Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000050567 (Maml1)
Chromosomal location
Chr 11: 50069139 - 50105818 (-)
Description
mastermind like 1 (Drosophila) Gene [Source:MGI (curated);Acc:Maml1-001]
RefSeq_peptide
NP_780543.2 
UniGene
Mm.51116 Mm.408389 Mm.473242 
MGI
MGI:1890504 
Uniprot/SWISSPROT
Q6T264 
Uniprot/SPTREMBL
B0QZS2 
Human Ortholog
ENSG00000161021 (MAML1)
Omim not available
UniTrap UNI36343
Vector Insertion
Chr 11: 50079096 - 50105819
Public Clones IST11842F2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33913
Vector Insertion
Chr 11: 50069138 - 50074576
Public Clones IST12788H6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102771
Sequence
GCGGCGGCAGCGGCGCGGAAAACAATGGGGCAGGGGTATAGCGGACAGGCCGAAGCCTGAGGCGGGCGGTGTTCCCCGGCCTGGAATCGGGCCGAGCGGG

GCCGGAGGAAGACCCGCCGCCGCGCCCGAGCCCGCTCCACAGCCCGGCCGGACATGGCGCGGGCGTGAGGCGGATCCGGGCCGTCAGAAGCGGAGGAACC

CGAAGTGGCAGCCGGCGCCGGGAGGCCCGGGCCCGGCCAGTGCCGCCCGCGGCCCATGGTGCTACCCACCTGCCCCATGGCGGAGTTCGCGCTGCCGCGG

CACAGCGCGGTCATGGAGCGCCTCCGCCGGCGCATCGAACTGTGCCGGCGCCACCACAGCACCTGTGAGGCCCGCTACGAGGCTGTGTCTCCCGAGCGCC

TGGAGCTCGAGCGCCAGCACACCTTTGCCCTGCACCAGCGCTGCATCCAGGCCAAGGCCAAGCGCGCCGGCAAGCACCGGCAGCCGCCGGCCGCCGCCAC

GGCCCCGGTTGCCGCTCCGGCCCCCGCCTCGGCCCCGGCGGCCGCGCGCCTGGACGCAGCGGACGGCCCGGAGCACGGCCGCCCGGTCGCG - UNI363

43 - CATCTTCATGATACAGTGAAGAGGAGTCTTGACAGTGCTGCCTCCCCTCAGAATGGCGATCAACCAAATGGCTACGGAGACTTGTTTCCTGGGCA

TAAGAAGACACGCCGGGAGGCCCCTCTGGGGGTCAGTGTGTCTGCCAATGGGCTTCCTCCTGCCTCGCCCCTGGGCCAGCCCGACAAGCCTTCAGGGGGA

GACACCCTGCAGACCGCTGGGAAGCACTCTCTGGGGCTCGATCCCATCAACAAGAAGTGTCTGGCAGACTCAGGCATCCACCTGAATGGAGGCAGCAACT

CCAGTGAGCCCTTTCCTCTAAGCCTGAGTAAAGAACTCAAGCAGGAGCCAGTGGACGACCTGCCGTGCATGATCGCGGGCGCTGGAGGCTCCGTAGCTCA

GAGCAACCTCATGCCGGACCTCAACCTTAATGAGCAGGAGTGGAAGGAGCTCATCGAGGAGCTCAACAGGTCAGTGCCCGACGAAGACATGAAGGACCTG

