Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000050737 (Ptges)
Chromosomal location
Chr 2: 30744995 - 30758819 (-)
Description
prostaglandin E synthase 3 (cytosolic) Gene [Source:MGI (curated);Acc:Ptges-001]
RefSeq_dna
NM_022415 
RefSeq_peptide
NP_071860.1 
UniGene
Mm.451004 Mm.28768 
MGI
MGI:1927593 
Uniprot/SWISSPROT
Q9JM51 
Uniprot/SPTREMBL
A2APZ8 Q8BNP8 A2APZ9 Q3UDM3 
Human Ortholog
ENSG00000148344 (PTGES)
Omim not available
UniTrap UNI31565
Vector Insertion
Chr 2: 30757233 - 30758820
Public Clones IST15069H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20767
Vector Insertion
Chr 2: 30748347 - 30756386
Public Clones not available
Private Clones OST352714 (lexicon)
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20095
Vector Insertion
Chr 2: 30748117 - 30748347
Public Clones IST10874B4 (tigm)
Private Clones OST373055 (lexicon) OST355894 (lexicon) OST286382 (lexicon) OST14968 (lexicon)
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000056046
Sequence
ATTACAGGAACTCCACTGGTGGCAAAGCTGGGCCCTCAGAGTTGGGGTTTCCGAGCCAGGAGGGAGGAATTCTGG - UNI31565 - GCTTTTGCCAA

