTCAAATGTTTATAGAAGCCTGAGAGTCAAATGAT

GATGTCTGGTTCCTGACCAAGAAGCCAGCAATCTCGTGGCTTGGAGATACATTCCATACCTCAGTCCCTCTCCTAGTACCCTCCACCATATGCTCTCTCA

CATCCTCAATCCATCTCTGCCAGACTCACACATGTTTACAGGTCACTGTTTGTCACTTTTGTGTACCAGCTTCCCCATTAGAATTCAACCGATACTTGTT

TTCTTGAAGAATTTCCATCCACCAGTCAGGGGTCAGAACTGTCCCCTTATACTCCTGCATCCTAGTCACTGGGATTGTTCTCCCACTCCTCTAATGCCAA

GAGCCATAGCCCCTTATAATAGGTTCTAAAAGAATTGCCAGCGATGCCTGTTTCTTCTCCCATCTTAGCCAAGCCCTTTCTTGATTTCCTTTATTCGGAG

TCAGTTTACACAAGCTGTGTTAAAAGTCAGCCACACATTTATTCACACCAAGCCCTTCCTATACAAAACACAATTGCTGGAACAGATAGTGTATATTCCC

CCTCTCTAATTCTAGGGACCCCCACAGATACAGAAGGGAAAATAAACTGGAATGTTATCACC
Translation
MADSR RSSSVSCAAAPVAEAPEAALADQGAMAAADIARQV GEDCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVG GETGLGKSTLMDTLFNTK

FEGEPATHTQPGVQLQSNTYDLQESNVGLKLTIVSTVGFGDQINKED - UNI22651 -  - UNI22651 -       
Transcript ENSMUST00000115240
Sequence
TCAACTGCCCACATAG GACAACAAGTG GGCGAAGATTGTCGAACTGTCCCCCTGGCTGGACATGTGGGGTTCGACAGCTTGCCTGACCAGCTGGTGAA