TTTACGGAGGACTTTGAGGAGAAGAAGGATCCAGAGCCTCCTGGCTCTGCCACACAAACCCCCCTGGCCCAGGACATTAATATTAAGACTGAGTTCTCTC

CAGCAGCTTTTGAGCAGGAGCAGTTAGGTTCTCCACAAGTAAGGGCTGGGTCTGCAGGCCAGACCTTCCTAGGAGCCTCATCTGCCCCTGTGGGCACAGA

TTCTCCAAGCCTTGGGAGCTCTCAGACTCTGTTTCACACAACTAGTCAACCTGGGGTGGATAATTCCAGTCCAAACCTGATGCCGGCATCAGCCCAGGCT

CAAAGTGCACAAAGAGCCCTCACGAGTGTGGTATTACCTAGCCAGGGCCCAGGCGGGGCCTCGGAGCTGTCCTCTGCTCACCAGCTCCAGCAGATAGCTG

CCAAGCAGAAGCGCGAGCAGATGTTGCAGAATCCCCAGCAAGCTGCCCCAGCACCCGGCCCAGGCCAGCTGGCCACGTGGCAGCAGGCAGGGCCCTCCCA

CAGTCCCTTAGATGTTCCTTATCCCATGGAGAAGCCTGCCAGCCCTTCTGGCTACAAGCAAGACTTTACCAACTCAAAACTGCTCATGATGCCCGGTGTG

AACAAGAGTTCTCCTCGGCCAGGAGGCCCCTACCTCCAACCTAGCCACTCCAACCTGCTGAGTCACCAGTCACCAAGTAACTTGAATCAGAACCCCGTGA

ATAACCAAGGGTCTGTGCTAGACTATGGCAATACAAAGCCCCTTTCTCATTACAAAGCAGACTGTGGCCAAGGTGGTCCTGGGTCTGGCCAGAACAAACC

AGCTTTGATGGCATATCTTCCCCAGCAGCTGCCCCATCTGAGTAACGAGCAGAACTCCTTGTTTCTGATGAAACCAAAGTCAGGAAACATGCCCTTCCGG

TCATTGGTTCCACCTGGCCAG - UNI36343 - GAGCAGAACCCTTCCAGTGTCCCTGTAGCTGCCCCAGCTGCCAGTGTGGGAACCCAGCCTACTGT

GTCTGTGGCCAGCACTCACAACAGCTCGCCATACCTCAGCAGCCAGCAGCAGGCAGCTGTGATGAAGCAGCACCAGCTGCTCCTGGACCAGCAGAAGCAG

AGGGAGCAGCAGCAGCAGCAGCTGCAGCAGCAGCAGTTCCTGCAGAGGCAGCACCTCCTGGCTGAGCAG - UNI33913 - GAGAAACAACAGTTTCA

GCGTCATCTGACCCGCCCACCCCCCCAGTACCAAGACCCAACACAAAGCACCTTCCCACAACAGGTTGGACAGTTCACAG - UNI33913 - GACCTT

CTGCTGCTGTGCCTGGGATGAACAACTTGGGTCCGTCCAACTCCAGCTGTCCTCGAGTGTTCCCTCAGCCTGGGACTCTGATGTCCATGGGCCCTGGACA

TGCCCCTGTCTCCTCTCTCCCCTCCAGCTCAGGCCAGCAGGACCGTGGAGTGGCCCAGTTTACTGGGTCCCAGAGTTTGCCTCAGAACAGCCTTTATGGC

ATGGCATCTGGCCTAGCCCAGATAGTTGCCCAGCCCCCACCACAGGCTACCAGCACACATGCCCACATTCCACGGCAGACCAACGTGGGCCAGAACGCCT

CCACCTCGGCTGCATATGGACAGAACTCTCTGGGGAGTGCCAGTCTTTCCCAGCAGCACAGTAAGGGAACCCTGCCTCCTGGTTTAACAAAGCCACAAGT

CCCAAGGGTGTCAGCAGCCATGGGAAGCCAGAATGCCTCGTGGCAGCATCAGGGAATGCCAAACCTGAGCAGCCAGACGTCTGGGAACAGCAGTGTGAAC

CCCTTCACTGCAGCTCCCAGTTTCCACATACAGCAAGCCCACCTGAAACTAGCTGGCCAGCAGTTCTCCCAAGCCATGCCCAGCAGGCCCATGGCGCCTC

