Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000050565 (Tor1aip2)
Chromosomal location
Chr 1: 157882533 - 157915991 (+)
Description
torsin A interacting protein 2 Gene [Source:MGI (curated);Acc:Tor1aip2-002]
RefSeq_dna
NM_172843 
RefSeq_peptide
NP_766431.2 
UniGene
Mm.407148 Mm.253335 
MGI
MGI:3582695 
Uniprot/SWISSPROT
Q8BYU6 
Human Ortholog
ENSG00000169905 (TOR1AIP2)
Omim not available
UniTrap UNI19380
Vector Insertion
Chr 1: 157888133 - 157888204
Public Clones not available
Private Clones OST392706 (lexicon) OST340276 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13362
Vector Insertion
Chr 1: 157898423 - 157898754
Public Clones CMHD-GT_329E6-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37673
Vector Insertion
Chr 1: 157898754 - 157906540
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000060404
Sequence
GACATTCTGCCGTGGCGGCTGGGGGTTGCAGACCAGCGCTGTGGAGCTGGAGGAACGGCCTAGTGGTACCGCTGATCCTGACTGTCCCGTGTTTTAAAAC

CTGGCTGGAAATT - UNI13362 - - UNI19380 - TCACTGTCTATATCCCTTGCTTCTTGCTTCCATGGGAAGCATGAGTCTATTGGAACCTGG

GACAAGAAGAAACCAAGGTATCTCCACTACAAAACCCAGACACTAAAAAGATGTCCCAAAGTCTGAAGAGCCAGAACACAAACATGAGCGACAGTGGCTG

CAGGGATCCTGTGGGAG ACTCACAAAATGTTTTGGAAAATGATCCATCAATAAACTCTCAAACACAGGACACCAGAGTCACACCGAATAACACTGCAGA

AGCCCAGCCCCTACAGCCCACATCTGATCTTAAAGAAGACCACCATGAAATAGGGGCCAGAGCTCAGGAGCATACAGACACAGGTGACAGGTCAGAAAGT

CCAGAGGAACCAGCGTTAGAGAAACCTCCACTGGATAAAGCAGAGCTGGAGAGCAGCCCGAGTTCTCAGGACACAGAGCTCGGGCATCACCCCCACTCAG

AACATGGGGGCGGAGACGCCCTAGATCTGGATCCTAACTGCTCTCAAAGCGACTTGGGAGGAAGAGCAGATGCACACCTGGAGAGCAGCTCTGTAGCGTC

CCCAGAGGGAGCAGGTGACAGGGGTGAAGCTGATGAGCACCTGGAGAGCAGCTCTGCAGCCCCCACAGAGGGGGCAGGTGACAGGGGTGAAGCTGGTCAG

GAACTGCTTGCTGAAGACTCTACCGATGGCCAGAGTCTGGGCCATTCCAACACAGGTCCAGGGAACCAGGATTCACTGAGGAGACGACTGCCTGTGCCCG

 AGGCTGGAAGTCATGAAGAGGAGACAGAGTTGGTGAAGGAAAAGCAAGAGGTTGCACAGGATACATTGAGAAAGACTGATAAAAAGAGTCTCTGGACCT

ATG GTTCCGTGTTTCTCGGCTGCCTGATCGTGGCTGTTGTGCTAAGCTCCGTCAACAGCTACTATTCTTCCCCAGCCCAGCAGGTGCCCCAGAACCCGG

CTTTGGAGGCCTTCCTGGCTCAGTTTGGCCAACTGAAGGAGAAATTTCCAGGTCAGAGTTCCTTCCTGTGGCAGCGAGGACGTAAGTTTCTCCAGAAGCA