TAAGTCAGTCAGCCAGGGCTTCTGCTTCAACATCCTGTGCGTGG GGGAGACAGGTTTGGGCAAGTCCACGCTCATGGATACCCTGTTTAACACCAAGTT

TGAAGGGGAGCCAGCGACCCACACACAGCCAGGGGTTCAGCTCCAGTCCAATACCTACGACCTCCAGGAGAGCAACGTGGGGTTGAAACTCACAATTGTG

AGCACTGTAGGCTTTGGGGATCAGATCAACAAGGAGGACAG - UNI22651 - CTACAAGCCCATCGTGGAATTCATTGATGCTCAGTTTGAGGCCTA

CCTACAAGAGGAGCTGAAGATCCGAAGAGTACTGCACTCCTACCATGACTCCCGAATCCATGTCTGCTTGTATTTCATTGCCCCGACAGGACATTCGCTT

AAGTCTCTGGACCTAGTGACCATGAAGAAGCTGGATAGTAAG - UNI22651 - GTGAACATCATTCCCGTTATTGCCAAGTCAGATGCCATTTCTAA

GAGTGAGCTGGCAAAGTTCAAGATCAAAATCACCAGCGAACTTGTGAGCAATGGAGTCCAGATCTATCAGTTCCCCACAGACGATGAGTCGGTGAGCGAG

ATCAATGGAACCATGAAT GCCCACCTGCCGTTTGCTGTTGTTGGCAGCACAGAAGAAGTGAAGATAGGCAACAAGATGATGCGGGCTCGGCAGTATCCT

TGGGGGACTGTGCAGG TTGAAAACGAGGCTCACTGCGACTTTGTGAAGCTGCGGGAGATGCTGATTCGGGTCAACATGGAGGATCTGCGGGAGCAGACC

CACGCCCGGCACTATGAATTGTACCGCCGCTGTAAGCTGGAGGAGATGGGCTTCAAGGACACCGACCCTGACAGCAAACCATTCAG TTTGCAGGAGACA

TATGAGGCAAAGAGAAATGAGTTCCTTGGGGAGCTCCAGAAGAAAGAAGAGGAGATGAGGCAGATGTTTGTCCAGAGAGTCAAAGAGAAAGAAGCGGAGC

TCAAGGAGGCTGAAAAAGAG CTGCATGAGAAATTTGACCGTCTGAAGAAACTGCACCAGGAAGAGAAGAAGAAGCTGGAGGATAAGAAGAAATGTCTGG

ATGAGGAAATGAACGCCTTCAAGCAGAGAAAGGCGGCAGCTGAGCTGCTCCAGTCTCAGGGCTCTCAGGCTGGGGGCTCACAGACTCTGAAAAGGGACAA

AGAGAAGAAGAA TTAACTCTGCTGTTTGCTGCATGCTGCATGACACCCAGGGTCCTG TTTGGGCTTCCTGTAGACGCGCCCTTTCCTGTGCAACAGAG

CTGGGCTTCCCTCTCTTTATTTCCCCCCTTAACATGCTTAGAGGGCATACACCCCATGCCTTCCCTTTTTCTTCCTTCAAATGTTTATAGAAGCCTGAGA

GTCAAATGATGATGTCTGGTTCCTGACCAAGAAGCCAGCAATCTCGTGGCTTGGAGATACATTCCATACCTCAGTCCCTCTCCTAGTACCCTCCACCATA

TGCTCTCTCACATCCTCAATCCATCTCTGCCAGACTCACACATGTTTACAGGTCACTGTTTGTCACTTTTGTGTACCAGCTTCCCCATTAGAATTCAACC

GATACTTGTTTTCTTGAAGAATTTCCATCCACCAGTCAGGGGTCAGAACTGTCCCCTTATACTCCTGCATCCTAGTCACTGGGATTGTTCTCCCACTCCT

CTAATGCCAAGAGCCATAGCCCCTTATAATAGGTTCTAAAAGAATTGCCAGCGATGCCTGTTTCTTCTCCCATCTTAGCCAAGCCCTTTCTTGATTTCCT

TTATTCGGAGTCAGTTTACACAAGCTGTGTTAAAAGTCAGCCACACATTTATTCACACCAAGCCCTTCCTATACAAAACACAATTGCTGGAACAGATAGT

GTATATTCCCCCTCTCTAATTCTAGGGACCCCCACAGATACAGAAGGGAAAATAAACTGGAATGTTATCACC
Translation
   MDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVGLKLTIVSTVGFGDQINKEDS - UNI22651 - SYKPIVEFIDAQFEAYLQEELKIRRVL

HSYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSK - UNI22651 - VNIIPVIAKSDAISKSELAKFKIKITSELVSNGVQIYQFPTDDESVSEIN

GTMN AHLPFAVVGSTEEVKIGNKMMRARQYPWGTVQV VENEAHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTDPDSKPFS SLQ

ETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEKE LHEKFDRLKKLHQEEKKKLEDKKKCLDEEMNAFKQRKAAAELLQSQGSQAGGSQTLK

RDKEKKN N 
Transcript ENSMUST00000053456
Sequence
GCTCGCCCTAGGGGAAGGCAGCGCGGCCAATCCGTCCCCTCCCCACACCTACTCTGAGGGGGTGGGTGATAGAGGAGAGGTTGGGGTTGGAGCAGCGGTG

