Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000050714 (Zbtb26)
Chromosomal location
Chr 2: 37287690 - 37298641 (-)
Description
zinc finger and BTB domain containing 26 Gene [Source:MGI (curated);Acc:Zbtb26-001]
RefSeq_dna
NM_199025 
RefSeq_peptide
NP_950190.2 
UniGene
Mm.383299 Mm.405475 Mm.466079 
MGI
MGI:2444402 
Uniprot/SPTREMBL
Q6P9Q3 Q69ZG1 Q8C8S0 
Human Ortholog
ENSG00000171448 (ZBTB26)
Omim not available
UniTrap UNI12457
Vector Insertion
Chr 2: 37292520 - 37298575
Public Clones F017B08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18574
Vector Insertion
Chr 2: 37292520 - 37298575
Public Clones IST13878E10 (tigm) IST12639D12 (tigm) IST14245C4 (tigm) IST13778G5 (tigm)
IST14250C9 (tigm)
Private Clones OST420407 (lexicon) OST314405 (lexicon) OST264569 (lexicon) OST206137 (lexicon)
OST73551 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30161
Vector Insertion
Chr 2: 37287689 - 37292520
Public Clones D097F05 (ggtc) IST14559H7 (tigm) IST12705F11 (tigm) IST10722H11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000067043
Sequence
CGGAGCCCCGAGGGGCCGCAGCTCCTGGTTTTGCCAGATGTAGATGGCGACCTTCCCCCCGGGTCTGTAAGTTCGGAGGCCACCCGAGAGCCGGGCTAGG