CCTCAATGCCTCGAACCCCAGTGAGCCGGCCACCATCATCTTCACAGCTGCTCGAGAGGGCAAGGAGACCCTCAAGTGCCTGAGCTACCATGTTGCCAAC

GCCTACACCTCTTCCCAGAAGGTGACTGCCGTCTCCATAGACGGAGCCGAAAGGGCCCTGCAGGACAGTGACACAGTCAAGCTGCTGGTTGACTTGGAGC

TTAGCGATGGGTTTGAGAATGGCCACAAGGCTGCTGTGGTCCACCACTTCGAATCCCTTCCTGCCGGCTCCACCCTGATCTTCTACAAGTACTGTGACCA

TGAGAACGCCGCCTTTAAAGATGTGGCACTTGTCCTGACAGTCCTGCTGGAGGAGGAAACGTTAGAAGCAAGTGTAAGCCCCAGGGAAATAGAAGAAAAG

GTGAGGGATTTACTCTGGGCTAAGTTCACCAACTCTGAGAGCCCCACCTCCTACAGCCACATGGACTCAGACAAACTGAGTGGGCTCTGGAGCCGCATCT

CCCACCTGGTGCTGCCCGTCCAGCCCGTCAGGAACATAGAAGAGCGAGGCTGCCTTTTGTGAAGCCAGTCACAGAGGTGACATGGAAGGGCCATGTCTCA

GGGCTCTGTCCCGCTAGGAGGTGACTGGCATGTGAGAGGAAACAGCTGGGAGGCCGTCACTGTGTTAGAAAAGAAGCTTTTTTTCTTTGACTTTTAAAAA

ATCTTTCTAGTCTGAACTTTGATAAAACTAACAATTGGCCTGATGTTTTTCTTTGTTTTTTAAAGCCAATCAGGGTTAAAATACAACATGATGTATTGTT

TAAGTGTCCAGCACATCAGTAGAATAGAATTGTTTTGCACAGGAAGATCTGATTCTCCGGGGAACTGCAGCCCCACTGCTGCCTGCAAGGACTCTCACCA

GCCTCTAGGGCAGTGCTTGGACCTGGACGAGGTGTCATGTAAATGATTTTAGAGAACTCTTCTACTACATATTAAGTGCTTTTTAATATTCACTTTTTTT

TGTTGTTTTTTTCTGAGGCAGGGTTTCTCTGTGTAGCTCTGGCTGTCCTGGAACTCACTTTGTAGACCAGGCTGGCCTCGAACTCAGAAATCTGCCTGCC

TCTGCCTCCTAAGTGCTGGGGTTAAAGGCGTGCAGCATCACTGCCTGGCCTTAATACTCACTTTAATAATACACTTGTGGGTTGATTGTGTCTTACACAG

ATTTGCACTTTGAGTAGGTGAAAACAGAAAACTAGAATTCAACCCTCCAAACCTACCTAAGAGCCTGGTGTGTGTGTGCTTCTGTTCCGTTAGTGAGCTG

AGGCCAGAACAGCTGTGCTCAAAAAAGAACCTTCCCAAGCATTGGACTCAATGACGAAATTGTTAGTAATCACCAGAAATGAAAAAATCCCCCTTGGCCA

TGTCACTTGTCTTTGCCTACCCAGCAGCCCCTCCTTCCTGTGAATCATGCCTGCTCTTGGCTGCTGGGTTTGGGGTTCTCTGTTAGGATTTCAGTGGAGC

TGAGTTTCACAGAGAAGTTTGAAAGCCATTGATGAAGTGAAAGTGCATTCTAGAGTAGGAAGGATAGGAAGACATGAAAGGGTTAAAGCTGAGGAGTAAC

AGGAAGTTCTGTTGTTCAGGGCGACAGAGACCTGCAGATGAGCTGCTACTGGAGGGTGTAGGGCAGGGCCGTGAGCTTTTGTCCCTTTCTGTGGATCTTT

CCTGTCCTCCCCTGCTGGAATCTCACTGTTGTCTGTGTTCTTTCAGAAAAGACTTGAGGTCCTCAGCTAGTTAGAAATGCCGTCAGGAAAGGAACTTGAT

AAACACAAGGGGAAGGTCTCCTGTAGGGAACAGAAAGAGGAATCATGGCCAATATCCGTTGTTAAGCTACATCCCATGATTTCAGACTGGGGCCAATAAG

CTGTTAATCAGTACGTGAACTCTGAAAGTAAAACTCTAGTAAAATGATCTTGACCCACAAAAGGTCTGTTCCTTTACATGGATGGGAAAAGCCCTTGGAA