AGGGGGCCCCTCCCTGGCACCTCCCTCCACCAGACTTGGTCGCGCCCGAAGTGTAACACTTTCTCTTTGTCGGAGGAGCTCTTCTGTTTCCTGTGCAGCA

GCTCCCGTTGCGGAGGCACCCGAAGCAGCCCTGGCGGACCAAGGAGCGATGGCAGCGGCCGATATAGCTCGCCAGGTG GGCGAAGATTGTCGAACTGTC

CCCCTGGCTGGACATGTGGGGTTCGACAGCTTGCCTGACCAGCTGGTGAATAAGTCAGTCAGCCAGGGCTTCTGCTTCAACATCCTGTGCGTGG GGGAG

ACAGGTTTGGGCAAGTCCACGCTCATGGATACCCTGTTTAACACCAAGTTTGAAGGGGAGCCAGCGACCCACACACAGCCAGGGGTTCAGCTCCAGTCCA

ATACCTACGACCTCCAGGAGAGCAACGTGGGGTTGAAACTCACAATTGTGAGCACTGTAGGCTTTGGGGATCAGATCAACAAGGAGGACAG - UNI226

51 - CTACAAGCCCATCGTGGAATTCATTGATGCTCAGTTTGAGGCCTACCTACAAGAGGAGCTGAAGATCCGAAGAGTACTGCACTCCTACCATGACT

CCCGAATCCATGTCTGCTTGTATTTCATTGCCCCGACAGGACATTCGCTTAAGTCTCTGGACCTAGTGACCATGAAGAAGCTGGATAGTAAG - UNI22

651 - GTGAACATCATTCCCGTTATTGCCAAGTCAGATGCCATTTCTAAGAGTGAGCTGGCAAAGTTCAAGATCAAAATCACCAGCGAACTTGTGAGCA

ATGGAGTCCAGATCTATCAGTTCCCCACAGACGATGAGTCGGTGAGCGAGATCAATGGAACCATGAAT GCCCACCTGCCGTTTGCTGTTGTTGGCAGCA

CAGAAGAAGTGAAGATAGGCAACAAGATGATGCGGGCTCGGCAGTATCCTTGGGGGACTGTGCAGG TTGAAAACGAGGCTCACTGCGACTTTGTGAAGC

TGCGGGAGATGCTGATTCGGGTCAACATGGAGGATCTGCGGGAGCAGACCCACGCCCGGCACTATGAATTGTACCGCCGCTGTAAGCTGGAGGAGATGGG

CTTCAAGGACACCGACCCTGACAGCAAACCATTCAG TTTGCAGGAGACATATGAGGCAAAGAGAAATGAGTTCCTTGGGGAGCTCCAGAAGAAAGAAGA

GGAGATGAGGCAGATGTTTGTCCAGAGAGTCAAAGAGAAAGAAGCGGAGCTCAAGGAGGCTGAAAAAGAG CTGCATGAGAAATTTGACCGTCTGAAGAA

ACTGCACCAGGAAGAGAAGAAGAAGCTGGAGGATAAGAAGAAATGTCTGGATGAGGAAATGAACGCCTTCAAGCAGAGAAAGGCGGCAGCTGAGCTGCTC

CAGTCTCAGGGCTCTCAGGCTGGGGGCTCACAGACTCTGAAAAGGGACAAAGAGAAGAAGAA TTAACTCTGCTGTTTGCTGCATGCTGCATGACACCCA

GGGTCCTG TTTGGGCTTCCTGTAGACGCGCCCTTTCCTGTGCAACAGAGCTGGGCTTCCCTCTCTTTATTTCCCCCCTTAACATGCTTAGAGGGCATAC

ACCCCATGCCTTCCCTTTTTCTTCCTTCAAATGTTTATAGAAGCCTGAGAGTCAAATGATGATGTCTGGTTCCTGACCAAGAAGCCAGCAATCTCGTGGC

TTGGAGATACATTCCATACCTCAGTCCCTCTCCTAGTACCCTCCACCATATGCTCTCTCACATCCTCAATCCATCTCTGCCAGACTCACACATGTTTACA

GGTCACTGTTTGTCACTTTTGTGTACCAGCTTCCCCATTAGAATTCAACCGATACTTGTTTTCTTGAAGAATTTCCATCCACCAGTCAGGGGTCAGAACT

GTCCCCTTATACTCCTGCATCCTAGTCACTGGGATTGTTCTCCCACTCCTCTAATGCCAAGAGCCATAGCCCCTTATAATAGGTTCTAAAAGAATTGCCA

GCGATGCCTGTTTCTTCTCCCATCTTAGCCAAGCCCTTTCTTGATTTCCTTTATTCGGAGTCAGTTTACACAAGCTGTGTTAAAAGTCAGCCACACATTT

ATTCACACCAAGCCCTTCCTATACAAAACACAATTGCTGGAACAGATAGTGTATATTCCCCCTCTCTAATTCTAGGGACCCCCACAGATACAGAAGGGAA

AATAAACTGGAATGTTATCACCAGCCTAGAGTCTTGATTCATAGGCTTCTAAAATTCTCCTTGGGGGTTTCAGCATGCCATTGGTCAATTCTTGCCATCC

CAATGAAGTGGAATAGCAAGAATAATAATAATCCAAGTAGCTGATCAAAGAATCCAGGCGTGGGGTTGTCTAGTGTTCTAGTCTCCCTGATGAATGTAAT