CCCCGAGGATGCGCTGAAACGTGGAGGCCTCCAGTATTACAGGAGTGACCCAGATGTGGAGCGCTGCCTCAG - UNI20095 - - UNI20767 - A

GCCCACCGCAACGACATGGAGACAATCTATCCTTTCCTCTTCCTCGGCTTCGTGTACTCATTCCTGGGACCCAACCCTCTGATCGCCTGGATACATTTCC

TCGTTGTCCTCACAGGCCGTGTGGTACACACCGTGGCCTACCTGGGCAAGCTGAACCCACGCCTTCGCTCCGGGGCCTATGTCCTGGCCCAGTTCTCCTG

TTTCTCCATGGCCCTGCAGATCCTCTGGGAGGTGGCCCACCATCTGTGACCAGCAGCTGAAGCCTCCTCAGCTACCACAGTGGGGACAGAGCCATGAAGG

CTGAACTTGCGGACTTGGTGTCTCTTCTAGAATAGGGACGGGGTCTGGTCCTGGGGTCCTGGGTAACCTGGGCGAGTGGATCTCAGGGCCCAATGTGCAC

ATGTGTGTTTCTTAGCCTTTTGGGATGCTAGATGAAGTCCCATTTGGAGCCACTTACAGATGAGCTGTCAAGATTTGAGAGGACATCCTTCACCTCACAA

AATGCCTTAAACATCACACCACACTCCCTCTTAACCATAAAATAAAGGACAGGATTGACCAACAGAGCCATCATCCCATATAGGACTAAGAATGAAGGCT

TCTCAGACCTACCTACAATTCTGGCCCAGCCCAAGGAGAGCCACCTGGCTGGTATGTGTCCGAGGACATCCTCACAAGAGGCCCAGCAGTGGCCAGCTCC

ATGTGGAGGTAGAGTGCTTGCTATTTTTAGAGGTGGGCAGGTCAGAGCATCCCTGTCCCCTGTTGATACCACCGTCCTTTGAGTGCCTTAGGTAGCACAG

GCTCAGGGGGGTGAGAATGTCCACAGCTCAGCCTCCTTGTGCATGGCTTTGGCTCCTCCAAAGACGGAAAGGATGGGCTTTGACCAACCCCTGGAAGGGA

ACTTTGGCTTCTTCAGCATCTGTGAGGTTTGAAGATGCCAAATGTCTACTCCTGTGGAAAATCTCACTTGTGTGTGTGCAGTGTCCCTCCAGAGTCCTGA

GACCTGTTTAGGTTTAGTCATTAAACAGCAGAGTGTGACCTGTGAATGTTCGGTGTCTAAGACCCATGCTGTGCCAGCCGGCCTGGTACCTATGGGAGTT

TTCACGTTCCGGTGTGTGTATGTTTTACTTTTATGAGACAAGGTCTCACTTAGCCCGAGTTGGCCTCAAACTTACTCTACAGTCAGGACAACCTTGAGCT

GACAGCCTACCTGTGCCTCCTAAGTGCTGGGATCGCCGGCCTGCACCACCATAGTGCCAAGCCAGTACAGGCAACTTCCACCAGGCTGCTCCAGAGAAGT

CCCTGACAAGATGGTGTTTGGCTTGGGATCCAGAGATGTCCAAATCCTGTCTTCCACGTGGCGATTCTTTCTGCAGCTCTGCCACCTTGTAGGGTGCTGG

TTTTCTGCTCTACAGACGGAGACGGAAGTGACTACCTGAAGGAAGGCATAGGGTGTGCTCCAGAACCTGGGACATTCAGGCTCCCAGGCTTCCCACACAA

GCCTAGCCACACCACTTCTCCTCCCAGCGGGGCAAGCCCTGTGCCCCAGACCTGCTCTATGGGGTTGGGGAGGGGGTTTTACTGGAAAGCCCTGCTGGCC

TAGGCTTCAGCCTCACACAGCTGGTGTTCTGGGAGTGAATAGCACTGCCCTCTGGTGGTGAGTTGAAACCTTTGCTCTTGGAATGCTCATCTGAGAAAAC

AAAAACTGTAGAATGGGGCCCCTCTTGAATGCCAGCTGTCGCTGAACATTAGGCTGGATGCGACCTTCATCTGTCATTGTCACCCCAACCCCAATGCCCC

AGTTAATACTTAAATTTTAGATAAGACCAGGTGAATTCAGACAAAAGCCTTTTTTCCTGCGTTTTAATTTTCTGTGGATGGGTGTTTTGTATGAATGTCT

GTCTGTATCATAGGTGTACCTGGTGCCCATGGAGACCAGAAGAAGTTGCTGGAGCTGGAGTTAGAGACATTGTGAGCCATCATGTGGATACTGGGAATTG

AACCCGGGTTCTCTGAAGAGCAACCAGTGCTCTTAACCACTGAGCCATTTCTCCAGACCCATTTTTAGATAAGGGATTCAAGGATCCAAGAAGACTTGTC

CTGAATTCCTGAGCTAGCATAGTCAAAAACTTTGCAAGATGGGACCCAGGAGAGAGAGGACTGGAGAGTCCATGCAGGGCGTATAAATACTCATCTACTT