TGAGTTCAGCAGGTGCAGCAGGGCCCATGCTGCCCCCAGTGAGTGCACAGCAGAGGAACAGTGCCCCTGCATCTGCACCTCCCCAAGCAGCCCCGCAGCA

GGGCTTGCCTGGCTTAAGTCCTTCGGGGCCCGAGCTGGGGGCCTTCGGCCAGAGCCCCACCTCCCAGATGAGCGGCCGGCCAGGGCTACACTGTGCGCAG

GCTTACCCTGTGAGGACCATGGGCCAAGAGCTGCCCTTTGCCTACAGCGGGCAGCCAGGTAGCAGTGGTCTGTCCAGTGTGGCTGGACACACTGACCTGA

TCGACTCGCTGCTGAAGAACAGGACTTCTGAGGAGTGGATCAATGAATTGGATGATCTTTTAGGGTCACAGTAACAGAGACGACTGTGGTGTTTTCAGTG

TTTAGTCATCTTATATTTTTGTTCTCAGATTCAAGAAAGCAACTACTTTGGACCAAAAGCCATGGCCCAGAGAATTGGGCCAGTAGAACCTAAGCCACAC

CTGAGGCCAGCTCTGGTCAGTCTCTGATGGTCCATTGGGCTGGCTCAGCACATTGACATCACTAACTAGGGTTGGGATAGCTTCCTACCCAGATGACCAA

AAAGCCAGTGGAAACAGTTAAGCCCCTCCATATCAGGCTTACCAAGAATATGTGCCCTGTTTTTACCCGAGATTTCTCCACTTGCCTCAAGGCTGGGAAC

AAACTTCTGTTGGAATTTTAAATAGGATTATTTGCATTTTATAGCATAGGCATAATTTTTTTAATTTAAGATTTTTAAGCAGATTAGGACAGGTGGTGGT

TGTATTGTAAGTGGCACTGGGAACCCAGGGTTTCCTTGGGAGTTGAGGCCTTCTTTATTCCTGCTCTGTCAGCTTTCATGGTCACTGGAAATCACTGCCA

CAGTACAGGCTGTGACTGCAGATGCCAAAATGATTAGGATGCCACAGATGGTACATCTAGTGGTCCAGATAGGATCCCTCCTGAAATCTCCTACTTCTTG

TCTGCCACTCACTCTTGAGGACACTGGGCCCCCATGGAATCCCTCCATGCCCTAGCATGGCTAAATGCTGAAGGTGGAGGTTCAGCATGTCTGACAACCC

GGATGTACACCGTAGAAGTGCCATTCAGTTGTACACACATCTTTCCTCCTCCACATCATCCCCACGACCCTTCTAACTCCTGGCCTCTTCCAGCCAAAAC

GGGAAAAGTGGCTGACTTCACTGCATTAGAAGAGGAAAAGTCCAACTCCTTAGGGAGTCTGAGCCTGGCACGGGCTTGGGGAAAGAAGGCTGCAGGCAGC

CTGCCGTCTAGGCATCACTTTATTTTTTATCCTCCAGACTTCTGCTCCTCCCACAGCTGATGACTTGCACTTTTAAAGTGGTTTTATAACACTAACCCGT

CCTTGCTAAAGATTGAAGTAGGTTCTCTTAAAAGGTCTATTGATGGACATGTCTGAGCAGAGAAACCGTGGAATAGAATATGGTGCGTGGGCTGCTAACA

GCAAGAGGGAGCACTTGTCTTCATCACAAGCAAGATGATGAGCACAGAGTGAGACCTTTAACAGGATGGCGGAGGGAAAGGTGTTTGCTGGAGTGACTTC

CGTGCAGAGTGGTCTATAGAGAAACTACAGCTCTGCCCATTGTCCTGGGGTCCTGGAACTTCGTCCAGTGTTAAGAACTGAGCCAAGGAGAAGCACGAGC

AGCCTTCGCACCTGGAGGGTCAGAACGTGCACACACTGCTAACTAGTTTGCACCGGCAGTGCCTTTTTCACTGAGGGCACCTGTGCTCTCAGGTCCTTGT

