Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000050556 (Kcnb1)
Chromosomal location
Chr 2: 166928888 - 167014299 (-)
Description
potassium voltage gated channel, Shab-related subfamily, member 1 Gene [Source:MGI (curated);Acc:Kcnb1-001]
RefSeq_dna
NM_008420 
RefSeq_peptide
NP_032446.2 
UniGene
Mm.387390 
MGI
MGI:96666 
Uniprot/SWISSPROT
Q03717 
Uniprot/SPTREMBL
B0LAE2 Q0N2S5 Q80X33 Q8K0D1 
Human Ortholog
ENSG00000158445 (KCNB1)
Omim not available
UniTrap UNI31574
Vector Insertion
Chr 2: 166928887 - 167014300
Public Clones IST14814A11 (tigm) IST12385D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000059826
Sequence
CTGCCTCGCAGCCGTCGGGATGGAGGTGAGACGGTAGCCGCGACGCCCGCCCTCGCGCACCCCTGCACCACAGCGGCCTGCAGAGCTCCCCGCCCCCCGC

CCCCGCGGCAGCGGGCCTTGCCGTCGAGTGACAGCGGCCTGGGGGGGCAGGGGGGGCGGGGGCGGCCAGACCAGCGATGCCGGCGGGCATGACGAAGCAT

GGCTCGCGCTCCACCAGCTCGCTGCCGCCCGAGCCCATGGAGATCGTGCGCAGCAAGGCGTGCTCGCGCCGGGTGCGCCTCAACGTCGGGGGCCTGGCGC

ACGAGGTGCTGTGGCGCACTCTGGACCGCCTGCCTCGCACGCGGCTGGGCAAGCTCCGGGACTGCAACACGCACGACTCTCTGCTCCAGGTGTGCGACGA

CTACAGCCTCGAGGACAACGAGTACTTCTTCGACCGCCACCCTGGCGCCTTCACCTCTATTCTCAATTTCTACCGCACCGGCCGGCTGCACATGATGGAG

GAGATGTGCGCGCTGAGCTTCAGCCAGGAGCTGGACTACTGGGGCATCGATGAGATCTACCTGGAGTCCTGCTGCCAGGCCCGCTACCACCAAAAGAAGG

AGCAGATGAACGAGGAGCTGAAGCGGGAGGCTGAGACGCTGCGGGAGCGGGAGGGCGAGGAGTTCGACAACACGTGCTGTGCTGAGAAGAGGAAGAAACT

TTGGGACCTGCTGGAGAAGCCCAACTCATCGGTGGCCGCCAAG - UNI31574 - ATCCTGGCCATCATCTCCATCATGTTCATTGTCCTCTCCACCA

TTGCCCTGTCACTCAACACACTGCCTGAGCTACAGAGCCTGGACGAATTCGGCCAGAGCACGGACAACCCGCAGCTGGCACACGTGGAGGCTGTGTGCAT

CGCGTGGTTCACCATGGAGTACTTGCTGAGGTTCCTGTCCTCGCCCAAGAAATGGAAGTTCTTTAAGGGCCCCCTCAACGCCATTGACTTACTGGCCATC

CTGCCCTACTACGTCACCATCTTCCTCACAGAATCCAACAAGAGCGTGCTGCAGTTCCAGAATGTGCGCCGTGTGGTCCAGATCTTCCGCATCATGCGCA

TCCTGCGCATCCTGAAGTTGGCCCGCCACTCCACCGGTCTGCAGTCCTTGGGCTTCACGCTGCGCAGGAGCTACAACGAGCTGGGCTTGCTCATCCTCTT

CCTCGCCATGGGCATCATGATCTTCTCCAGCCTGGTCTTCTTTGCCGAGAAGGATGAGGATGACACCAAGTTCAAAAGCATCCCCGCCTCTTTCTGGTGG

GCTACCATCACCATGACGACCGTTGGTTACGGAGACATCTACCCTAAGACTCTCCTGGGGAAAATCGTGGGGGGCCTCTGTTGCATTGCCGGTGTCCTGG

TGATTGCCCTCCCCATTCCAATTATCGTCAATAACTTCTCCGAGTTCTACAAGGAGCAGAAGCGCCAGGAGAAAGCCATCAAGCGGAGAGAGGCTCTGGA

GAGAGCCAAGAGGAACGGCAGCATCGTGTCCATGAACATGAAGGATGCCTTCGCCCGGAGCATCGAGATGATGGACATCGTGGTGGAGAAAAATGGAGAG

GGCGTGGCTAAGAAGGACAAGGTGCAGGATAACCACCTGTCTCCCAACAAGTGGAAATGGACCAAGAGGGCGCTCTCCGAGACCAGCTCGAGCAAGTCCT

TTGAAACCAAGGAGCAGGGATCTCCTGAGAAGGCCAGGTCCTCGTCTAGTCCGCAGCACTTGAACGTCCAGCAGCTGCAAGACATGTACAGCAAGATGGC

CAAGACCCAGTCTCAACCCATCCTCAACACCAAGGAGATGGCGCCGCAGAGCCAGCCGCAGGAAGAACTGGAGATGGGCAGCATGCCCAGCCCCGTGGCC

CCTCTGCCCACGCGCACAGAGGGCGTCATCGACATGCGCAGCATGTCTAGCATCGACAGCTTCATCAGCTGCGCCACGGACTTCCCTGAAGCCACCAGAT