CAGTCTTTTCCTCTCAGGAAGGTGAGATTGTGAGGGCCAGGTGTAAGAACCTGCCAGTTGCCTGATGCAGACCATGCATTGCCCACAAGGTCTGCCTGCT

GTGGGGCCTGCGAGATGGAGGCCAGGGCCCCTCGGAGGGTCTACTCATTTGTCTTTCTTGCCCATCCCCTGGCACTGCAGTGGGAAAGGCACCAAGCAAG

GGACAGTGACAGCCTCATGTGGGGTAAGAAGGCTCAGTCCTCTGATCCCTGCTGGGCAGGGAGGTGAGTTACGCTAATGCTGGCCAGGATGTATAAAGAA

ATTCAAGTGTGCACACCTTCAATCCAGCACACAGGCAGGTGGATAGCTGAGTTGGAAGCCAGCCTGGTCTACCCAGTGAGTCCTTGTCTCAAAAGCAAAG

AAATCAGTACCTGTGTGCCATGGTATGAAGTTGAAATTGGAGGGGTGGGAAATCGGGGTAAGAGGGCCATTAAGGAGGCCGAGGTACCCTTTCTATGTTC

CAAGCAGGAGAGAGGTGGGGACAGTGGTTTCAGCAGGGTGTCACTGGGCAGTTGGCAGGAGCAGAGACAGGACCTAGTGGCTTGTTCTGATCCAGCCCTC

ATGATAGGGAATACAGGGAGTGATCTCCTGGCTGCAAATCTGGACTCAAGACAGGTGGCTCCAGGCCACAGCACAGAGCAAAGCACTGTCCAGGGAGGCA

GTGTGGCTGGTGCCACCTGCCAATCCAGCCAGAGGCTGCAACACAGCACCTGCAGCCCTCAAGCCCTGCTACCACAGCAGCATCTCTTGCATCTCTCGAT

TCCTTTTTTTTTCTGACATGGTCTCTTGTCTGAGGCCATTTGTGGTGGCTTGAATAGGAATGGCCCCCCAATAAACTCATGTGTTTGACTGCTTAGCCCA

TAGGGAGGAGTGGCATTATTAAGAGGTGTGGCCTTGTTGGAGGTGGTGTGTCACTGTGAGGTGGGCTTTGGGGTCTCATATGCTCAATCTCAGCCTACTG

GGGCAGTCCCCTGCTGCCTTCAGATCAAGTTGTAGAACTCTGATCTCCTTCTCCAGCACCATGTCTGCCTTCATGCCATGTTCCCACCATGATGATAAAG

GACTAAACCTCTGAACCTGTAAGTCAGCCCCAATTAAATGCTTTCCTTTAT
Translation
ITGTPLVAKLGPQSWGFRARREEFW - UNI31565 - AFANPEDALKRGGLQYYRSDPDVERCLR - UNI20095 - - UNI20767 - RAHRND

METIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL
Transcript ENSMUST00000113591
Sequence
TCCTCTCCATAAGCCGCCTGTGGGACAGTCTCACTCTCAGTCCCGGTGTCCCCGAGTTGAAGTCCAGGCCGGCTAGCCGAGATGCCTTCCCCGGGCCTGG

TGATGGAGAGCGGCCAGGTGCTCCCGGCCTTTCTGCTCTGCAGCACACTGCTGGTCATCAAGATGTACGCGGTGGCTGTCATCACAGGCCAGATGAGGCT

GCGGAAGAAG - UNI31565 - GCTTTTGCCAACCCCGAGGATGCGCTGAAACGTGGAGGCCTCCAGTATTACAGGAGTGACCCAGATGTGGAGCGCT

GCCTCAG - UNI20095 - - UNI20767 - AGCCCACCGCAACGACATGGAGACAATCTATCCTTTCCTCTTCCTCGGCTTCGTGTACTCATTCCT

GGGACCCAACCCTCTGATCGCCTGGATACATTTCCTCGTTGTCCTCACAGGCCGTGTGGTACACACCGTGGCCTACCTGGGCAAGCTGAACCCACGCCTT

CGCTCCGGGGCCTATGTCCTGGCCCAGTTCTCCTGTTTCTCCATGGCCCTGCAGATCCTCTGG - UNI20095 - GGTGGCCCACCATCTGTGACCAG

CAGCTGA
Translation
MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKK - UNI31565 - AFANPEDALKRGGLQYYRSDPDVERCLR - UNI20095 - -

 UNI20767 - RAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKLNPRLRSGAYVLAQFSCFSMALQILW - UNI20095

 - GGPPSVTSS
Transcript ENSMUST00000102852
Sequence
TCCTCTCCATAAGCCGCCTGTGGGACAGTCTCACTCTCAGTCCCGGTGTCCCCGAGTTGAAGTCCAGGCCGGCTAGCCGAGATGCCTTCCCCGGGCCTGG