TCTTGCACTCAGTTTTGGGTCATCTGCTGCTAAGAGATCATGTATACACTTAAGACATTAAGCAACCTGAGTCTAAAGGGATTTTAGGAAACACTAAGAA

GATGTCTATTGGTAGTTAAATGGATCACAGAGACACGGGTGAGAGGTGATCTGAAAATATTTCCCACAAGATGGCTTTGGCCACAACCTTTGGTGTTAAG

TAAGTTAAGTATGGGGGCACACATGAAACAGTATGTATTTGGGATTTTGAAGGAATCCTGATATAGATTTCAGAAAAGACCCTACACAAAGTTTAAGCAT

AGTGAATGGAATTTTTCTGTCAACTCATTGTAAAACACAGGGATTGAAGAAAAATCCATTTGCCATTTTTGAATTTTTTTTCTTCTGTATTTCTAGACTT

ATTTGTTTTGAATGCTAGTGGCTTGTCACATAGCCATGTCTGGCCTGGTGTTTACTCTGTAGCATAGGCTGACTTTGAACTTAGAGTAATTTCTCCTACC

TCCGTGTGCTGAGTGCCGAGGCTACAGGTGTGTGCCATCATATCCAACTTTCATGTAAGCTCTTAGCCACTAGCATTACATCGCGTAAAACCACATCAAA

TCGCGTCAAAAGGTGCCTTGCAGACTGTCATGTTGGCCTTTGACCCATGCTACCTCAGACTCTAGAGGAATGTCTACAGTATTTGTGCACAGTCTATGTC

AGTGGCTCAGATCACAAGTGGAAAGCAATCGTTTCCTCATTAAAACTATGTAAAACGACAGCCTTACATAGTTTCCTGTCAACACAAATTTAGGATATAA

TACATTTTAGAAATTTATTATTTTTCAATTATTTTTGGTTTTTTTACTACTTACCTTGTAAAAATACACTTTTCCTTTTGTCATAAGTGCAATCAGCTGA

GTGAGACTTGTCAGTTGTTGTTGCTTTTTTTTTTTCTATCCTCTGTTTCAAAACTCAGGGCCTTAACATTCAAGGAAAGTGCCCTACCACTAACCTATAT

CCCAGACCTCTTAAAAGTCATTTTGAAAAGAAGCAGTATGTTAGTTTGGGGTCAGAACAAGTAATTTTCTGGTTTTGATACCGAGTCTCTACACAGTCCA

AAGTAATGATTCTCAAGCCTCGGGCTCTTACAGGATGGGATTACGGTAGTGTGCCGCCACACCAGCCTATTATCCCGTGTACTGTCTTCTAGACCATTGC

TTTTCATATTCAGTTTTCCAGCCTTTTATGTGTGTTGTAATTCTTTGTGATAATTTGCCTGTGTGTGTATGTTTTTTATTGGTGGTGGGGTTTTTTTTGT

TTGTTTTTAACTAGGAATCCCTTCTTGAGTAATACCAAGTCTTAGAAGCAAGCAGGGGAAATAGAAACTGTCTTTAGACTTGGGTCTTTCTTTCCCTTTC

AGGTAAAATTTAGGGTTCTTCTGGGCACCACTCAGAGATTGTCAGAAAAGCTCTAGAGAGTTCTTAACACTGAACTAATTTTAGTAACTTTTACCTGGAA

GTCCGCAGGCTTAGGGGGAGTAGTGAGGCTCAGTACCCTTCCCATTGGCTTATGTGCCCCACCCCCACCCCCAATCACTGTGGCTGATGGTACAGCTTTG

TCTCACAGCCTTTGGTCCACAGTCTTGTTAAAGACAGGAGCACTGTGAGCACGGATGTTGGCTATGACAGACAGATGCAGCCTGTGAACACGAGAGTAGT

GCAGCAAAAATGATTTTCACCAACACTCTTACTTTCTCTAACAAAGATTTCTTAACCCCATAGAGTTTTGCCTTTATATATTTACAAATGTAATGGCTTG

TCAAACTTACCAAATCACCATAACTGCTTTTTGCATTCATTTCCATAGTGATGATGTTGAATGTGCCTTATTCAAATCAATTGTCTGATTACTATACAAT

AAATCTCTTCAATTTTTCCTGACTGATTTTTTACTAAAATTTCCAAAATAAAGAATTTATGAAAA
Translation
 - UNI13362 - - UNI19380 - MSQSLKSQNTNMSDSGCRDPVGD DSQNVLENDPSINSQTQDTRVTPNNTAEAQPLQPTSDLKEDHHEIGARA

