Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000050394 (Armcx6)
Chromosomal location
Chr X: 131282994 - 131285951 (-)
Description
armadillo repeat containing, X-linked 6 Gene [Source:MGI (curated);Acc:Armcx6-001]
Human Ortholog
not available
Omim not available
UniTrap UNI37341
Vector Insertion
Chr X: 131285573 - 131285688
Public Clones CMHD-GT_425D9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113194
Sequence
AGGTCGGTGGAAGCTGCTTGGAAGGCGATGTGGGTGGGAGAGGGCCAAGAGCACCTCGCATCCAAGTTTGGCGAATATGGGCTATGTCCCTTTCTCACCT

ACTTTTTAAATATCTACTGGACCCGCATCTCACCCTCGGTTCTTTTAGTAGGGAGAAGTGGCAGGCTTCAGGTTGGGGTGAG - UNI37341 - GTCT

CCGCTGGAGCCTAGACTTGAGAAGAAGCAACCCGCCTTGGTTGGAACCTTGCTGCAGGTTTGAAGGTGGGATTCATCCTGATCCTAAAG ACTCGGTCCA

CCTATCTCCGTGGAGGGAATACAGCAGAAGCCACCAGAAGAAAAAAGGAATTCAATTGGTTTTTGTAGAG ATTCATGACAAGAATCGCAGAAGCCTAGA

AGAGGCTGAAGATTACTAGCCTGACCTATTAATCCACACATCCGCTGACCGTTCTCTTCAATCAGGTGAAGAAAGGCCCTCTTCTTTCTGGCCACAAGGC

TCACACACCTATAATCATGGGTCGGGCCCGGGAAATGGGTTGGATGGCAGCCGGACTCATGATTGGAGCTGGTGCCTGTTACTGCATGTACAAACTGACC

ATGGGAAGAAGTGAGGGGAACGAGCTGGAGGACGAGGAGGAAGATGAATGGGAAGATGGACAGGATCTGGATGAAGAGGAAGCAGACAATTGGTTTGATT

TCACAGCAATGGCTCGACCCTGGAGTGAGGATGGGGACTGGGATGAACCTGGGGCCCCAGGTGGGACTGAGGACAGACGGTCAGGTGGTGGAAAGGCAAA

CAGAGCACACCCAATCAAGCAGCGGCCATTCCCTTATGAACATAAAAACATATGGGGTGAACAGAGCTTTAAATCCTTCACTTGTATTCTTGACCTGAAC

AAGTGTGTTTCCACTCAAAGAAAGAAAAGGTTCACGAAGAACATAAATGCTGGCTTTTCCCTTAGCCCCAATATCAGTAAACATCTGGCCAGCCTATCAG

TGGTTGGAAACAGGAGTCCCACCCCCCATCCCACTGTGAGGGAGAAGGCTCTGTTTGTCCCTGAAAACCCAAACAGCAGCCTTGAAAATCAGGGCCAGAT

TAAGATGTCCATTGATGAAGTGTGTCGAGAGACACTGTTGTGTTGCTGCAAGTCTTTTCTGCAGCAGGCAGGATTAAGTCTGCTAATAAGCATGACAGTC

ATTAATAACATGCTTGCCAAGTCTGTTTCAGACCTGAAGTTTCCTTTGCTATCCAAGGGGAGTGGATGTGCAGAGGTGCGGGGCTTGGAAGAGCTGATGA

GTTTGTCTGAAAAGCCAGTGCTGGTGGGGGAAGCACTGGCTGCCCAAATGCTCTCCTCCTTCATGTGCCTCTTTACCAGAAGTGGGAGCAGAGAGATGCT

TGTGGAAGCCATCTCCCCTTAAGTGGCTGTCTCAGAAAGAATGAGACTGAAGCCACCCAGAGCCTGAGCACTTTCCTGAGGGCAAAGAGGCTGCAGTGAG

TGCCACTAAGGATGCAGCTTTAGCCAGTCAGCTCCTCCCTGGGTGAGAGTTCCTTCCACTGTCTAAATGGAGGGCTACACTCTGACTGGCCAGGCAAGGC

TCTTCCAGAGCTGTGGGCAACTTCTGGGTTTTGTAGTTTGCAGGTAAAGTGCATTGTAAATTGCTGCCCTGCAGCCTTCTTCATGTGGTAAAGGGTAAGG

GGCTCCCCGTGGCCACTAGCTGGGGATGACTAACAGCAAATCACAGCATAGAGGTGAAGGGTAAGGGGATGCCCGCGGCCACTAGCTGGGGAAACTAACA

GCAAGTCACAGCATCAGAGTGAATGTTGCTGTTGCCTGTGGTGATCTCCCTGTCTAAGCGCTGAACCACTTAGCAGAAATGACACCCATATGAGAGCTTG

TGCCAAATACCCTTCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTTAGATAGAAGTAGTTCCCTTCTCCTCTGTCCTACACTAGCTGATGGAT

GGCTAGCATGTTAATCAAGAGATGCACTCCCTTCCTGTCCACTGTAGTGACTGACCCTCTTACTCCCCAGTCCCTTACCCTCACCCCCAGTTTGTATCCT

CAATAAACTGTGTGCTTTGATTGGCAAGACAATTAA
Translation
 - UNI37341 -   MGRAREMGWMAAGLMIGAGACYCMYKLTMGRSEGNELEDEEEDEWEDGQDLDEEEADNWFDFTAMARPWSEDGDWDEPGAPGGT