GTGCGGGGTCTCTGGAAATGGAGCCCCCGTGGGGACCTGGATCGGCCGCAACCTGCCCTGGGATGGGAGCCAAGGAGCTGGTCTAGGCCCCCAGACTTTT

GAGCCATTGGACTGGCCCATGCTGCATCCCACTTTCTTCCCCTTCCCGAATCTGCAGTGGGGAATCTCAGGATGCCCCAGGGACCGCTTCCTGAGACCCT

CTATATAGGGCCCTGTAGCTGGCCAGGAAGCCAGACTCTGGCATTTTGTAAAAAGTGCTGCAGTTGAGGCCGGCAGAAAACTGAACGGCGGGAGCTAGCC

AAGGCAAGGCCTTCAGTGCCAACCGCGAGTCTACT - UNI12457 - - UNI18574 - - UNI30161 - GTCTGCCAAAATGTCTGAAAGATCA

GATCTCCTTCACTTCAAGTTTGAAAATTATGGAGATTCAATGTTACAAAAAATGAACAAATTAAGAGAAGAGAATAAATTTTGTGATGTTACAGTTCTCA

TAGATGATGTTGAGGTGCAGGGGCATAAAATTGTTTTTGCTGCAGGTTCCCCCTTCTTAAGAGACCAGTTTTTACTGAATGATTCCCGAGAGGTGAAAAT

CTCCATATTACAGAGTTCTGAAGTGGGGAGACAATTGCTCTTGTCCTGTTATAGTGGTGTGCTGGAATTCCCTGAGATGGAACTGGTAAATTACTTGACT

GCTGCGAGTTTTCTTCAGATGAGCCACATTGTAGAACGGTGCACACAGGCGCTGTGGAAGTTTATAAAGCCAAAACAACCAATGGATAGTAAAGAGGGAT

CTGAACCACAGAGCGCTTCTCCCCAGTCGAAAGAACAGCAGGGAGATGCCAGAGGCTCTCCAAAGCAGGACTTACCTTGTATTCATCCATCTGAAGACAG

TATGGATATGGAGGACAGTGATATTCAGATTGTTAAGGTAGAATCTATTGGGGATGTATCAGAGGATAGAAGTAAAAAAGATGAGAACCAGTACATTTCT

TCTGAACCCACTGCTTTGCACTCATCAGAGCCCCAGCACTCCCTGATAAACTCAACTGTGGAAAACAGAGTTAATGAACTAGACCAGAGCCATCTCCACA

ATTACGCCCTCTCTTACACAGGCAATGATGACATCATCATGACCTCTAAAGATGTCTTTGGGCCTAATATTCGAGGTGTAGACAAAGGCTTACAGTGGCA

TCACCAGTGCCCAAAGTGTACCAGGGTATTCCGTCACCTGGAGAACTACGCCAACCATTTAAAAATGCACAAACTGTTTATGTGTCTACTCTGCGGCAAG

ACTTTCACTCAGAAAGGCAATCTTCATCGACACATGCGTGTACATGCCGGAATTAAACCTTTCCAGTGTAAAATCTGTGGGAAAACCTTTTCTCAGAAGT

GTTCCTTACAGGACCATCTTAACCTTCACAGTGGAGATAAGCCCCATAAATGTAACTATTGTGACATGGTTTTTGCACATAAGCCAGTTTTGAGGAAACA

CCTTAAACAGCTGCATGGCAAAAACAGCTTTGATAATGCCAATGAGAGGAGTGTACAAGACCTCACAGTGGATTTTGACTCTTTTGCATGTACAACAGTC

ACAGACTCTAATTGCCAGCCACAACCTGATGCAACACAGGTCCTGGATGCAGGTAAACTGACCCAAGCTGTCCTCAGCTTAAGGAGTGACAGTACATGTG

TGAATTGAACAGGGCTTAGTGCTCACAGCCAGAGCTGGCAGTATGGCAATAGTCGCTGAGTCTCTTTAGAAGTCACTTGGTAGTTTCTTCTACAAAGCCT

CCAAGCAGGTGGTAGTGAGTGAGTTGAAGCACTAGCAGACTAGGTGACTCCCTCTTATGGTAGCTTTGCTTTCCTTTGGCCCTCTCCTGGTTCCTTTTTG

AGTTATTTAACCTGTGATTTCTGTTTTCCTTTTCTAAGGAATAATTCCATTTGTCTACCTAGTGTTGATATATGTCTTAGACTGGCACTATTTTAAATTT