QEHTDTGDRSESPEEPALEKPPLDKAELESSPSSQDTELGHHPHSEHGGGDALDLDPNCSQSDLGGRADAHLESSSVASPEGAGDRGEADEHLESSSAAP

TEGAGDRGEAGQELLAEDSTDGQSLGHSNTGPGNQDSLRRRLPVPE EAGSHEEETELVKEKQEVAQDTLRKTDKKSLWTYG GSVFLGCLIVAVVLSSV

NSYYSSPAQQVPQNPALEAFLAQFGQLKEKFPGQSSFLWQRGRKFLQKHLNASNPSEPATIIFTAAREGKETLKCLSYHVANAYTSSQKVTAVSIDGAER

ALQDSDTVKLLVDLELSDGFENGHKAAVVHHFESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLEASVSPREIEEKVRDLLWAKFTNSESPTSY

SHMDSDKLSGLWSRISHLVLPVQPVRNIEERGCLL
Transcript ENSMUST00000065673
Sequence
GGAAATGAAACCGAGCGCAGAGTAGTTTGGGGCTCCGACAATGGCTTAGCCGCCGACCTCTAGCAAAAGCCTACAGAAAGAGGAGACCTAGACCCCCCAA

ACTGAAGCTCCAGGACTAGGCAGAGCTGCCCGCCTCCGCTCGGGTCACTTCGCACCACCACCTTCCCGCGCGGCCCACTGCGTCCTTCCCTCTTGAGGGT

CCGGGTGGACTCAATCCGGGAGTGCGCGCCCAAAGGGCCGCAGAAATCACCAGGACCCAGGCGGGGCCGGAGCGGGGCCGGCCTCCACGGGGGCGCGCCT

GCCGCCGCGTGCCCGCCGCCGCGCGCGCTCCCGAGCCCGCAGCCGAGACTGTTACCTTCGCGGTCCTCACTGGAGGACGGAGAGTCCCGTAACCCTCGGC

CGCTCGTGGCCGGAGACAGCTGCGGCTGCTGTGAGTGCTGCTCAAGGCGAGCAGACCTCCGCGTCTTCATCTCCTCGGCTTCCTGGGCTCGCCGCTGCCT

CCGTGGTCGAGAGCGAAGGTTGTAAGCGCTTTCTCTCACTTCCTCTCCCGCAGAAGCCGGCCGGAACTTTTCTGGCGGGGTTCGTCTCCCCCCCGGAGAC

CTTTCTTTGGCCGCCCGGGGCTCGAAGTCGCCGTACACTTCTGCCGGCTCCTCTGAAAACCTCACTTCCCGTCGTCCGCGGCGCGACGGGTGAGCTCCGT

ACGCAG - UNI19380 - GTCTTTGAGAAAGGATCCCTCCCCACCCCCACCTCCCCTACGGCACAAACAGAAATCGAG - UNI13362 - GTGTGT

GACGCATTCCCAGACCATCCTGCAAACTCAACACCAGCGACTTCTCTGTGACTGGGTCCAGATAAAGGTCCTTTCAAGACTGACTTCAGTGGATCTACTC

CACCAGGTCTTCCCGACCTTACTACATCACTGCCAAGTGCTATTGGCGAGACTGCCTGCACCAGCAGAAGACTCACCGGATCCATCAGAGCGTCGGTTTT

ACCAGAGCAAAGCAAGAGCCTGTGTGGTTCTGCCTCCCGCTAATACTGGACAGGAAACAGCAACTGGCTTGGACTAGAGGCCTGGCTTTCCTTTGAAGGA

GCTATTCTGTGATCTGTGTTGCTA - UNI13362 - TCACTGTCTATATCCCTTGCTTCTTGCTTCCATGGGAAGCATGAGTCTATTGGAACCTGGGA

CAAGAAGAAACCAAGGTATCTCCACTACAAAACCCAGACACTAAAAAGATGTCCCAAAGTCTGAAGAGCCAGAACACAAACATGAGCGACAGTGGCTGCA

GGGATCCTGTGGGAG ACTCACAAAATGTTTTGGAAAATGATCCATCAATAAACTCTCAAACACAGGACACCAGAGTCACACCGAATAACACTGCAGAAG

CCCAGCCCCTACAGCCCACATCTGATCTTAAAGAAGACCACCATGAAATAGGGGCCAGAGCTCAGGAGCATACAGACACAGGTGACAGGTCAGAAAGTCC

AGAGGAACCAGCGTTAGAGAAACCTCCACTGGATAAAGCAGAGCTGGAGAGCAGCCCGAGTTCTCAGGACACAGAGCTCGGGCATCACCCCCACTCAGAA