EDRRSGGGKANRAHPIKQRPFPYEHKNIWGEQSFKSFTCILDLNKCVSTQRKKRFTKNINAGFSLSPNISKHLASLSVVGNRSPTPHPTVREKALFVPEN

PNSSLENQGQIKMSIDEVCRETLLCCCKSFLQQAGLSLLISMTVINNMLAKSVSDLKFPLLSKGSGCAEVRGLEELMSLSEKPVLVGEALAAQMLSSFMC

LFTRSGSREMLVEAISP
Transcript ENSMUST00000052431
Sequence
TGTTAGTCGCCTCTGACTGGGTACCAACCCCCTATTACTCTGCAGGCGCGTGAAGGAGAAGGAAACTCGCTGGGACCGTGCAG - UNI37341 - GTC

TCCGCTGGAGCCTAGACTTGAGAAGAAGCAACCCGCCTTGGTTGGAACCTTGCTGCAGGTTTGAAGGTGGGATTCATCCTGATCCTAAAG ACTCGGTCC

ACCTATCTCCGTGGAGGGAATACAGCAGAAGCCACCAGAAGAAAAAAGGAATTCAATTGGTTTTTGTAGAG ATTCATGACAAGAATCGCAGAAGCCTAG

AAGAGGCTGAAGATTACTAGCCTGACCTATTAATCCACACATCCGCTGACCGTTCTCTTCAATCAGGTGAAGAAAGGCCCTCTTCTTTCTGGCCACAAGG

CTCACACACCTATAATCATGGGTCGGGCCCGGGAAATGGGTTGGATGGCAGCCGGACTCATGATTGGAGCTGGTGCCTGTTACTGCATGTACAAACTGAC

CATGGGAAGAAGTGAGGGGAACGAGCTGGAGGACGAGGAGGAAGATGAATGGGAAGATGGACAGGATCTGGATGAAGAGGAAGCAGACAATTGGTTTGAT

TTCACAGCAATGGCTCGACCCTGGAGTGAGGATGGGGACTGGGATGAACCTGGGGCCCCAGGTGGGACTGAGGACAGACGGTCAGGTGGTGGAAAGGCAA

ACAGAGCACACCCAATCAAGCAGCGGCCATTCCCTTATGAACATAAAAACATATGGGGTGAACAGAGCTTTAAATCCTTCACTTGTATTCTTGACCTGAA

CAAGTGTGTTTCCACTCAAAGAAAGAAAAGGTTCACGAAGAACATAAATGCTGGCTTTTCCCTTAGCCCCAATATCAGTAAACATCTGGCCAGCCTATCA

GTGGTTGGAAACAGGAGTCCCACCCCCCATCCCACTGTGAGGGAGAAGGCTCTGTTTGTCCCTGAAAACCCAAACAGCAGCCTTGAAAATCAGGGCCAGA

TTAAGATGTCCATTGATGAAGTGTGTCGAGAGACACTGTTGTGTTGCTGCAAGTCTTTTCTGCAGCAGGCAGGATTAAGTCTGCTAATAAGCATGACAGT

CATTAATAACATGCTTGCCAAGTCTGTTTCAGACCTGAAGTTTCCTTTGCTATCCAAGGGGAGTGGATGTGCAGAGGTGCGGGGCTTGGAAGAGCTGATG

AGTTTGTCTGAAAAGCCAGTGCTGGTGGGGGAAGCACTGGCTGCCCAAATGCTCTCCTCCTTCATGTGCCTCTTTACCAGAAGTGGGAGCAGAGAGATGC

TTGTGGAAGCCATCTCCCCTTAAGTGGCTGTCTCAGAAAGAATGAGACTGAAGCCACCCAGAGCCTGAGCACTTTCCTGAGGGCAAAGAGGCTGCAGTGA

GTGCCACTAAGGATGCAGCTTTAGCCAGTCAGCTCCTCCCTGGGTGAGAGTTCCTTCCACTGTCTAAATGGAGGGCTACACTCTGACTGGCCAGGCAAGG

CTCTTCCAGAGCTGTGGGCAACTTCTGGGTTTTGTAGTTTGCAGGTAAAGTGCATTGTAAATTGCTGCCCTGCAGCCTTCTTCATGTGGTAAAGGGTAAG

GGGCTCCCCGTGGCCACTAGCTGGGGATGACTAACAGCAAATCACAGCATAGAGGTGAAGGGTAAGGGGATGCCCGCGGCCACTAGCTGGGGAAACTAAC

AGCAAGTCACAGCATCAGAGTGAATGTTGCTGTTGCCTGTGGTGATCTCCCTGTCTAAGCGCTGAACCACTTAGCAGAAATGACACCCATATGAGAGCTT

GTGCCAAATACCCTTCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTTAGATAGAAGTAGTTCCCTTCTCCTCTGTCCTACACTAGCTGATGGA

TGGCTAGCATGTTAATCAAGAGATGCACTCCCTTCCTGTCCACTGTAGTGACTGACCCTCTTACTCCCCAGTCCCTTACCCTCACCCCCAGTTTGTATCC

TCAATAAACTGTGTGCTTTGATTGGCAAGACAATTAAACAGGG
Translation
 - UNI37341 -   MGRAREMGWMAAGLMIGAGACYCMYKLTMGRSEGNELEDEEEDEWEDGQDLDEEEADNWFDFTAMARPWSEDGDWDEPGAPGGT

EDRRSGGGKANRAHPIKQRPFPYEHKNIWGEQSFKSFTCILDLNKCVSTQRKKRFTKNINAGFSLSPNISKHLASLSVVGNRSPTPHPTVREKALFVPEN

PNSSLENQGQIKMSIDEVCRETLLCCCKSFLQQAGLSLLISMTVINNMLAKSVSDLKFPLLSKGSGCAEVRGLEELMSLSEKPVLVGEALAAQMLSSFMC

LFTRSGSREMLVEAISP

For any suggestions or comments, please send an email to unitrap@crg.es