GGTAGGGTGAACCTGCATTTGCACAAGTGACACTTGAAAGAGGGAAGAAAAGAGGCATTGTCACTTGAAAGGTCATTTACTTTGGTCTAAGGATTTGATA

TTTTTAAAAATATGGTAGTTTTAAGTTTTATAATGGGTCCCGCCTGATTGTGGCTTTTGGAAACCCTTTGAAGTACAGAGCCTTCCACCGTCAGGGCCAG

GAGGCAGAGTATGGCTTTTGGCGTTTGGCTAGTGACAGAGCAACAGCTAGAGGCGACCTGGCAATGATCTGTGGCTAATATGGCGTCTCTCTGCCCTTCC

TTTGCAGTAACCCATGGCTGTGTATTGAATAGTATGGCCCGCTACAGCTGGACTGGACTCCACTTAGCCTTTTAAGCGAAGGTTCTTATTTTAACTGACA

ACTTTTTTTAAAAAATATGGTGCCAGACAGCTGGGCCCTCCACCCCTGCTCTGGTACTTCAAGCATTTTGTTTTTGTTTTTGTTTTTGAGTTCTGCAACT

TGCTTCTGCCTCCCAGTCCCACTGGCATGGACCCTGACTTCTTTTATCTTGTTATAAAGGTGGCTGTATGATCACTACCTCTAAAAAAATGCAATAAATA

AATTTGCAGGCCTTCTGAACTGTTACAAAAGGGCAGGGGCCATTGTCTACAATCATAGTTAATAACTTGAACCTAAGACTAAGCCCAAAGCAGAACTTGT

TAAAGCAAGCAAGACAATGTGCGCACTTTCTCTTTTCTTGTTGGCAAAGAGAGAAGGCGGTTTTGATCTGTACTGGCCAATGGCCAGAGGCAAGGACCAG

GTGACAAAGTGAAAGCCTGAGCTAGTCCTTCAGAAAAACCAACTGGAAGTGGAGAATTGCAGGAAACCCTATGCCTAGAGGCGAAACAAAATGAAGCCAG

CCACCTCGGGAACAGAAAGCCCTAAAGCAAAATCTCCAAGTATCTCAGATACACTCAGTAATCAGGAGAGCCAGGCTACTGAGTGAAGGCTGTCTGGGTC

TCCTAGAGAAAGGCCCCTTATTTGTACCCATGGAGTTCTGTTTGTTTTTAAAAAAACAAGTTCTTACTATGTAGCCCTGGCTAGCCTTGAAATCACAAAA

CAGACCAGGCTGGCCTGAAATTCACAGAGATTTGCCTGCTGGTATTTTGCACTGGCATTAAAGGCAAACACCACCACACCCAGCTGCCTTAGGGGGGTTA

ATCCACCTTCCCAGACTGCCTGCCAGCCTGAAAGTACCACCTTCCTTAAAAAGTACTTGTATTTTTAAACGAGGCCTTTCATTTGCATCTGTATATACAC

TCCCTACTTGAGCCTGGAGGATTTCAGAATACTTCACAAGTATTTGAGCTACACAACCCTCTAAAAGCAAGCAAAAACTGTATATAAAGTGAGGAGCTTT

TTGATCAGCATGGCTGATATACCCCACCCCATGCTATAGGAGGATAGTGACACGTAGAGAAACGAAGGGACTCATCCAAGGTCCCAGCGCTATTCCTTGG

CAAGCAAAATTTCCAATTTCCTGTCTCTGGGTTCCTAATCCTTTTCACCAAGCAACCCAAGTATTTATGGTTTTTTCTGGAGACAAGATTTTTTTCTTTT

TTTTTTATGTTCAGAGAAACCAGTGTTAGATGACTCTTGAGGGTTTTTATGTAGAAAAATAGGATAGGGTGGGTAGGCACAGGTGAAGAGAAAGCTCCAG

GCCAGCTGCCATGATGCTGGATGATCAGTTAGCTGTAAGTCTGTAAGTCAAAACAGAAAATCAGATCCTGTAAGTCTGAACCAGGACCAGGCCAGTGTAC

ATTTCACTGGTGCACTGTGTAATCAGGGAACTCAGGTAGATATAAAAAGCAATGGTACCTATTAAAAGATGATGCTAAATTTCATTGAGAAGTTCTCACT

GTAAATGAGACAAACTTTTGTCTGTCTTCACTTGAAAGTCTTTAATTAGTACAATTGTTACTATTTTTTTAAAAAATTACTCTAAGTTCCCTGTTTACTT

CTGGCAAAACAAAAAACACTCATTAGAGAAATGGTCTGTGCTTTTCCAGACTGGAATGGAATGGCTTCCTGAAACACACACACACACCCCATTTCTCTTA

AGCCAAGAAGTCTGCTTTCTCCACCTGGTTTGGATTTTTTAAAAATCATTTGGCATTCACGTTTGGCTGTTAATATGTGCTTATTTTTAAATTAAAGCAA

GATGCAATT
Translation
MAAADIARQV GEDCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVG GETGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVGLKL

TIVSTVGFGDQINKEDS - UNI22651 - SYKPIVEFIDAQFEAYLQEELKIRRVLHSYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSK - UNI

22651 - VNIIPVIAKSDAISKSELAKFKIKITSELVSNGVQIYQFPTDDESVSEINGTMN AHLPFAVVGSTEEVKIGNKMMRARQYPWGTVQV VEN

EAHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTDPDSKPFS SLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEKE

 LHEKFDRLKKLHQEEKKKLEDKKKCLDEEMNAFKQRKAAAELLQSQGSQAGGSQTLKRDKEKKN N 
Transcript ENSMUST00000115239
Sequence
GAGCTCTTCTGTTTCCTGTGCAGCAGCTCCCGTTGCGGAGGCACCCGAAGCAGCCCTGGCGGACCAAGGAGCGATGGCAGCGGCCGATATAGCTCGCCAG

GTG GGCGAAGATTGTCGAACTGTCCCCCTGGCTGGACATGTGGGGTTCGACAGCTTGCCTGACCAGCTGGTGAATAAGTCAGTCAGCCAGGGCTTCTGC

TTCAACATCCTGTGCGTGG GGGAGACAGGTTTGGGCAAGTCCACGCTCATGGATACCCTGTTTAACACCAAGTTTGAAGGGGAGCCAGCGACCCACACA

CAGCCAGGGGTTCAGCTCCAGTCCAATACCTACGACCTCCAGGAGAGCAACGTGGGGTTGAAACTCACAATTGTGAGCACTGTAGGCTTTGGGGATCAGA

TCAACAAGGAGGACAG - UNI22651 - CTACAAGCCCATCGTGGAATTCATTGATGCTCAGTTTGAGGCCTACCTACAAGAGGAGCTGAAGATCCGA

AGAGTACTGCACTCCTACCATGACTCCCGAATCCATGTCTGCTTGTATTTCATTGCCCCGACAGGACATTCGCTTAAGTCTCTGGACCTAGTGACCATGA

AGAAGCTGGATAGTAAG - UNI22651 - GTGAACATCATTCCCGTTATTGCCAAGTCAGATGCCATTTCTAAGAGTGAGCTGGCAAAGTTCAAGATC

AAAATCACCAGCGAACTTGTGAGCAATGGAGTCCAGATCTATCAGTTCCCCACAGACGATGAGTCGGTGAGCGAGATCAATGGAACCATGAAT GCCCAC

CTGCCGTTTGCTGTTGTTGGCAGCACAGAAGAAGTGAAGATAGGCAACAAGATGATGCGGGCTCGGCAGTATCCTTGGGGGACTGTGCAGG TTGAAAAC

GAGGCTCACTGCGACTTTGTGAAGCTGCGGGAGATGCTGATTCGGGTCAACATGGAGGATCTGCGGGAGCAGACCCACGCCCGGCACTATGAATTGTACC

GCCGCTGTAAGCTGGAGGAGATGGGCTTCAAGGACACCGACCCTGACAGCAAACCATTCAG TTTGCAGGAGACATATGAGGCAAAGAGAAATGAGTTCC

TTGGGGAGCTCCAGAAGAAAGAAGAGGAGATGAGGCAGATGTTTGTCCAGAGAGTCAAAGAGAAAGAAGCGGAGCTCAAGGAGGCTGAAAAAGAG CTGC

ATGAGAAATTTGACCGTCTGAAGAAACTGCACCAGGAAGAGAAGAAGAAGCTGGAGGATAAGAAGAAATGTCTGGATGAGGAAATGAACGCCTTCAAGCA

GAGAAAGGCGGCAGCTGAGCTGCTCCAGTCTCAGGGCTCTCAGGCTGGGGGCTCACAGACTCTGAAAAGGGACAAAGAGAAGAAGAA TAACCCATGGCT

GTGTATTGAATAG
Translation
MAAADIARQV GEDCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVG GETGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVGLKL

TIVSTVGFGDQINKEDS - UNI22651 - SYKPIVEFIDAQFEAYLQEELKIRRVLHSYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSK - UNI

22651 - VNIIPVIAKSDAISKSELAKFKIKITSELVSNGVQIYQFPTDDESVSEINGTMN AHLPFAVVGSTEEVKIGNKMMRARQYPWGTVQV VEN

EAHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTDPDSKPFS SLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEKE

 LHEKFDRLKKLHQEEKKKLEDKKKCLDEEMNAFKQRKAAAELLQSQGSQAGGSQTLKRDKEKKN NNPWLCIE
Transcript ENSMUST00000060474
Sequence
GAGCTCTTCTGTTTCCTGTGCAGCAGCTCCCGTTGCGGAGGCACCCGAAGCAGCCCTGGCGGACCAAGGAGCGATGGCAGCGGCCGATATAGCTCGCCAG

GTG GGCGAAGATTGTCGAACTGTCCCCCTGGCTGGACATGTGGGGTTCGACAGCTTGCCTGACCAGCTGGTGAATAAGTCAGTCAGCCAGGGCTTCTGC

TTCAACATCCTGTGCGTGG GGGAGACAGGTTTGGGCAAGTCCACGCTCATGGATACCCTGTTTAACACCAAGTTTGAAGGGGAGCCAGCGACCCACACA

CAGCCAGGGGTTCAGCTCCAGTCCAATACCTACGACCTCCAGGAGAGCAACGTGGGGTTGAAACTCACAATTGTGAGCACTGTAGGCTTTGGGGATCAGA

TCAACAAGGAGGACAG - UNI22651 - CTACAAGCCCATCGTGGAATTCATTGATGCTCAGTTTGAGGCCTACCTACAAGAGGAGCTGAAGATCCGA

AGAGTACTGCACTCCTACCATGACTCCCGAATCCATGTCTGCTTGTATTTCATTGCCCCGACAGGACATTCGCTTAAGTCTCTGGACCTAGTGACCATGA

AGAAGCTGGATAGTAAG - UNI22651 - GTGAACATCATTCCCGTTATTGCCAAGTCAGATGCCATTTCTAAGAGTGAGCTGGCAAAGTTCAAGATC

AAAATCACCAGCGAACTTGTGAGCAATGGAGTCCAGATCTATCAGTTCCCCACAGACGATGAGTCGGTGAGCGAGATCAATGGAACCATGAAT GCCCAC

CTGCCGTTTGCTGTTGTTGGCAGCACAGAAGAAGTGAAGATAGGCAACAAGATGATGCGGGCTCGGCAGTATCCTTGGGGGACTGTGCAGG TTGAAAAC

GAGGCTCACTGCGACTTTGTGAAGCTGCGGGAGATGCTGATTCGGGTCAACATGGAGGATCTGCGGGAGCAGACCCACGCCCGGCACTATGAATTGTACC

GCCGCTGTAAGCTGGAGGAGATGGGCTTCAAGGACACCGACCCTGACAGCAAACCATTCAG TTTGCAGGAGACATATGAGGCAAAGAGAAATGAGTTCC

TTGGGGAGCTCCAGAAGAAAGAAGAGGAGATGAGGCAGATGTTTGTCCAGAGAGTCAAAGAGAAAGAAGCGGAGCTCAAGGAGGCTGAAAAAGAG CTGC

ATGAGAAATTTGACCGTCTGAAGAAACTGCACCAGGAAGAGAAGAAGAAGCTGGAGGATAAGAAGAAATGTCTGGATGAGGAAATGAACGCCTTCAAGCA

GAGAAAGGCGGCAGCTGAGCTGCTCCAGTCTCAGGGCTCTCAGGCTGGGGGCTCACAGACTCTGAAAAGGGACAAAGAGAAGAAGAA - UNI33980 -

 CTTTTTTTAA
Translation
MAAADIARQV GEDCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVG GETGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVGLKL

TIVSTVGFGDQINKEDS - UNI22651 - SYKPIVEFIDAQFEAYLQEELKIRRVLHSYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSK - UNI