CATGGGGGCGGAGACGCCCTAGATCTGGATCCTAACTGCTCTCAAAGCGACTTGGGAGGAAGAGCAGATGCACACCTGGAGAGCAGCTCTGTAGCGTCCC

CAGAGGGAGCAGGTGACAGGGGTGAAGCTGATGAGCACCTGGAGAGCAGCTCTGCAGCCCCCACAGAGGGGGCAGGTGACAGGGGTGAAGCTGGTCAGGA

ACTGCTTGCTGAAGACTCTACCGATGGCCAGAGTCTGGGCCATTCCAACACAGGTCCAGGGAACCAGGATTCACTGAGGAGACGACTGCCTGTGCCCG A

GGCTGGAAGTCATGAAGAGGAGACAGAGTTGGTGAAGGAAAAGCAAGAGGTTGCACAGGATACATTGAGAAAGACTGATAAAAAGAGTCTCTGGACCTAT

G GTTCCGTGTTTCTCGGCTGCCTGATCGTGGCTGTTGTGCTAAGCTCCGTCAACAGCTACTATTCTTCCCCAGCCCAGCAGGTGCCCCAGAACCCGGCT

TTGGAGGCCTTCCTGGCTCAGTTTGGCCAACTGAAGGAGAAATTTCCAGGTCAGAGTTCCTTCCTGTGGCAGCGAGGACGTAAGTTTCTCCAGAAGCACC

TCAATGCCTCGAACCCCAGTGAGCCGGCCACCATCATCTTCACAGCTGCTCGAGAGGGCAAGGAGACCCTCAAGTGCCTGAGCTACCATGTTGCCAACGC

CTACACCTCTTCCCAGAAGGTGACTGCCGTCTCCATAGACGGAGCCGAAAGGGCCCTGCAGGACAGTGACACAGTCAAGCTGCTGGTTGACTTGGAGCTT

AGCGATGGGTTTGAGAATGGCCACAAGGCTGCTGTGGTCCACCACTTCGAATCCCTTCCTGCCGGCTCCACCCTGATCTTCTACAAGTACTGTGACCATG

AGAACGCCGCCTTTAAAGATGTGGCACTTGTCCTGACAGTCCTGCTGGAGGAGGAAACGTTAGAAGCAAGTGTAAGCCCCAGGGAAATAGAAGAAAAGGT

GAGGGATTTACTCTGGGCTAAGTTCACCAACTCTGAGAGCCCCACCTCCTACAGCCACATGGACTCAGACAAACTGAGTGGGCTCTGGAGCCGCATCTCC

CACCTGGTGCTGCCCGTCCAGCCCGTCAGGAACATAGAAGAGCGAGGCTGCCTTTTGTGAAGCCAGTCACAGAGGTGACATGGAAGGGCCATGTCTCAGG

GCTCTGTCCCGCTAGGAGGTGACTGGCATGTGAGAGGAAACAGCTGGGAGGCCGTCACTGTGTTAGAAAAGAAGCTTTTTTTCTTTGACTTTTAAAAAAT

CTTTCTAGTCTGAACTTTGATAAAACTAACAATTGGCCTG
Translation
 - UNI19380 -  - UNI13362 -  - UNI13362 - MSQSLKSQNTNMSDSGCRDPVGD DSQNVLENDPSINSQTQDTRVTPNNTAEAQPLQP

TSDLKEDHHEIGARAQEHTDTGDRSESPEEPALEKPPLDKAELESSPSSQDTELGHHPHSEHGGGDALDLDPNCSQSDLGGRADAHLESSSVASPEGAGD

RGEADEHLESSSAAPTEGAGDRGEAGQELLAEDSTDGQSLGHSNTGPGNQDSLRRRLPVPE EAGSHEEETELVKEKQEVAQDTLRKTDKKSLWTYG GS

VFLGCLIVAVVLSSVNSYYSSPAQQVPQNPALEAFLAQFGQLKEKFPGQSSFLWQRGRKFLQKHLNASNPSEPATIIFTAAREGKETLKCLSYHVANAYT

SSQKVTAVSIDGAERALQDSDTVKLLVDLELSDGFENGHKAAVVHHFESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLEASVSPREIEEKVRD

LLWAKFTNSESPTSYSHMDSDKLSGLWSRISHLVLPVQPVRNIEERGCLL
Transcript ENSMUST00000111757
Sequence
GGCTTTCCTTTGAAGGAGCTATTCTGTGATCTGTGTTGCTA - UNI13362 - TCACTGTCTATATCCCTTGCTTCTTGCTTCCATGGGAAGCATGAG

