Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051065 (1600021P15Rik)
Chromosomal location
Chr 16: 28826262 - 28929784 (-)
Description
RIKEN cDNA 1600021P15 gene Gene [Source:MGI Symbol;Acc:MGI:1917028]
RefSeq_dna
NM_177718 
RefSeq_peptide
NP_808386.2 
UniGene
Mm.408779 Mm.155887 
MGI
MGI:1917028 
Uniprot/SWISSPROT
Q8C525 
Human Ortholog
ENSG00000180611 (C3orf59)
Omim not available
UniTrap UNI29873
Vector Insertion
Chr 16: 28835236 - 28929785
Public Clones E039E05 (ggtc) IST14938B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000058376
Sequence
ATGCTACAGACGCCGATGACAG - UNI29873 - GAATGGTGCAAAAGCTAGATCAAAAACTTCCCGTGGCCAACGAGTATCTGTTGCTCTCCGGAGG

AGTCCGGGAAGGTGTGGTGGACCTGGACCTAGATGAGTTAAACGTCTATGCCCGGGGCACTGACTACGATATGGACTTTACCCTTCTGGTGCCCGCCCTT

AAGCTGCATGACCGTAACCAGCCTGTGACGCTCGATATGCGCCACTCAGCCCTGTGCCACTCCTGGCTGAGCCTCAGGCTCTTTGATGAGGGGACAATCA

GTAAATGGAAAGGTTGCTGCACAATCGCCGATCACATCAACGGTGCCACCAACTACTTCTTCTCCCCCACCAAAGTGGCTGACTGGTTCTATGACTCCAT

CAGCATCGTCCTCTCGGAGATACAGAAGAAACCCCAGAGAGGGATGCCGAAGGTGGAGAAGGTAGAGAAGAACGGTACCATCATCTCCATCATTCTGGGC

GTGGGGAGCAGCCGCATGTTGTACGACATCGTCCCCGTGGTGTCCTTCAAAGGCTGGCCCGCGGTGGCTCAGAGCTGGCTCATGGAGAACCACTTTTGGG

ATGGGAAGATCACCGAAGAAGAGGTCATCAGTGGCTTCTACCTGGTGCCAGCTTGCTCCTACAAAGGCAAGAAGGACAATGAGTGGCGACTGTCCTTCGC

CAGGAGCGAGGTACAACTGAAGAAGTGCATTTCAGGCAGTCTAATGCAGGCCTACCAAGCCTGCAAAGCCATCATCATCAAACTCCTGTCGAGGCCCAAG

GCCATCAGCCCTTATCACCTGCGGAGCATGATGCTCTGGGCCTGTGATCGACTCCCTGCCAGCTACTTGGCTCAAGAAGACTATGCAGCCCACTTTTTGC

TGGGCCTCATTGACGACCTGCAGCACTGCCTGGTCAACAAGATGTGCCCTAATTATTTCATCCCTCAGTGCAACATGCTGGAGCATCTGTCAGAGGAGAC

AGTCATGCTCCACGCCCGGAAGCTCTCCTCGGTTCGCTCCGATCCCGCAGAGCACCTGCGCACCGCCATTGAGCACGTGAAGGCAGCCAATCGGCTGACG

CTGAAGCTCCAGCGTCGGGGCAGCACCACCAGCATCCCCTCCCCACAGTCGGATGGCGGGGACCCCAATCAGCCTGATGACCGTCTGGCAAAAAAACTGC

AGCAGCTAGTGACTGAGAATCCAGGGAAGTCCATCTCGGTCTTTATTAACCCCGATGACGTCACGAGGCCCCATTTCAGAATCGATGATAAATTTTTCTG

AGTGTTTTGTTGACTTTTTTCCCCCTATCTTTCTTGGTTCTAAAATTTACGTACCGTGTAGTGTGATTTGTGACTGTCGTTCTGTTTTTTACATATCCAG

CTAACATTGGACTTGGTAAGAACACAGGTTCTGCAGGATGGTGCGGGCTCTGAAACAGTATTATTACTATTTCATATTCTGCCTGATTTTGCTGTTTGTT

TTCTAGTTATTGTGGATTTTTATTTTTCTTGGTTTTCATTGTTTTAAAGGAGAACTTGAGCCATAGACGACACTGCCCACGAATCCTCTTGCTTGCTTTC