TGATGGAGAGCGGCCAGGTGCTCCCGGCCTTTCTGCTCTGCAGCACACTGCTGGTCATCAAGATGTACGCGGTGGCTGTCATCACAGGCCAGATGAGGCT

GCGGAAGAAG - UNI31565 - GCTTTTGCCAACCCCGAGGATGCGCTGAAACGTGGAGGCCTCCAGTATTACAGGAGTGACCCAGATGTGGAGCGCT

GCCTCAG - UNI20095 - - UNI20767 - AGCCCACCGCAACGACATGGAGACAATCTATCCTTTCCTCTTCCTCGGCTTCGTGTACTCATTCCT

GGGACCCAACCCTCTGATCGCCTGGATACATTTCCTCGTTGTCCTCACAGGCCGTGTGGTACACACCGTGGCCTACCTGGGCAAGCTGAACCCACGCCTT

CGCTCCGGGGCCTATGTCCTGGCCCAGTTCTCCTGTTTCTCCATGGCCCTGCAGATCCTCTGGGAGGTGGCCCACCATCTGTGACCAGCAGCTGAAGCCT

CCTCAGCTACCACAGTGGGGACAGAGCCATGAAGGCTGAACTTGCGGACTTGGTGTCTCTTCTAGAATAGGGACGGGGTCTGGTCCTGGGGTCCTGGGTA

ACCTGGGCGAGTGGATCTCAGGGCCCAATGTGCACATGTGTGTTTCTTAGCCTTTTGGGATGCTAGATGAAGTCCCATTTGGAGCCACTTACAGATGAGC

TGTCAAGATTTGAGAGGACATCCTTCACCTCACAAAATGCCTTAAACATCACACCACACTCCCTCTTAACCATAAAATAAAGGACAGGATTGACCAACAG

AGCCATCATCCCATATAGGACTAAGAATGAAGGCTTCTCAGACCTACCTACAATTCTGGCCCAGCCCAAGGAGAGCCACCTGGCTGGTATGTGTCCGAGG

ACATCCTCACAAGAGGCCCAGCAGTGGCCAGCTCCATGTGGAGGTAGAGTGCTTGCTATTTTTAGAGGTGGGCAGGTCAGAGCATCCCTGTCCCCTGTTG

ATACCACCGTCCTTTGAGTGCCTTAGGTAGCACAGGCTCAGGGGGGTGAGAATGTCCACAGCTCAGCCTCCTTGTGCATGGCTTTGGCTCCTCCAAAGAC

GGAAAGGATGGGCTTTGACCAACCCCTGGAAGGGAACTTTGGCTTCTTCAGCATCTGTGAGGTTTGAAGATGCCAAATGTCTACTCCTGTGGAAAATCTC

ACTTGTGTGTGTGCAGTGTCCCTCCAGAGTCCTGAGACCTGTTTAGGTTTAGTCATTAAACAGCAGAGTGTGACCTGTGAATGTTCGGTGTCTAAGACCC

ATGCTGTGCCAGCCGGCCTGGTACCTATGGGAGTTTTCACGTTCCGGTGTGTGTATGTTTTACTTTTATGAGACAAGGTCTCACTTAGCCCGAGTTGGCC

TCAAACTTACTCTACAGTCAGGACAACCTTGAGCTGACAGCCTACCTGTGCCTCCTAAGTGCTGGGATCGCCGGCCTGCACCACCATAGTGCCAAGCCAG

TACAGGCAACTTCCACCAGGCTGCTCCAGAGAAGTCCCTGACAAGATGGTGTTTGGCTTGGGATCCAGAGATGTCCAAATCCTGTCTTCCACGTGGCGAT

TCTTTCTGCAGCTCTGCCACCTTGTAGGGTGCTGGTTTTCTGCTCTACAGACGGAGACGGAAGTGACTACCTGAAGGAAGGCATAGGGTGTGCTCCAGAA

CCTGGGACATTCAGGCTCCCAGGCTTCCCACACAAGCCTAGCCACACCACTTCTCCTCCCAGCGGGGCAAGCCCTGTGCCCCAGACCTGCTCTATGGGGT

TGGGGAGGGGGTTTTACTGGAAAGCCCTGCTGGCCTAGGCTTCAGCCTCACACAGCTGGTGTTCTGGGAGTGAATAGCACTGCCCTCTGGTGGTGAGTTG