22651 - VNIIPVIAKSDAISKSELAKFKIKITSELVSNGVQIYQFPTDDESVSEINGTMN AHLPFAVVGSTEEVKIGNKMMRARQYPWGTVQV VEN

EAHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTDPDSKPFS SLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEKE

 LHEKFDRLKKLHQEEKKKLEDKKKCLDEEMNAFKQRKAAAELLQSQGSQAGGSQTLKRDKEKKN - UNI33980 - NFF
Transcript ENSMUST00000115241
Sequence
GAGCTCTTCTGTTTCCTGTGCAGCAGCTCCCGTTGCGGAGGCACCCGAAGCAGCCCTGGCGGACCAAGGAGCGATGGCAGCGGCCGATATAGCTCGCCAG

GTG GGCGAAGATTGTCGAACTGTCCCCCTGGCTGGACATGTGGGGTTCGACAGCTTGCCTGACCAGCTGGTGAATAAGTCAGTCAGCCAGGGCTTCTGC

TTCAACATCCTGTGCGTGG GGGAGACAGGTTTGGGCAAGTCCACGCTCATGGATACCCTGTTTAACACCAAGTTTGAAGGGGAGCCAGCGACCCACACA

CAGCCAGGGGTTCAGCTCCAGTCCAATACCTACGACCTCCAGGAGAGCAACGTGGGGTTGAAACTCACAATTGTGAGCACTGTAGGCTTTGGGGATCAGA

TCAACAAGGAGGACAG - UNI22651 - CTACAAGCCCATCGTGGAATTCATTGATGCTCAGTTTGAGGCCTACCTACAAGAGGAGCTGAAGATCCGA

AGAGTACTGCACTCCTACCATGACTCCCGAATCCATGTCTGCTTGTATTTCATTGCCCCGACAGGACATTCGCTTAAGTCTCTGGACCTAGTGACCATGA

AGAAGCTGGATAGTAAG - UNI22651 - GTGAACATCATTCCCGTTATTGCCAAGTCAGATGCCATTTCTAAGAGTGAGCTGGCAAAGTTCAAGATC

AAAATCACCAGCGAACTTGTGAGCAATGGAGTCCAGATCTATCAGTTCCCCACAGACGATGAGTCGGTGAGCGAGATCAATGGAACCATGAAT GCCCAC

CTGCCGTTTGCTGTTGTTGGCAGCACAGAAGAAGTGAAGATAGGCAACAAGATGATGCGGGCTCGGCAGTATCCTTGGGGGACTGTGCAGG TTGAAAAC

GAGGCTCACTGCGACTTTGTGAAGCTGCGGGAGATGCTGATTCGGGTCAACATGGAGGATCTGCGGGAGCAGACCCACGCCCGGCACTATGAATTGTACC

GCCGCTGTAAGCTGGAGGAGATGGGCTTCAAGGACACCGACCCTGACAGCAAACCATTCAG TTTGCAGGAGACATATGAGGCAAAGAGAAATGAGTTCC

TTGGGGAGCTCCAGAAGAAAGAAGAGGAGATGAGGCAGATGTTTGTCCAGAGAGTCAAAGAGAAAGAAGCGGAGCTCAAGGAGGCTGAAAAAGAG CTGC

ATGAGAAATTTGACCGTCTGAAGAAACTGCACCAGGAAGAGAAGAAGAAGCTGGAGGATAAGAAGAAATGTCTGGATGAGGAAATGAACGCCTTCAAGCA

GAGAAAGGCGGCAGCTGAGCTGCTCCAGTCTCAGGGCTCTCAGGCTGGGGGCTCACAGACTCTGAAAAGGGACAAAGAGAAGAAGAA - UNI33980 -

 TTTTTTT
Translation
MAAADIARQV GEDCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVG GETGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVGLKL

TIVSTVGFGDQINKEDS - UNI22651 - SYKPIVEFIDAQFEAYLQEELKIRRVLHSYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSK - UNI

22651 - VNIIPVIAKSDAISKSELAKFKIKITSELVSNGVQIYQFPTDDESVSEINGTMN AHLPFAVVGSTEEVKIGNKMMRARQYPWGTVQV VEN

EAHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTDPDSKPFS SLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEKE

 LHEKFDRLKKLHQEEKKKLEDKKKCLDEEMNAFKQRKAAAELLQSQGSQAGGSQTLKRDKEKKN - UNI33980 - NFF

For any suggestions or comments, please send an email to unitrap@crg.es