CCCTCATAGCCATTTCTCCTGCCATGTCCCCCCCTCCCCCAGCCCCCAGAAACTCAGTTCAGCTCTCAGAGAAGCAGGTGAATCATAAAGTCAGTGAAGA

CGCCGCCCTCTGATTCTCCCCACTGTAGGGGGAAGGAAGGGAGTGACTTCAGTGGGTTCTCTACCAAAAACAGGGCTAAGGGCTGGAGATGGATCCCCGT

TCCTTGTCCAGCCTCCTGCTACCGCTGCCCACCTCCTGCCTCCATTGCCCAGGCCACACTAGTTGGCCCCAGCACTCTACCTTAGGCCCAGGCTGGCCAC

AGGCAGTGGGCAGCTCACTTGCTGCAGTGTCATAGCAATAAAATGTGATTCTTGGGGTCTGCCCAGAGCTGCCCATGGCTTTATTTATGAGTGTGGCTTT

GAGGAGTTGGGAAGAGGTAACCCACTTCTCTCCCATCTTCTCCGAGCCATGACTCAAGAAGAAAAGGGTGCTCGGACTCTCTTATACACATGTGCTTTGT

GTAAATAAATGTTTACAATTTTATATTGAAGATGGAATAAGTGTTAGAGCGTCCAACTGTATATTTTTTACTTTTATAGATTTTAAAACTGATCCTTTAT

ATGTGTTTGGAGCTATGATAAGTTTTATGGCAAGCAGTTGGTATTGTTAACTTTTTATGATCATCAAAAGTACATAAAAGTCCTATTAATCCCCTTACTC

TGCTTCCCTTAGCTCTGGTATACACCAAAAAGAAATCTTTACTTTCCTTGTGTTATAAAAATAATAAAAATATTTTACTAGTATGG
Translation
 - UNI36343 - MIAGAGGSVAQSNLMPDLNLNEQEWKELIEELNRSVPDEDMKDLFTEDFEEKKDPEPPGSATQTPLAQDINIKTEFSPAAFEQEQL

GSPQVRAGSAGQTFLGASSAPVGTDSPSLGSSQTLFHTTSQPGVDNSSPNLMPASAQAQSAQRALTSVVLPSQGPGGASELSSAHQLQQIAAKQKREQML

QNPQQAAPAPGPGQLATWQQAGPSHSPLDVPYPMEKPASPSGYKQDFTNSKLLMMPGVNKSSPRPGGPYLQPSHSNLLSHQSPSNLNQNPVNNQGSVLDY

GNTKPLSHYKADCGQGGPGSGQNKPALMAYLPQQLPHLSNEQNSLFLMKPKSGNMPFRSLVPPGQ - UNI36343 - EQNPSSVPVAAPAASVGTQPT

VSVASTHNSSPYLSSQQQAAVMKQHQLLLDQQKQREQQQQQLQQQQFLQRQHLLAEQ - UNI33913 - EKQQFQRHLTRPPPQYQDPTQSTFPQQVG

QFTG - UNI33913 - GPSAAVPGMNNLGPSNSSCPRVFPQPGTLMSMGPGHAPVSSLPSSSGQQDRGVAQFTGSQSLPQNSLYGMASGLAQIVAQPP

PQATSTHAHIPRQTNVGQNASTSAAYGQNSLGSASLSQQHSKGTLPPGLTKPQVPRVSAAMGSQNASWQHQGMPNLSSQTSGNSSVNPFTAAPSFHIQQA

HLKLAGQQFSQAMPSRPMAPLSSAGAAGPMLPPVSAQQRNSAPASAPPQAAPQQGLPGLSPSGPELGAFGQSPTSQMSGRPGLHCAQAYPVRTMGQELPF

AYSGQPGSSGLSSVAGHTDLIDSLLKNRTSEEWINELDDLLGSQ
Transcript ENSMUST00000059458
Sequence
GCGGCGGCAGCGGCGCGGAAAACAATGGGGCAGGGGTATAGCGGACAGGCCGAAGCCTGAGGCGGGCGGTGTTCCCCGGCCTGGAATCGGGCCGAGCGGG