AAACCTTTGCTCTTGGAATGCTCATCTGAGAAAACAAAAACTGTAGAATGGGGCCCCTCTTGAATGCCAGCTGTCGCTGAACATTAGGCTGGATGCGACC

TTCATCTGTCATTGTCACCCCAACCCCAATGCCCCAGTTAATACTTAAATTTTAGATAAGACCAGGTGAATTCAGACAAAAGCCTTTTTTCCTGCGTTTT

AATTTTCTGTGGATGGGTGTTTTGTATGAATGTCTGTCTGTATCATAGGTGTACCTGGTGCCCATGGAGACCAGAAGAAGTTGCTGGAGCTGGAGTTAGA

GACATTGTGAGCCATCATGTGGATACTGGGAATTGAACCCGGGTTCTCTGAAGAGCAACCAGTGCTCTTAACCACTGAGCCATTTCTCCAGACCCATTTT

TAGATAAGGGATTCAAGGATCCAAGAAGACTTGTCCTGAATTCCTGAGCTAGCATAGTCAAAAACTTTGCAAGATGGGACCCAGGAGAGAGAGGACTGGA

GAGTCCATGCAGGGCGTATAAATACTCATCTACTTCAGTCTTTTCCTCTCAGGAAGGTGAGATTGTGAGGGCCAGGTGTAAGAACCTGCCAGTTGCCTGA

TGCAGACCATGCATTGCCCACAAGGTCTGCCTGCTGTGGGGCCTGCGAGATGGAGGCCAGGGCCCCTCGGAGGGTCTACTCATTTGTCTTTCTTGCCCAT

CCCCTGGCACTGCAGTGGGAAAGGCACCAAGCAAGGGACAGTGACAGCCTCATGTGGGGTAAGAAGGCTCAGTCCTCTGATCCCTGCTGGGCAGGGAGGT

GAGTTACGCTAATGCTGGCCAGGATGTATAAAGAAATTCAAGTGTGCACACCTTCAATCCAGCACACAGGCAGGTGGATAGCTGAGTTGGAAGCCAGCCT

GGTCTACCCAGTGAGTCCTTGTCTCAAAAGCAAAGAAATCAGTACCTGTGTGCCATGGTATGAAGTTGAAATTGGAGGGGTGGGAAATCGGGGTAAGAGG

GCCATTAAGGAGGCCGAGGTACCCTTTCTATGTTCCAAGCAGGAGAGAGGTGGGGACAGTGGTTTCAGCAGGGTGTCACTGGGCAGTTGGCAGGAGCAGA

GACAGGACCTAGTGGCTTGTTCTGATCCAGCCCTCATGATAGGGAATACAGGGAGTGATCTCCTGGCTGCAAATCTGGACTCAAGACAGGTGGCTCCAGG

CCACAGCACAGAGCAAAGCACTGTCCAGGGAGGCAGTGTGGCTGGTGCCACCTGCCAATCCAGCCAGAGGCTGCAACACAGCACCTGCAGCCCTCAAGCC

CTGCTACCACAGCAGCATCTCTTGCATCTCTCGATTCCTTTTTTTTTCTGACATGGTCTCTTGTCTGAGGCCATTTGTGGTGGCTTGAATAGGAATGGCC

CCCCAATAAACTCATGTGTTTGACTGCTTAGCCCATAGGGAGGAGTGGCATTATTAAGAGGTGTGGCCTTGTTGGAGGTGGTGTGTCACTGTGAGGTGGG

CTTTGGGGTCTCATATGCTCAATCTCAGCCTACTGGGGCAGTCCCCTGCTGCCTTCAGATCAAGTTGTAGAACTCTGATCTCCTTCTCCAGCACCATGTC

TGCCTTCATGCCATGTTCCCACCATGATGATAAAGGACTAAACCTCTGAACCTGTAAGTCAGCCCCAATTAAATGCTTTCCTTTAT
Translation
MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKK - UNI31565 - AFANPEDALKRGGLQYYRSDPDVERCLR - UNI20095 - -

 UNI20767 - RAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL

For any suggestions or comments, please send an email to unitrap@crg.es