TCTATTGGAACCTGGGACAAGAAGAAACCAAGGTATCTCCACTACAAAACCCAGACACTAAAAAGATGTCCCAAAGTCTGAAGAGCCAGAACACAAACAT

GAGCGACAGTGGCTGCAGGGATCCTGTGGGAG ACTCACAAAATGTTTTGGAAAATGATCCATCAATAAACTCTCAAACACAGGACACCAGAGTCACACC

GAATAACACTGCAGAAGCCCAGCCCCTACAGCCCACATCTGATCTTAAAGAAGACCACCATGAAATAGGGGCCAGAGCTCAGGAGCATACAGACACAGGT

GACAGGTCAGAAAGTCCAGAGGAACCAGCGTTAGAGAAACCTCCACTGGATAAAGCAGAGCTGGAGAGCAGCCCGAGTTCTCAGGACACAGAGCTCGGGC

ATCACCCCCACTCAGAACATGGGGGCGGAGACGCCCTAGATCTGGATCCTAACTGCTCTCAAAGCGACTTGGGAGGAAGAGCAGATGCACACCTGGAGAG

CAGCTCTGTAGCGTCCCCAGAGGGAGCAGGTGACAGGGGTGAAGCTGATGAGCACCTGGAGAGCAGCTCTGCAGCCCCCACAGAGGGGGCAGGTGACAGG

GGTGAAGCTGGTCAGGAACTGCTTGCTGAAGACTCTACCGATGGCCAGAGTCTGGGCCATTCCAACACAGGTCCAGGGAACCAGGATTCACTGAGGAGAC

GACTGCCTGTGCCCG AGGCTGGAAGTCATGAAGAGGAGACAGAGTTGGTGAAGGAAAAGCAAGAGGTTGCACAGGATACATTGAGAAAGACTGATAAAA

AGAGTCTCTGGACCTATG GTTCCGTGTTTCTCGGCTGCCTGATCGTGGCTGTTGTGCTAAGCTCCGTCAACAGCTACTATTCTTCCCCAGCCCAGCAGG

TGCCCCAGAACCCGGCTTTGGAGGCCTTCCTGGCTCAGTTTGGCCAACTGAAGGAGAAATTTCCAGGTCAGAGTTCCTTCCTGTGGCAGCGAGGACGTAA

GTTTCTCCAGAAGCACCTCAATGCCTCGAACCCCAGTGAGCCGGCCACCATCATCTTCACAGCTGCTCGAGAGGGCAAGGAGACCCTCAAGTGCCTGAGC

TACCATGTTGCCAACGCCTACACCTCTTCCCAGAAGGTGACTGCCGTCTCCATAGACGGAGCCGAAAGGGCCCTGCAGGACAGTGACACAGTCAAGCTGC

TGGTTGACTTGGAGCTTAGCGATGGGTTTGAGAATGGCCACAAGGCTGCTGTGGTCCACCACTTCGAATCCCTTCCTGCCGGCTCCACCCTGATCTTCTA

CAAGTACTGTGACCATGAGAACGCCGCCTTTAAAGATGTGGCACTTGTCCTGACAGTCCTGCTGGAGGAGGAAACGTTAGAAGCAAGTGTAAGCCCCAGG

GAAATAGAAGAAAAGGTGAGGGATTTACTCTGGGCTAAGTTCACCAACTCTGAGAGCCCCACCTCCTACAGCCACATGGACTCAGACAAACTGAGTGGGC

TCTGGAGCCGCATCTCCCACCTGGTGCTGCCCGTCCAGCCCGTCAGGAACATAGAAGAGCGAGGCTGCCTTTTGTGAAGCCAGTCACAGAGGTGACATGG

AAGGGCCATGTCTCAGGGCTCTGTCCCGCTAGGAGGTGACTGGCATGTGAGAGGAAACAGCTGGGAGGCCGTCACTGTGTTAGAAAAGAAGCTTTTTTTC

TTTGACTTTTAAAAAATCTTTCTAGTCTGAACTTTGATAAAACTAACAATTGGCCTGATGTTTTTCTTTGTTTTTTAAAGCCAATCAGGGTTAAAATACA

ACATGATGTATTGTTTAAGTGTCCAGCACATCAGTAGAATAGAATTGTTTTGCACAGGAAGATCTGATTCTCCGGGGAACTGCAGCCCCACTGCTGCCTG