GCCGGAGGAAGACCCGCCGCCGCGCCCGAGCCCGCTCCACAGCCCGGCCGGACATGGCGCGGGCGTGAGGCGGATCCGGGCCGTCAGAAGCGGAGGAACC

CGAAGTGGCAGCCGGCGCCGGGAGGCCCGGGCCCGGCCAGTGCCGCCCGCGGCCCATGGTGCTACCCACCTGCCCCATGGCGGAGTTCGCGCTGCCGCGG

CACAGCGCGGTCATGGAGCGCCTCCGCCGGCGCATCGAACTGTGCCGGCGCCACCACAGCACCTGTGAGGCCCGCTACGAGGCTGTGTCTCCCGAGCGCC

TGGAGCTCGAGCGCCAGCACACCTTTGCCCTGCACCAGCGCTGCATCCAGGCCAAGGCCAAGCGCGCCGGCAAGCACCGGCAGCCGCCGGCCGCCGCCAC

GGCCCCGGTTGCCGCTCCGGCCCCCGCCTCGGCCCCGGCGGCCGCGCGCCTGGACGCAGCGGACGGCCCGGAGCACGGCCGCCCGGTCGCG - UNI363

43 - CATCTTCATGATACAGTGAAGAGGAGTCTTGACAGTGCTGCCTCCCCTCAGAATGGCGATCAACCAAATGGCTACGGAGACTTGTTTCCTGGGCA

TAAGAAGACACGCCGGGAGGCCCCTCTGGGGGTCAGTGTGTCTGCCAATGGGCTTCCTCCTGCCTCGCCCCTGGGCCAGCCCGACAAGCCTTCAGGGGGA

GACACCCTGCAGACCGCTGGGAAGCACTCTCTGGGGCTCGATCCCATCAACAAGAAGTGTCTGGCAGACTCAGGCATCCACCTGAATGGAGGCAGCAACT

CCAGTGAGCCCTTTCCTCTAAGCCTGAGTAAAGAACTCAAGCAGGAGCCAGTGGACGACCTGCCGTGCATGATCGCGGGCGCTGGAGGCTCCGTAGCTCA

GAGCAACCTCATGCCGGACCTCAACCTTAATGAGCAGGAGTGGAAGGAGCTCATCGAGGAGCTCAACAGGTCAGTGCCCGACGAAGACATGAAGGACCTG

TTTACGGAGGACTTTGAGGAGAAGAAGGATCCAGAGCCTCCTGGCTCTGCCACACAAACCCCCCTGGCCCAGGACATTAATATTAAGACTGAGTTCTCTC

CAGCAGCTTTTGAGCAGGAGCAGTTAGGTTCTCCACAAGTAAGGGCTGGGTCTGCAGGCCAGACCTTCCTAGGAGCCTCATCTGCCCCTGTGGGCACAGA

TTCTCCAAGCCTTGGGAGCTCTCAGACTCTGTTTCACACAACTAGTCAACCTGGGGTGGATAATTCCAGTCCAAACCTGATGCCGGCATCAGCCCAGGCT

CAAAGTGCACAAAGAGCCCTCACGAGTGTGGTATTACCTAGCCAGGGCCCAGGCGGGGCCTCGGAGCTGTCCTCTGCTCACCAGCTCCAGCAGATAGCTG

CCAAGCAGAAGCGCGAGCAGATGTTGCAGAATCCCCAGCAAGCTGCCCCAGCACCCGGCCCAGGCCAGCTGGCCACGTGGCAGCAGGCAGGGCCCTCCCA

CAGTCCCTTAGATGTTCCTTATCCCATGGAGAAGCCTGCCAGCCCTTCTGGCTACAAGCAAGACTTTACCAACTCAAAACTGCTCATGATGCCCGGTGTG

AACAAGAGTTCTCCTCGGCCAGGAGGCCCCTACCTCCAACCTAGCCACTCCAACCTGCTGAGTCACCAGTCACCAAGTAACTTGAATCAGAACCCCGTGA

