Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000050953 (Gja1)
Chromosomal location
Chr 10: 56097136 - 56110221 (+)
Description
gap junction protein, alpha 1 Gene [Source:MGI Symbol;Acc:MGI:95713]
RefSeq_dna
NM_010288 
RefSeq_peptide
NP_034418.1 
UniGene
Mm.472795 
MGI
MGI:95713 
Uniprot/SWISSPROT
P23242 
Uniprot/SPTREMBL
Q544I7 Q6T9D4 Q7TMQ1 Q8C4N2 Q8CE05 Q9CT20 
Human Ortholog
ENSG00000176857 (AC010228.8)
Omim not available
UniTrap UNI10414
Vector Insertion
Chr 10: 56097325 - 56107339
Public Clones D177F01 (ggtc) D069A12 (ggtc) D003H08 (ggtc) P065G07 (ggtc) D032E05 (ggtc)
P115B02 (ggtc) D009H01 (ggtc) IST11654B6 (tigm) IST14278B2 (tigm)
IST14207F10 (tigm)
Private Clones OST296639 (lexicon) OST114860 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000068581
Sequence
ACGCTTTTACGAGGTATCAGCACTTTTCTTTCATTGGGGGAAAGGCGTGAGGGAAGTACCCAACAGCAGCAGACTTTGAAACTTTAAACAGACAGGTCTG