CAAGGACTCTCACCAGCCTCTAGGGCAGTGCTTGGACCTGGACGAGGTGTCATGTAAATGATTTTAGAGAACTCTTCTACTACATATTAAGTGCTTTTTA

ATATTCACTTTTTTTTGTTGTTTTTTTCTGAGGCAGGGTTTCTCTGTGTAGCTCTGGCTGTCCTGGAACTCACTTTGTAGACCAGGCTGGCCTCGAACTC

AGAAATCTGCCTGCCTCTGCCTCCTAAGTGCTGGGGTTAAAGGCGTGCAGCATCACTGCCTGGCCTTAATACTCACTTTAATAATACACTTGTGGGTTGA

TTGTGTCTTACACAGATTTGCACTTTGAGTAGGTGAAAACAGAAAACTAGAATTCAACCCTCCAAACCTACCTAAGAGCCTGGTGTGTGTGTGCTTCTGT

TCCGTTAGTGAGCTGAGGCCAGAACAGCTGTGCTCAAAAAAGAACCTTCCCAAGCATTGGACTCAATGACGAAATTGTTAGTAATCACCAGAAATGAAAA

AATCCCCCTTGGCCATGTCACTTGTCTTTGCCTACCCAGCAGCCCCTCCTTCCTGTGAATCATGCCTGCTCTTGGCTGCTGGGTTTGGGGTTCTCTGTTA

GGATTTCAGTGGAGCTGAGTTTCACAGAGAAGTTTGAAAGCCATTGATGAAGTGAAAGTGCATTCTAGAGTAGGAAGGATAGGAAGACATGAAAGGGTTA

AAGCTGAGGAGTAACAGGAAGTTCTGTTGTTCAGGGCGACAGAGACCTGCAGATGAGCTGCTACTGGAGGGTGTAGGGCAGGGCCGTGAGCTTTTGTCCC

TTTCTGTGGATCTTTCCTGTCCTCCCCTGCTGGAATCTCACTGTTGTCTGTGTTCTTTCAGAAAAGACTTGAGGTCCTCAGCTAGTTAGAAATGCCGTCA

GGAAAGGAACTTGATAAACACAAGGGGAAGGTCTCCTGTAGGGAACAGAAAGAGGAATCATGGCCAATATCCGTTGTTAAGCTACATCCCATGATTTCAG

ACTGGGGCCAATAAGCTGTTAATCAGTACGTGAACTCTGAAAGTAAAACTCTAGTAAAATGATCTTGACCCACAAAAGGTCTGTTCCTTTACATGGATGG

GAAAAGCCCTTGGAATCTTGCACTCAGTTTTGGGTCATCTGCTGCTAAGAGATCATGTATACACTTAAGACATTAAGCAACCTGAGTCTAAAGGGATTTT

AGGAAACACTAAGAAGATGTCTATTGGTAGTTAAATGGATCACAGAGACACGGGTGAGAGGTGATCTGAAAATATTTCCCACAAGATGGCTTTGGCCACA

ACCTTTGGTGTTAAGTAAGTTAAGTATGGGGGCACACATGAAACAGTATGTATTTGGGATTTTGAAGGAATCCTGATATAGATTTCAGAAAAGACCCTAC

ACAAAGTTTAAGCATAGTGAATGGAATTTTTCTGTCAACTCATTGTAAAACACAGGGATTGAAGAAAAATCCATTTGCCATTTTTGAATTTTTTTTCTTC

TGTATTTCTAGACTTATTTGTTTTGAATGCTAGTGGCTTGTCACATAGCCATGTCTGGCCTGGTGTTTACTCTGTAGCATAGGCTGACTTTGAACTTAGA

GTAATTTCTCCTACCTCCGTGTGCTGAGTGCCGAGGCTACAGGTGTGTGCCATCATATCCAACTTTCATGTAAGCTCTTAGCCACTAGCATTACATCGCG

TAAAACCACATCAAATCGCGTCAAAAGGTGCCTTGCAGACTGTCATGTTGGCCTTTGACCCATGCTACCTCAGACTCTAGAGGAATGTCTACAGTATTTG