TTTACCAAGCACATTCTGAAGGTACCAACAAATGACATTATCTACTTCCTACTAGTAAACTGTGTTTAGGAAAGTTAATATTTCTCCTTGGGGGAAAAAT

GAGGCTGGGATAGAAGGTGATACTGCTGTTGACCTAAATATGTGATAGAGTTTCTGTTTGTCTACTGTGATTCATCCAAGGCTGATGAGTGAATCTGCTT

CCTGCCGTTTGTACTTTTTTGGAGCTGCTGTGGAGAAGTGTGTGGGTTTGTACTTTAAACACTAACTGCCCATTGAAATTTTCTTAAAACCCAGAATACA

ATTTTTTTCAGCAACTTCTACAGACAAAAAGGGACTGCCATGGGGCGGATAATCAGTAAATGATAGAAATATAATAAAACAAGAGTGGGCATATGGAAGT

TTTCCTAAATATTATGACCTAACAAGAGGCCATCTGCGTACATATATATCCTGTTGATGCTTTAATAATTGGAAATGTTTTAGGCATGCTCAGGTGAGCT

AAAGAATAATGGATTATGTTGGAGTCTAAATGATGTATCATTTTATACATAAGAAAGGTGCATTTGGCCATAACTTGTCCAGTATAGAATTAATGTCTCC

AGCCAGTCTTTCCTTTTCACATGGACCTTCATCTTAGAAATCGATGAAAAAAATTAAATGTGATACAGAGGAACTACCAGAATTTCTGCATTTAGATAGC

CTTAGAGATACACAATACGCTGTCTACTTTTGCTACCTTTGATAGTTGATCTTGAAGGATGGGGGAAAAAAAAACAAACAATTCTTTATCCTGAAGTAAA

TTTTAGACATTTGTTTGAGCCTGCTTCTTACCCAAGGGTTACAGGGAGGTGATAGGATTGCTAGAGATCTTAGAAACTTTCAAAAGATTGCTTACACTAT

CTGCCATTTTAAATAGGGGCATTTAGAGTCAAACAGGTAGCCTGGCCACTATTGGCCCAAATACACTTGACAAAATATGATTATCCCAATACATCTCTTC

CACATACCTTGTCTTTAACGATGGGGAATAGTAACACATTAACAGAAAGTTTCCAATTCTGTTTCACTATTGTATAATTGTCCCTTTTGGTTTTCAGAGA

CAGCCAAGAATTCACCAACAAAATGTCATAGAAGGACTTGTAAGAATTACTTTTTAAACTTTATTTTATTTTGGTGGTTTGTGCCTGTAACCTCAGAATT

TACAAAGTTACAAGAAGGTTGCCTGGGCTATAGAATGAGGCCCTCCTTCAAAAGACCTAAATAAATATAATTATTTTATAGTAGTGGTGCTGGAAGTCGA

ACCCAGTGTCTCATAGGCACTGGACAAGCACTGTACCACCTAGATACAGCTCTAGCCTGATCATTGTTCTTAGCTAGATGAACATTATACTATTTCTAAA

TGACTGGTTTGGCTATCAAGGGAACGGCAGGTTAGAATAATGCGAAAATAATCCAAATATGAAACTGATTTTGTCTAAAAAACTTTATTTCTACCAGACT

TTTGTTTTTTATTTTTAAGCTATGAGAGCACATGGACAGAAAAATCCAAAAATTTATATTAATTTATATATAGACATAATTTGATATATTTACACATAGC

TCAGATTTGAGGCATAATTTTTACTAAATATTTAAATGTGAGTACAGTTAGCTAACATGTGTGCTAGGTACTTCATGCCCAACATCACTCAGTATAGTCC

TAATAATGCCTCCTAGCATTCCAAATTTTGCATGATTCATCCAAAGAGCACCAGTTCTATGCAACAGTGGGACTCTAATCATCCCATGTTTTAAATATTT

TCTCTGAACATCATTTGAAGATGGTGGGGCTCCATATACTTATTCTTGTCCAGTTACTGTTAGTAGTTTGAAGACTTAAGAACGGCATGGGTTTAAATAG