TCTCCCACAGTCCTCTGGCATCCCTCTCCGGCAAGTCTGGGGGCAGCACAGCCCCGGAGGTGGGCTGGCGGGGGGCTCTGGGTGCCAGCGGCGGGAGACT

CATGGAGACCAACCCCATCCCCGAGGCCAGCCGCTCTGGTTTCTTCGTGGAGAGCCCCCGGAGTTCCATGAAGACCCACAACCCCATGAAGCTGCGAGCG

CTCAAGGTTAACTTCCTGGAGGGCGATCCCACCCCGCTGCTACCGGCTCTGGGCTTGTATCACGATCCTCTTAGGAACAGAGGAGGCGCAGCGGCTGCAG

TCGCCGGACTGGAGTGTGCCTCCCTCTTAGACAAGCCCGTGCTGAGCCCGGAGTCCTCCATCTACACCACAGCAAGTGCCAGGACGCCCCCTCGCTCCCC

AGAGAAACACACAGCAATAGCGTTCAACTTCGAGGCGGGGGTCCACCAGTACATAGACACCGACACTGATGACGAGGGTCAGCTGCTCTACAGCGTGGAC

TCCAGTCCTCCCAAGAGTCTCCACGGGAGTACCAGCCCCAAGTTCAGCCTTGGAGCTAGAACAGAAAAGAACCACTTCGAGAGCTCCCCGTTGCCCACCT

CCCCTAAGTTCTTAAGGCCGAACTGTGTCTACGCCTCAGAAGGGTTACCTGGGAAAGGTCCCGGGGCCCAAGAGAAATGCAAGCTGGAGAACCACACCTC

CCCCGATGTGCACATGCTGCCTGGGGGAGGAGCACACGGGAGCACTCGGGATCAGAGTATCTGAGCTCCCTACCACAGAGGGTATTTGCAGGAGACATCG

AGGAGGAGGGATGCTTGGCCTGCCTGCCGCTGAGTTCTGCGTGAACTCGGAGACCCAAGGACCCCACACACACACAATTTTCCCCACCCCCGCAGAGCCC

CAGCGACAGGAGAGACCCTGAGAGCCACGACAAGTCTGTGGACACCAACTAGGATGGGGACCACACCTAACAGCTTCTTCCTTAGATGGCAGGAGCAGAG

CTGACAGCCACATACTCCTAGTCTCCTTTAGAGGCTCTGTCTGCCTCTGAGTGCGTCATCGCCATCTCTCATGGCGTCAGCTGAGGCAGGTGTTGGAGCA

AGGGGTTGCTAGTGAGAGAGTGGGCTGGCCAAGCAGTAGTGGGTGTCCCCCCTCTTGTTAGAGGGGTACAGAGGACACTTGATCCTGAGGGAGTCTCCAC

TTCATCAGCCACACTCCTAGGGCATAACGCTTAAACAAGCAGCGGCTCAAATGATTCAGTATTCTGTGGTATCTGGGGCTTTAGTCTGAGAAGCTGTCAG

GAGGAGCTGACAATTTAAACTCAATCCTTTCTGCTCACCTGGCAATCCAGAAAGGGTTCCAACAGTTGGCACGCAGCCAAGGGGATATAAGCCAGGGCTG

TCACAGGAATGCGGGTCCCAAACAGGGCTAGCCCGGACTGAAAAGATAAGCGTCAAATATGCAAACGAGATAGATTATTCAAAAAGACTGTGTGTGACTG

AAAAACAACATTAAAAAAATAATAAATTTCATTTTCTACATGAAAAAAAAAAGAAAAAAGAAAAGAAAAATCCTTCACTGAACTGCCCTGTGAAGAATTG

TGACTACTTTCTGCTGTGGTGTGGTAGGGAACACACCTACTATGAGAGGAAGTTCTCTCTCTCTTTTTTTTTCTTTCTTTTTTTGTTTCCTGTAGTATTC

AAGCTAAAAAATAATAATAATAATAAGTT
Translation
MPAGMTKHGSRSTSSLPPEPMEIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLQVCDDYSLEDNEYFFDRHPGAFTSILNFYR

TGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCAEKRKKLWDLLEKPNSSVAAK - UNI31574

 - ILAIISIMFIVLSTIALSLNTLPELQSLDEFGQSTDNPQLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSV

LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPK

TLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMNMKDAFARSIEMMDIVVEKNGEGVAKKDKVQDNHLSPN

KWKWTKRALSETSSSKSFETKEQGSPEKARSSSSPQHLNVQQLQDMYSKMAKTQSQPILNTKEMAPQSQPQEELEMGSMPSPVAPLPTRTEGVIDMRSMS

SIDSFISCATDFPEATRFSHSPLASLSGKSGGSTAPEVGWRGALGASGGRLMETNPIPEASRSGFFVESPRSSMKTHNPMKLRALKVNFLEGDPTPLLPA

LGLYHDPLRNRGGAAAAVAGLECASLLDKPVLSPESSIYTTASARTPPRSPEKHTAIAFNFEAGVHQYIDTDTDDEGQLLYSVDSSPPKSLHGSTSPKFS

LGARTEKNHFESSPLPTSPKFLRPNCVYASEGLPGKGPGAQEKCKLENHTSPDVHMLPGGGAHGSTRDQSI

For any suggestions or comments, please send an email to unitrap@crg.es