ATAACCAAGGGTCTGTGCTAGACTATGGCAATACAAAGCCCCTTTCTCATTACAAAGCAGACTGTGGCCAAGGTGGTCCTGGGTCTGGCCAGAACAAACC

AGCTTTGATGGCATATCTTCCCCAGCAGCTGCCCCATCTGAGTAACGAGCAGAACTCCTTGTTTCTGATGAAACCAAAGTCAGGAAACATGCCCTTCCGG

TCATTGGTTCCACCTGGCCAG - UNI36343 - GAGCAGAACCCTTCCAGTGTCCCTGTAGCTGCCCCAGCTGCCAGTGTGGGAACCCAGCCTACTGT

GTCTGTGGCCAGCACTCACAACAGCTCGCCATACCTCAGCAGCCAGCAGCAGGCAGCTGTGATGAAGCAGCACCAGCTGCTCCTGGACCAGCAGAAGCAG

AGGGAGCAGCAGCAGCAGCAGCTGCAGCAGCAGCAGTTCCTGCAGAGGCAGCACCTCCTGGCTGAGCAG - UNI33913 - GAGAAACAACAGTTTCA

GCGTCATCTGACCCGCCCACCCCCCCAGTACCAAGACCCAACACAAAGCACCTTCCCACAACAGGTTGGACAGTTCACAG - UNI33913 - GACCTT

CTGCTGCTGTGCCTGGGATGAACAACTTGGGTCCGTCCAACTCCAGCTGTCCTCGAGTGTTCCCTCAGCCTGGGACTCTGATGTCCATGGGCCCTGGACA

TGCCCCTGTCTCCTCTCTCCCCTCCAGCTCAGGCCAGCAGGACCGTGGAGTGGCCCAGTTTACTGGGTCCCAGAGTTTGCCTCAGAACAGCCTTTATGGC

ATGGCATCTGGCCTAGCCCAGATAGTTGCCCAGCCCCCACCACAGGCTACCAGCACACATGCCCACATTCCACGGCAGACCAACGTGGGCCAGAACGCCT

CCACCTCGGCTGCATATGGACAGAACTCTCTGGGGAGTGCCAGTCTTTCCCAGCAGCACAGTAAGGGAACCCTGCCTCCTGGTTTAACAAAGCCACAAGT

CCCAAGGGTGTCAGCAGCCATGGGAAGCCAGAATGCCTCGTGGCAGCATCAGGGAATGCCAAACCTGAGCAGCCAGACGTCTGGGAACAGCAGTGTGAAC

CCCTTCACTGCAGCTCCCAGTTTCCACATACAGCAAGCCCACCTGAAACTAGCTGGCCAGCAGTTCTCCCAAGCCATGCCCAGCAGGCCCATGGCGCCTC

TGAGTTCAGCAGGTGCAGCAGGGCCCATGCTGCCCCCAGTGAGTGCACAGCAGAGGAACAGTGCCCCTGCATCTGCACCTCCCCAAGCAGCCCCGCAGCA

GGGCTTGCCTGGCTTAAGTCCTTCGGGGCCCGAGCTGGGGGCCTTCGGCCAGAGCCCCACCTCCCAGATGAGCGGCCGGCCAGGGCTACACTGTGCGCAG

GCTTACCCTGTGAGGACCATGGGCCAAGAGCTGCCCTTTGCCTACAGCGGGCAGCCAGGTAGCAGTGGTCTGTCCAGTGTGGCTGGACACACTGACCTGA

TCGACTCGCTGCTGAAGAACAGGACTTCTGAGGAGTGGATCAATGAATTGGATGATCTTTTAGGGTCACAGTAACAGAGACGACTGTGGTGTTTTCAGTG

