Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000050592 (A130092J06Rik)
Chromosomal location
Chr 2: 31922409 - 31939227 (-)
Description
RIKEN cDNA A130092J06 gene Gene [Source:MGI Symbol;Acc:MGI:2443569]
RefSeq_dna
NM_175511 
RefSeq_peptide
NP_780720.1 
UniGene
Mm.250441 
MGI
MGI:2443569 
Uniprot/SWISSPROT
Q8C552 
Uniprot/SPTREMBL
A2ATN4 
Human Ortholog
ENSG00000126882 (FAM78A)
Omim not available
UniTrap UNI13193
Vector Insertion
Chr 2: 31925294 - 31938103
Public Clones CMHD-GT_438H7-3 (cmhd) CMHD-GT_323E6-3 (cmhd) CMHD-GT_422C8-3 (cmhd) CMHD-GT_282B07-3 (cmhd)
IST14807F7 (tigm) IST14398A9 (tigm) IST12656F1 (tigm) IST12339G12 (tigm)
Private Clones OST459072 (lexicon) OST346710 (lexicon) OST340874 (lexicon) OST316313 (lexicon)
OST313390 (lexicon) OST135013 (lexicon) OST108162 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000056406
Sequence
ACAGCCCGTGCCCGGCGCACAGGCATCGCCGCGCCCTCGAGTCCCCCGCAGTAAAGTTCGGCTCAACTTTGCCGCCCTGTGCCTTCCACCTCTCTGCAGG