AGAGCCCGAACTCTCCTTTTCCTTTGACTTCAGCCTCCAAGGAGTTCCACCACTTTGGCGTGCCGGCTTCACTTTCATTAAGTGAAAGA - UNI10414

 - GAGGTGCCCAGACATGGGTGACTGGAGCGCCTTGGGGAAGCTGCTGGACAAGGTCCAAGCCTACTCCACGGCCGGAGGGAAGGTGTGGCTGTCGGTG

CTCTTCATTTTCAGAATCCTGCTCCTGGGGACAGCGGTTGAGTCAGCTTGGGGTGATGAACAGTCTGCCTTTCGCTGTAACACTCAACAACCCGGTTGTG

AAAATGTCTGCTATGACAAGTCCTTCCCCATCTCTCACGTGCGCTTCTGGGTCCTTCAGATCATATTCGTGTCTGTGCCCACACTCCTGTACTTGGCTCA

CGTGTTCTATGTGATGAGAAAGGAAGAGAAGCTGAACAAGAAAGAAGAGGAGCTCAAAGTGGCGCAGACCGACGGGGTCAACGTGGAGATGCACCTGAAG

CAGATTGAAATCAAGAAGTTCAAGTATGGGATTGAAGAACACGGCAAGGTGAAGATGAGAGGTGGCCTGCTGAGAACCTACATCATCAGCATCCTCTTCA

AGTCTGTCTTCGAGGTGGCCTTCCTGCTGATCCAGTGGTACATCTATGGGTTCAGCCTGAGTGCGGTCTACACCTGCAAGAGAGATCCCTGCCCCCACCA

GGTGGACTGCTTCCTCTCACGTCCCACGGAGAAAACCATCTTCATCATCTTCATGCTGGTGGTGTCCTTGGTGTCTCTCGCTCTGAATATCATTGAGCTC

TTCTATGTCTTCTTCAAGGGCGTTAAGGATCGCGTGAAGGGAAGAAGCGATCCTTACCACGCCACCACCGGCCCACTGAGCCCATCCAAAGACTGCGGAT

CTCCAAAATATGCTTACTTCAATGGCTGCTCCTCACCAACGGCCCCACTCTCACCTATGTCTCCTCCTGGGTACAAGCTGGTCACTGGTGACAGAAACAA

TTCCTCCTGCCGCAATTACAACAAGCAAGCCAGCGAGCAAAACTGGGCGAATTACAGCGCAGAGCAAAATCGAATGGGGCAGGCCGGAAGCACCATCTCC

AACTCCCACGCCCAGCCGTTTGATTTCCCTGACGACAGCCAAAATGCCAAAAAAGTTGCTGCTGGACACGAACTCCAGCCCTTAGCTATCGTGGATCAGC

GACCTTCCAGCAGAGCCAGCAGCCGCGCCAGCAGCAGACCTCGGCCTGATGACCTGGAGATTTAAACAGGCTTGAACATCAAGCTGCCAATCGATTGTGG

AGGAGAAAAAAAAGGGTGCTTGCAGAACGTGCACCTGGGGTGTTCATTTCGTTCCCGTGGAGGTGGTACTCAACAACCTCAGTAATGAGGCGTAGAAAAC

AAAGACATTACAATATCTAGGTTCCTTGGGGGGTGTTTTGGGATAGCTAGGCGGCAAAAGTAGGGAAAGGGGAGGTATGTAACGGTATTTAATGTAGAAG

ATTCAAAGAGCTTAAATTCTAGTAAGAGTCTCATTGGATGAAACATAGATAGGGCTTTCTCTCTCTGCCCCCCAACTGAACCTTAAGAATGGTTCTGTAT

ACATGAGTGAGTGGGTGATATATATTTTTTTTAATTTTTGTTTTACTGAGATTCTGCCATAGAGCTTTGAGCAGGAATCCAAGTCCTCAACATGGCATTT

CCTTTATGAAAAGACAGGTTGTCCTACATCCCCGCTAAAAAACATTCCAGTGTTTAAAAACTTGGCAGTTTGCAGGCGAGCTTCCCTGGCCTGACCCTCT

AGGTGTGGATGGACCTTATGCTACTATACACGATTTTCATTCTTGGTAGGTATCAATTCGAAGTTCAGACAAGGTTCAAAGAAAAAGATTGCCCATGTAT

TTGCATCTCAGTGGGTTCTTTTTCAAATCTGTCCCACCTTTGTGTCTTCCATATATTATCCTCAGCTGGTCCTCACCCTCACCAAATGATTTCTATCGAC

ATTTTTAAAACAGTGAGAAAGTCTTTTTTTTTTTTTTTTTTGAGTTAGCATCAGGGAGGCAAGCCATGCTCAATATTTAACAATCGCTTCTGTCTATGTG

TGGGTGTGCAAGTGTGTAAGCGTGTGTTTTGTCATTATTGGTACAAGCAGAGGCAGTATAAACTCACAGATTTGAATCGAATTCACACAGTGTTCAAATT

TGAACCTTCCTCATGGATCTTTGTGGTGTGGGCCAACGTGGTGTTTACATTATAGAATTCCTGCCGTGCAAAAGTGTAAAGCACACACTTTTTCCCTAAA

ATATTTTTTCCACGTATCCTATTATGGATACTGGTTTTGTTAATTATGATTTTTTTTTCTTTTTTAGAATGTAGCAGTAATAGCCATTACTGAAATGAAT

GATTTCCTTTTTCTGAAATATAATCATTGATGCTTGAATGATAGAATTTTAGTACTGTAAACAGGCTTTAGTCATTAATGTGAGAGACTTAGAAGAGGGT

TGCTTAGAGTGGACTATCAAGTGAGCCTAAAGGAACTTTGTAGTAACTGGTAATCTGGTAATTTTTGTCCTACTTAACTACACATTAACTCAGAACTTGT

ATTCTGAGTTTAACAGTCTTTTAGATTGACGAGCAACTTGGATGTTTGCACTAAGATTTTCTTTGAGATACTAGAGGGGGTGAAGGAGTTTTCAGCAGTG

CACATGTAACTAATTTATTTGAACTGTAAGCTAAAGACACCTACCAGTTTCTTCAAGTGACTTAAAAAAACTCATCACAGATGATTGAAATGTCGAGTTA

TCATGTTTCCTCTTGCGCGCCAGCTACACAAGGAGTTTTTGGACAATGAGAAACTAATTTGTTTGACATTCCATGTTAAACTACTGTCATGTTCAGCTTC

ATTGCATGTAATGTAGACCTAGCCCATCCAATCAATGTGCTCGGGAAAGTGTTCTTTATTCAATAAAATTTTAATTTAGTATAAT
Translation
 - UNI10414 - MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVRFWVLQIIFVS

VPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSLSAVYT

CKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGY

KLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDSQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

For any suggestions or comments, please send an email to unitrap@crg.es