TGCACAGTCTATGTCAGTGGCTCAGATCACAAGTGGAAAGCAATCGTTTCCTCATTAAAACTATGTAAAACGACAGCCTTACATAGTTTCCTGTCAACAC

AAATTTAGGATATAATACATTTTAGAAATTTATTATTTTTCAATTATTTTTGGTTTTTTTACTACTTACCTTGTAAAAATACACTTTTCCTTTTGTCATA

AGTGCAATCAGCTGAGTGAGACTTGTCAGTTGTTGTTGCTTTTTTTTTTTCTATCCTCTGTTTCAAAACTCAGGGCCTTAACATTCAAGGAAAGTGCCCT

ACCACTAACCTATATCCCAGACCTCTTAAAAGTCATTTTGAAAAGAAGCAGTATGTTAGTTTGGGGTCAGAACAAGTAATTTTCTGGTTTTGATACCGAG

TCTCTACACAGTCCAAAGTAATGATTCTCAAGCCTCGGGCTCTTACAGGATGGGATTACGGTAGTGTGCCGCCACACCAGCCTATTATCCCGTGTACTGT

CTTCTAGACCATTGCTTTTCATATTCAGTTTTCCAGCCTTTTATGTGTGTTGTAATTCTTTGTGATAATTTGCCTGTGTGTGTATGTTTTTTATTGGTGG

TGGGGTTTTTTTTGTTTGTTTTTAACTAGGAATCCCTTCTTGAGTAATACCAAGTCTTAGAAGCAAGCAGGGGAAATAGAAACTGTCTTTAGACTTGGGT

CTTTCTTTCCCTTTCAGGTAAAATTTAGGGTTCTTCTGGGCACCACTCAGAGATTGTCAGAAAAGCTCTAGAGAGTTCTTAACACTGAACTAATTTTAGT

AACTTTTACCTGGAAGTCCGCAGGCTTAGGGGGAGTAGTGAGGCTCAGTACCCTTCCCATTGGCTTATGTGCCCCACCCCCACCCCCAATCACTGTGGCT

GATGGTACAGCTTTGTCTCACAGCCTTTGGTCCACAGTCTTGTTAAAGACAGGAGCACTGTGAGCACGGATGTTGGCTATGACAGACAGATGCAGCCTGT

GAACACGAGAGTAGTGCAGCAAAAATGATTTTCACCAACACTCTTACTTTCTCTAACAAAGATTTCTTAACCCCATAGAGTTTTGCCTTTATATATTTAC

AAATGTAATGGCTTGTCAAACTTACCAAATCACCATAACTGCTTTTTGCATTCATTTCCATAGTGATGATGTTGAATGTGCCTTATTCAAATCAATTGTC

TGATTACTATACAATAAATCTCTTCAATTTTTCCTGACTGATTTTTTACTAAAATTTCCAAAATAAAGAATTTATG
Translation
 - UNI13362 - MSQSLKSQNTNMSDSGCRDPVGD DSQNVLENDPSINSQTQDTRVTPNNTAEAQPLQPTSDLKEDHHEIGARAQEHTDTGDRSESP

EEPALEKPPLDKAELESSPSSQDTELGHHPHSEHGGGDALDLDPNCSQSDLGGRADAHLESSSVASPEGAGDRGEADEHLESSSAAPTEGAGDRGEAGQE

LLAEDSTDGQSLGHSNTGPGNQDSLRRRLPVPE EAGSHEEETELVKEKQEVAQDTLRKTDKKSLWTYG GSVFLGCLIVAVVLSSVNSYYSSPAQQVPQ

NPALEAFLAQFGQLKEKFPGQSSFLWQRGRKFLQKHLNASNPSEPATIIFTAAREGKETLKCLSYHVANAYTSSQKVTAVSIDGAERALQDSDTVKLLVD

LELSDGFENGHKAAVVHHFESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLEASVSPREIEEKVRDLLWAKFTNSESPTSYSHMDSDKLSGLWS

RISHLVLPVQPVRNIEERGCLL

For any suggestions or comments, please send an email to unitrap@crg.es