TTTAGTCATCTTATATTTTTGTTCTCAGATTCAAGAAAGCAACTACTTTGGACCAAAAGCCATGGCCCAGAGAATTGGGCCAGTAGAACCTAAGCCACAC

CTGAGGCCAGCTCTGGTCAGTCTCTGATGGTCCATTGGGCTGGCTCAGCACATTGACATCACTAACTAGGGTTGGGATAGCTTCCTACCCAGATGACCAA

AAAGCCAGTGGAAACAGTTAAGCCCCTCCATATCAGGCTTACCAAGAATATGTGCCCTGTTTTTACCCGAGATTTCTCCACTTGCCTCAAGGCTGGGAAC

AAACTTCTGTTGGAATTTTAAATAGGATTATTTGCATTTTATAGCATAGGCATAATTTTTTTAATTTAAGATTTTTAAGCAGATTAGGACAGGTGGTGGT

TGTATTGTAAGTGGCACTGGGAACCCAGGGTTTCCTTGGGAGTTGAGGCCTTCTTTATTCCTGCTCTGTCAGCTTTCATGGTCACTGGAAATCACTGCCA

CAGTACAGGCTGTGACTGCAGATGCCAAAATGATTAGGATGCCACAGATGGTACATCTAGTGGTCCAGATAGGATCCCTCCTGAAATCTCCTACTTCTTG

TCTGCCACTCACTCTTGAGGACACTGGGCCCCCATGGAATCCCTCCATGCCCTAGCATGGCTAAATGCTGAAGGTGGAGGTTCAGCATGTCTGACAACCC

GGATGTACACCGTAGAAGTGCCATTCAGTTGTACACACATCTTTCCTCCTCCACATCATCCCCACGACCCTTCTAACTCCTGGCCTCTTCCAGCCAAAAC

GGGAAAAGTGGCTGACTTCACTGCATTAGAAGAGGAAAAGTCCAACTCCTTAGGGAGTCTGAGCCTGGCACGGGCTTGGGGAAAGAAGGCTGCAGGCAGC

CTGCCGTCTAGGCATCACTTTATTTTTTATCCTCCAGACTTCTGCTCCTCCCACAGCTGATGACTTGCACTTTTAAAGTGGTTTTATAACACTAACCCGT

CCTTGCTAAAGATTGAAGTAGGTTCTCTTAAAAGGTCTATTGATGGACATGTCTGAGCAGAGAAACCGTGGAATAGAATATGGTGCGTGGGCTGCTAACA

GCAAGAGGGAGCACTTGTCTTCATCACAAGCAAGATGATGAGCACAGAGTGAGACCTTTAACAGGATGGCGGAGGGAAAGGTGTTTGCTGGAGTGACTTC

CGTGCAGAGTGGTCTATAGAGAAACTACAGCTCTGCCCATTGTCCTGGGGTCCTGGAACTTCGTCCAGTGTTAAGAACTGAGCCAAGGAGAAGCACGAGC

AGCCTTCGCACCTGGAGGGTCAGAACGTGCACACACTGCTAACTAGTTTGCACCGGCAGTGCCTTTTTCACTGAGGGCACCTGTGCTCTCAGGTCCTTGT

CCCTCATAGCCATTTCTCCTGCCATGTCCCCCCCTCCCCCAGCCCCCAGAAACTCAGTTCAGCTCTCAGAGAAGCAGGTGAATCATAAAGTCAGTGAAGA

CGCCGCCCTCTGATTCTCCCCACTGTAGGGGGAAGGAAGGGAGTGACTTCAGTGGGTTCTCTACCAAAAACAGGGCTAAGGGCTGGAGATGGATCCCCGT

TCCTTGTCCAGCCTCCTGCTACCGCTGCCCACCTCCTGCCTCCATTGCCCAGGCCACACTAGTTGGCCCCAGCACTCTACCTTAGGCCCAGGCTGGCCAC