CACTGGTCTCTCTAGTTGGAGGCTATTTCTTGATTAATTTCAGTCACTCAGAAGGCCTTTTTTCTTTTCTTTTTTTTTTTTTCCCCTTTTTAAAAAATGC

CCGAGACTTTGAATCCAAGGCCTCATGCACATTAAACATGTACTCCAGCACTGAGCTACTCCCACAGCCTCAAGAAGTATTAGTAACCAACTGGAATTTC

CAGGTACTGTGTTATATTCTGAGGATAGGAAGGTAAGATTGATATATATGGTCCCTGTCCTTATAGGGCAAGCGATTTTAGTGAGATGATGTCTCAAATT

TATATCCTAACAAGAATAAAATTGCCTCGTTTTCTTTAATCACTTAAAGCAGTGGTTTTCTACCTGTGGAATCAAGTGATTTTTTTTTTCACAGAGGTTG

CCTAAGACCATAGAAATTGTTTTTGTTTATATTACAATTTAATTACATTATAATTCAAAACAGCAGAAATGCAGTTATGAAATAATGAAAATATTTTTAT

GGTTGGGCTCACCACAGCATGAGGAACTGTATTAAAGGATCTCACAATATTAGGAAGGTTGAGAACCCTGACTTAAAGTCCACTTTCTTAGGGGTTTCTG

TTAGTAAAATTTTTGGTTCTGTTTGTAAGTGTAAACCATTTGCATAATTTGTGATCTCTTCCATTTCTTGGCTGGAGAGGTCTTATTTTTGTGTGAGATA

TTTAATTTTGGTGGAACTTGGTTTCTTTGCTTACGTGTTTCTCAGATTTTAAAGCAAAGAGAAGAGGCATATATTTTATTGTGGAAGAAGGCTTTTCACA

CTAGTAATTATATGAGGCAGAGGTGAGCCTTAGTTACTCAGCATTTGGTTTAATTTGGCTTTTTGTTTTTGTTTTTGTTTTTTTGAGGCAGGATCTTACT

ATGTGGCCCTGGCTGCCTCTGCCTCTGCTGGGATCACAGGTATAGGCCACGATGCCAGCCTCAGTGTTTGTGTTGTATGGATTCCTAGGAAAACCTCAAA

AGAAAGAGGACCCTCTTTACTGTAGTTTGTTTTTTTTAAAATTACTGTTATTTATTTATTATTTAATATGAAAACAATCTCCAAACTGAAGTGGCTCTGA

GGTAAATCAGGTGTGATTTTGCATTAGTTTAGAAGATGTGTAAGTGAAAGGTGACTAATGTCACTATTTCTAAAATATTGTCCTAAACAACTTAGAACAT

TTTATTTCAGCTCATGAATGGCTGTTCTAAATCTGTTGTATGTTAGACATACTTGAACTACCTCTTTACTTAATGGGGAAGTTTCCTTAATAAAAGTTAA

CCATT
Translation
 - UNI12457 - - UNI18574 - - UNI30161 - MSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDVEVQGHKIVFAAGSPFLRD

QFLLNDSREVKISILQSSEVGRQLLLSCYSGVLEFPEMELVNYLTAASFLQMSHIVERCTQALWKFIKPKQPMDSKEGSEPQSASPQSKEQQGDARGSPK

QDLPCIHPSEDSMDMEDSDIQIVKVESIGDVSEDRSKKDENQYISSEPTALHSSEPQHSLINSTVENRVNELDQSHLHNYALSYTGNDDIIMTSKDVFGP

NIRGVDKGLQWHHQCPKCTRVFRHLENYANHLKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFSQKCSLQDHLNLHSGDKPHKCNYCD

MVFAHKPVLRKHLKQLHGKNSFDNANERSVQDLTVDFDSFACTTVTDSNCQPQPDATQVLDAGKLTQAVLSLRSDSTCVN
Transcript ENSMUST00000102789
Sequence
GGAGCCCCGAGGGGCCGCAGCTCCTGGTTTTGCCAGATGTAGATGGCGACCTTCCCCCCGGGTCT - UNI12457 - - UNI18574 - - UNI301