TCCTCGGCGGCCGAGGCGAAGCAGGCGGCGGCGGATATCCGAGTGCAGTCCCGGAGCCCTGCGCGGCAGTCAGCGGCTACAGCGACAGTGGCAGAGGAAC

GCGCGAGTGGGCGCCGGAGGGGACCTGGCGAGCACCTAACCCGGAGCGCACCTCTCGGAAGGGCGGGTGGATACGGGCCTCACAGGACGTCGGACCTCTG

CCGCTTGAATCGGAGCTCACGCTGCAATTGATTGGGCCCCGCCGGGCGGGCGCGTGTGTTCCAGGGAGCCGGTGCGGAAGGCAGAAGGGCAGGAAGTCGG

CGTTCTGCAGCGAGGGTGGCGCGACCGCGCGGGGACCGAGCCTTCCTTATTTATGTGCCTGGCAGAGCCCGTCTGCTTCCTGCGAAGACTTCAGGGAGAG

TGTCCGAGCTGCCATCCCCAAGTGTGAGGACGCAGCGCTGGATGTCAGAAAAACATGCTTCTCCATTAAACTCCAAACTTTTCTTTTTTTAAACCCAAAG

AATATCGGTGGCTTTTGCCCACTGCTAGAAGAGGGAGCCCAGGGCTCTTGAGATGCAACAGAACCCATATTTATAACAGGACCCGGCAGTGCTATGCAAA

CCTCCTCTACTCCTTAAGTTCTCTAGCCTATGGATCTCGATTTTGAGTTTTGAGATTAGATTGAGCGCTCTGCACTGGGTCCTGCAACCTCCATCCTTTC

AATGCCCTGTTATTTTTGGGACTGCTGGCCTTCCCTGGAGATTAGAGCGGTCCTGTGTGCCATGGGCTGTATTCAGAGCATCGGAGGCAAAGCCAGAGTC

TTCCGGGAAGGGATTACCGTGATTGATGTGAAAGCCTCCATCGACCCCATCCCCACCAGCATCGACGAGTCCTCCAGCGTGGTATTGCGCTATCGGACAC

CCCACTTCCGGGCCTCAGCCCAAGTGGTCATGCCGCCCATTCCCAAGAAGGAGACCTGGATCGTTGGTTGGATTCAGGCGTGCAGCCATATGGAGTTTTA

CAACCAGTACGGGGAGCAGGGCAT - UNI13193 - GTCTAGCTGGGAGCTCCCCGACCTCCAGGAAGGAAAGATCGAGGCCATCAGTGACTCTGATG

GGGTGAACTATCCCTGGTACGGCAATACCACGGAGACCTGCACGATTGTGGGGCCCACCAAGAGGGACTCCAAGTTCATCATCAGCATGAACGATAACTT

CTACCCCAGCGTCACGTGGGCCGTGCCCGTCAGTGAGAGCAACGTGGCCAAACTGACCAACATCTACCGGGACCAGAGCTTCACCACGTGGCTGGTGGCC

ACCAACACCTCCACCAATGATATGATCATCCTGCAGACCCTGCACTGGCGCATGCAGCTGAGCATCGAGGTGAATCCCAACCGGCCCCTGGGCCAGCGCG

CCAGGCTGCGGGAGCCCATTGCCCAGGACCAGCCTAAAATCCTTAGCAAGAATGAGCCCATCCCGCCCAGTGCCCTGGTCAAGCCCAACGCCAACGATGC

ACAGGTCCTCATGTGGAGACCCAAGTACGGGCAGCCACTGGTGGTGATCCCGCCCAAGCACCGGTAACAGCCAGGCTGCTGCGAGGTGAGACTCAACGTA

GTAACAATATTACTGCTCAGAAGGAAACCCAGATGCCCTGTCGGTCATTCAGAAAAATACAACCATTCTACCTTCTCCCGGGGCGGATCTCACTGTGCTA

AAACCGGCCGGCCTCCTGGCTCCTCCACGTGCTTCCCTGCAGGGAGGGGGGAGCCAGGGACAACAGGCGCCCACCCACCCCACCCCCAGGGCTCCTCTCC

TCCTATCACAACCTCAGTGTTCATTGACTCTCCGAAACACCGCTTTTTTTAATTTTCCCCTCCTCTTTGTGGATGCAGGGGCAGGGGAGGAGGCTGGTTG

TCAGGGGACCCAGCCTGCTCTTCCTGCCTCCCCTCTGCCTCCCCTCTGCCATGCGGCCTTATGTAGACTTGCTTTGCCAAACTTTTGCCTTAAGCTGAAT

TTAAAGGAGAGAAAGAACTGGAAAGGCCACGGATCTCTGCCCTACAGGACTTGCCCTCTTCAGTCAGAGCTGGGAAGAGGGGAGGCTCACCTGAACCCTG

CTCCTCCTCCTGGGCGTCTGCGTGAGGGGGCAAGAGAGCGATCTCAGGTCTAAAACCAGCTGTTTTATCCTGTTGTTTGTGCAGAATCAAAACCACAGAC

TCTTCCTAGAGCTTCTATTCCACCCCAGTAGAACCCCTCCCCAGTACCTGCCGGGGGTGGGGGTACGAGCTGAGCAGGGCATAGATCCTTGACCCCACCC

CTCTCCTCAGTAGCCTTAAGTTGCCTGATGGAGGTATTCTGGGAGAAGAGTCCCCAAAGTGTTGGGTTGGAGCTAGGTAACGTTTTCACCTTTGCTATCT

CTAGAACCCACCCCTAGGAATGTGGCTTTTTCTCTTCCATTATCTTGGTCCCAAATGCCTGGCAGGGTTGGGGTTGGGGCATTGCCACTGAGTCTGGACA

GTCCCAGCTGTCTTAAGGTAAAGATGGCATGCCCTTTCCTCCTGGCCAGCACTATCACACTTGAATCTGGGGTTCCAGCACCCAGGGATGCCCATACGCT

AGCACACTGTAAAGAAGCCATATCAGAGCTTCTGGTTCATTCTCAGGGGAAGCGGCTCCCGGACTCTCTGGGGTGGGCTGCATATAGGAGCTAAGCACCA

GCTGGAGGGTGCTTAGGTCCCTCCCCTCCCCATCATAGGTGCTCCTGGGGAGGTGGAGGTCTGGGGAGCAAGCAGTCAGCTGACTCACCTGGGAGGTGTC

AGGCCATTGTGAAACTGGCTTGACACATGGTAGGCAGTCTTGGGGTCTCCCTTCTGGAGCCCTAGAACTTGTCCTTGAGTGATGCCATGGTTTCTAGAAA

TGTCTGCTTTGAGCTGCTTGAGGGACACTCCGTTAAGCGTACTAACAGCTGCATCACTGGATTCGAACCAGTAATAAGCACAGAAAACTGTTATCACAAG

AAAAAGAATGTTTTTGCTGCTGCTGAGCCATTTGTAGGGGAGCCTCGGAGACAGCATGGGAGGTACAGCTAGATCCCAGCTCTATTTCTACACTTGAGAC

GCTTGTCCTTCCAGGGTACTTAATGTCTGGTCATTCTCAGCCACTAGGGCTGGGGGCTGCAGTCACCTGGAGCACACCGAACAGATCATGCCCATGGCAC

AGTTGGCTGGAGAGCCACTTGTCAGGGCTGGACCTCCCTGGAGCCTTCTCTTTCTCTATGTCATCTTAGCTGGGAGAGCCATGAGGTCTCAGCCCCACAC

TAGATCAGGGTTGGCTGGTGACTGGAAAGGCCTTCTCTGTGTTCAGGACTTCCTTGCCCTGAAGAAAAGAGACAGGCCCTGGTGAGGGTTGGGAGCGAGT

CCTTGTCCTGGGCTGAGTGCTCTCTAAAGGTTTGGTGGGAATAAGGATTAGGAATCACAGTAGGGGTGGCCCGAACTGCTCTGGACATGGGGACCCCCAA

ACCCACATATCTTGCGCTCCTTCCCCACTGCATGCCTGGCTTTGCCCACCTGGCTTCCTTGGCTCCCCGTTCCTCTCTCCCCTCCTGCCTGACAGAAGAC

AGACAGGGCTAGGGAGAACCCCAGAGAGGCTGTGTGGGTCTGGGCGAGAACACTCAGCTTCTCTTGGGTTGGTCCCCTCGGTCCATTGCCTCATGTTGTT

GACAGACCCCAGGCTTCCCTCTACTGCTGTCCTTCACACCCATGCCCATCCGGGCATGGACACTCACTGTTTCTAGCAATAAGCACCAACTGTCCTTGGT

CACGGACAGTACTGTGAACACGAACCCATGCGTGCACTTACCAGCAGGCGCGAGACTCTTGAAGACAATGTCAAAGAAACCTTTTTTTTTTTAAAAAAAG

ATTAAAATAAAAGATATGTAGAG
Translation
MPCYFWDCWPSLEIRAVLCAMGCIQSIGGKARVFREGITVIDVKASIDPIPTSIDESSSVVLRYRTPHFRASAQVVMPPIPKKETWIVGWIQACSHMEFY

NQYGEQGM - UNI13193 - MSSWELPDLQEGKIEAISDSDGVNYPWYGNTTETCTIVGPTKRDSKFIISMNDNFYPSVTWAVPVSESNVAKLTNIYR

DQSFTTWLVATNTSTNDMIILQTLHWRMQLSIEVNPNRPLGQRARLREPIAQDQPKILSKNEPIPPSALVKPNANDAQVLMWRPKYGQPLVVIPPKHR

For any suggestions or comments, please send an email to unitrap@crg.es