AGGCAGTGGGCAGCTCACTTGCTGCAGTGTCATAGCAATAAAATGTGATTCTTGGGGTCTGCCCAGAGCTGCCCATGGCTTTATTTATGAGTGTGGCTTT

GAGGAGTTGGGAAGAGGTAACCCACTTCTCTCCCATCTTCTCCGAGCCATGACTCAAGAAGAAAAGGGTGCTCGGACTCTCTTATACACATGTGCTTTGT

GTAAATAAATGTTTACAATTTTATATTGAAGATGGAATAAGTGTTAGAGCGTCCAACTGTATATTTTTTACTTTTATAGATTTTAAAACTGATCCTTTAT

ATGTGTTTGGAGCTATGATAAGTTTTATGGCAAGCAGTTGGTATTGTTAACTTTTTATGATCATCAAAAGTACATAAAAGTCCTATTAATCCCCTTACTC

TGCTTCCCTTAGCTCTGGTATACACCAAAAAGAAATCTTTACTTTCCTTGTGTTATAAAAATAATAAAAATATTTTACTAGTATGG
Translation
MVLPTCPMAEFALPRHSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALHQRCIQAKAKRAGKHRQPPAAATAPVAAPAPASAPAAARLD

AADGPEHGRPVA - UNI36343 - HLHDTVKRSLDSAASPQNGDQPNGYGDLFPGHKKTRREAPLGVSVSANGLPPASPLGQPDKPSGGDTLQTAGKH

SLGLDPINKKCLADSGIHLNGGSNSSEPFPLSLSKELKQEPVDDLPCMIAGAGGSVAQSNLMPDLNLNEQEWKELIEELNRSVPDEDMKDLFTEDFEEKK

DPEPPGSATQTPLAQDINIKTEFSPAAFEQEQLGSPQVRAGSAGQTFLGASSAPVGTDSPSLGSSQTLFHTTSQPGVDNSSPNLMPASAQAQSAQRALTS

VVLPSQGPGGASELSSAHQLQQIAAKQKREQMLQNPQQAAPAPGPGQLATWQQAGPSHSPLDVPYPMEKPASPSGYKQDFTNSKLLMMPGVNKSSPRPGG

PYLQPSHSNLLSHQSPSNLNQNPVNNQGSVLDYGNTKPLSHYKADCGQGGPGSGQNKPALMAYLPQQLPHLSNEQNSLFLMKPKSGNMPFRSLVPPGQ -

 UNI36343 - EQNPSSVPVAAPAASVGTQPTVSVASTHNSSPYLSSQQQAAVMKQHQLLLDQQKQREQQQQQLQQQQFLQRQHLLAEQ - UNI3391

3 - EKQQFQRHLTRPPPQYQDPTQSTFPQQVGQFTG - UNI33913 - GPSAAVPGMNNLGPSNSSCPRVFPQPGTLMSMGPGHAPVSSLPSSSGQQ

DRGVAQFTGSQSLPQNSLYGMASGLAQIVAQPPPQATSTHAHIPRQTNVGQNASTSAAYGQNSLGSASLSQQHSKGTLPPGLTKPQVPRVSAAMGSQNAS

WQHQGMPNLSSQTSGNSSVNPFTAAPSFHIQQAHLKLAGQQFSQAMPSRPMAPLSSAGAAGPMLPPVSAQQRNSAPASAPPQAAPQQGLPGLSPSGPELG

AFGQSPTSQMSGRPGLHCAQAYPVRTMGQELPFAYSGQPGSSGLSSVAGHTDLIDSLLKNRTSEEWINELDDLLGSQ

For any suggestions or comments, please send an email to unitrap@crg.es