61 - GTCTGCCAAAATGTCTGAAAGATCAGATCTCCTTCACTTCAAGTTTGAAAATTATGGAGATTCAATGTTACAAAAAATGAACAAATTAAGAGAAG

AGAATAAATTTTGTGATGTTACAGTTCTCATAGATGATGTTGAGGTGCAGGGGCATAAAATTGTTTTTGCTGCAGGTTCCCCCTTCTTAAGAGACCAGTT

TTTACTGAATGATTCCCGAGAGGTGAAAATCTCCATATTACAGAGTTCTGAAGTGGGGAGACAATTGCTCTTGTCCTGTTATAGTGGTGTGCTGGAATTC

CCTGAGATGGAACTGGTAAATTACTTGACTGCTGCGAGTTTTCTTCAGATGAGCCACATTGTAGAACGGTGCACACAGGCGCTGTGGAAGTTTATAAAGC

CAAAACAACCAATGGATAGTAAAGAGGGATCTGAACCACAGAGCGCTTCTCCCCAGTCGAAAGAACAGCAGGGAGATGCCAGAGGCTCTCCAAAGCAGGA

CTTACCTTGTATTCATCCATCTGAAGACAGTATGGATATGGAGGACAGTGATATTCAGATTGTTAAGGTAGAATCTATTGGGGATGTATCAGAGGATAGA

AGTAAAAAAGATGAGAACCAGTACATTTCTTCTGAACCCACTGCTTTGCACTCATCAGAGCCCCAGCACTCCCTGATAAACTCAACTGTGGAAAACAGAG

TTAATGAACTAGACCAGAGCCATCTCCACAATTACGCCCTCTCTTACACAGGCAATGATGACATCATCATGACCTCTAAAGATGTCTTTGGGCCTAATAT

TCGAGGTGTAGACAAAGGCTTACAGTGGCATCACCAGTGCCCAAAGTGTACCAGGGTATTCCGTCACCTGGAGAACTACGCCAACCATTTAAAAATGCAC

AAACTGTTTATGTGTCTACTCTGCGGCAAGACTTTCACTCAGAAAGGCAATCTTCATCGACACATGCGTGTACATGCCGGAATTAAACCTTTCCAGTGTA

AAATCTGTGGGAAAACCTTTTCTCAGAAGTGTTCCTTACAGGACCATCTTAACCTTCACAGTGGAGATAAGCCCCATAAATGTAACTATTGTGACATGGT

TTTTGCACATAAGCCAGTTTTGAGGAAACACCTTAAACAGCTGCATGGCAAAAACAGCTTTGATAATGCCAATGAGAGGAGTGTACAAGACCTCACAGTG

GATTTTGACTCTTTTGCATGTACAACAGTCACAGACTCTAATTGCCAGCCACAACCTGATGCAACACAGGTCCTGGATGCAGGTAAACTGACCCAAGCTG

TCCTCAGCTTAAGGAGTGACAGTACATGTGTGAATTGAACAGGGCTTAGTGCTCACAGCCAGAGCTGGCAGTATGGCAATAGTCGCTGAGTCTCTTTAGA

AGTCACTTGGTAGTTTCTTCTACAAAGCCTCCAAGCAGGTGGTAGTGAGTGAGTTGAAGCACTAGCAGACTAGGTGACTCCCTCTTATGGTAGCTTTGCT

TTCCTTTGGCCCTCTCCTGGTTCCTTTTTGAGTTATTTAACCTGTGATTTCTGTTTTCCTTTTCTAAGGAATAATTCCATTTGTCTACCTAGTGTTGATA

TATGTCTTAGACTGGCACTATTTTAAATTTTTTACCAAGCACATTCTGAAGGTACCAACAAATGACATTATCTACTTCCTACTAGTAAACTGTGTTTAGG

AAAGTTAATATTTCTCCTTGGGGGAAAAATGAGGCTGGGATAGAAGGTGATACTGCTGTTGACCTAAATATGTGATAGAGTTTCTGTTTGTCTACTGTGA

TTCATCCAAGGCTGATGAGTGAATCTGCTTCCTGCCGTTTGTACTTTTTTGGAGCTGCTGTGGAGAAGTGTGTGGGTTTGTACTTTAAACACTAACTGCC

CATTGAAATTTTCTTAAAACCCAGAATACAATTTTTTTCAGCAACTTCTACAGACAAAAAGGGACTGCCATGGGGCGGATAATCAGT
Translation
MATFPPGL - UNI12457 - - UNI18574 - - UNI30161 - LSAKMSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDVEVQGHK

IVFAAGSPFLRDQFLLNDSREVKISILQSSEVGRQLLLSCYSGVLEFPEMELVNYLTAASFLQMSHIVERCTQALWKFIKPKQPMDSKEGSEPQSASPQS

KEQQGDARGSPKQDLPCIHPSEDSMDMEDSDIQIVKVESIGDVSEDRSKKDENQYISSEPTALHSSEPQHSLINSTVENRVNELDQSHLHNYALSYTGND

DIIMTSKDVFGPNIRGVDKGLQWHHQCPKCTRVFRHLENYANHLKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFSQKCSLQDHLNLH

SGDKPHKCNYCDMVFAHKPVLRKHLKQLHGKNSFDNANERSVQDLTVDFDSFACTTVTDSNCQPQPDATQVLDAGKLTQAVLSLRSDSTCVN

For any suggestions or comments, please send an email to unitrap@crg.es