TGTCCCACACCCAGTGTAGATTTGTTGGTGGGTTTGGGGGAACACATCTCCTCCTGGCATATTTGAACACATTCTCTTCCTCTTCGGCTGATGTTCTGTC

TTTGACCTCGTTCTTCTCCCGAGTTTTCACTGAGAGTCCTAAGAACCTGCGGCCCTGTGCATGCTGGCTGCGTTTATTTCTTTGCACCAGCAGTCAGAAC

AGTTTCCCCTTTCTACGAGACATGGAAACTTCAAGAGAGAGAGAGAGAGTGATGTCTATTGTGTTTCTGAGCAACCTCATTGAATGTAATTGTTCTCGAA

TCAGCAAACATTGGATGGTTTGGAGGGAGGGTTTGATAGCTTTCCAAACAGAATTAAGGTTTCCAAATGTTAGTTTTAGTGTTTGTAATTATTTGAAGCC

TTATTTAAATCCTATTAAGGAGCACACCATTCTAATTGTTATTTGCACTAATGAAGTCTTTGCCATTGTCATAAGCTTCGATGTGTGTTTTAGCGTCCAT

TGACATCTCTCTGGAAAAGGCTGTTGTCGCCTCTCGTTTAGTCCAGTTCTCCCGGTCAGTAGGATGAGTCTCTACATTTTGTCTAGTTCTCCTTTCATTG

TGGGTCCCGTTTTGCCCTCTTTGATAGCTCTGGTTTCTGCCTTACTGAGGGGAGTTCTTAAAGCTTTATACCTATTCACTGACCATCTGAAGCTGGGGGA

GATAGGAGATAATACTTGATCAAGTGGGTGTCTTTGTATTTATTTCTTTGAGGGAGGGGTTCTAGAGATCTTCTCTTCCCCCTTTTCTTTTATAAAGTCC

CTTTACGTCTCCTGAGATCTTGAGGGAAACTGACAGGCAGAATTGTTCCCAGATTGAAGATAACCATGCCTGTTCAAAGCAGGTGTCACTGTAGAGCAGG

AACCAGGAAATACCTAGGTAGCTCTGTTGGAAGAAGGGAGTCCTATTATCTGACAGGAACTATTTGCCAGATTTGGGTGCTTCAGGGTGTGTTGGCCCCT

GTTTGGGTGTGAACTCAAGGCAAACCGTGGTGCTTGAGTCGTGGACGGCCCTGCTGACATAGATGACACCGATGATGTCTGCTGATGGAAGAGTCAAGCA

AGCAACAGTGGCTGTTTTGGTCTTGAGTGTCCAGACTCATATAGGTTGGATTTTGGCCAGTTGGAATCAGGCTCTTGGAGTTTTGCATGGGAATTAATGT

AATGCTTATAAATCACTCAACAATCTCAAGTCAAACACAAAAATAAAAGAGAAACATACTGGCCTTGGAA
Translation
MLQTPMTG - UNI29873 - GMVQKLDQKLPVANEYLLLSGGVREGVVDLDLDELNVYARGTDYDMDFTLLVPALKLHDRNQPVTLDMRHSALCHSWL

SLRLFDEGTISKWKGCCTIADHINGATNYFFSPTKVADWFYDSISIVLSEIQKKPQRGMPKVEKVEKNGTIISIILGVGSSRMLYDIVPVVSFKGWPAVA

QSWLMENHFWDGKITEEEVISGFYLVPACSYKGKKDNEWRLSFARSEVQLKKCISGSLMQAYQACKAIIIKLLSRPKAISPYHLRSMMLWACDRLPASYL

AQEDYAAHFLLGLIDDLQHCLVNKMCPNYFIPQCNMLEHLSEETVMLHARKLSSVRSDPAEHLRTAIEHVKAANRLTLKLQRRGSTTSIPSPQSDGGDPN

QPDDRLAKKLQQLVTENPGKSISVFINPDDVTRPHFRIDDKFF
Transcript ENSMUST00000100023
Sequence
CGGCCGCCGCGGAGCCGCCGCTCGGCGCGTTTTGCATGAAGATGGCGGCTCCCACCGCCAGCAAGGCAGCCTCCCTGGGCTGCAACAACAAGCCTGCCTT

CCCGGAGCTGGATTTCAGGTCTGGAGCTCGGGTGGAGGAACTGAACAAACTCATCCAGGAATTCACCAGGCACGACCAGCGGGAATACGACGACCAGAGA

GCGCTGGAGATCCACACTGCCAAGGATTTCATCTTTTCCATGCTGG - UNI29873 - GAATGGTGCAAAAGCTAGATCAAAAACTTCCCGTGGCCAA

CGAGTATCTGTTGCTCTCCGGAGGAGTCCGGGAAGGTGTGGTGGACCTGGACCTAGATGAGTTAAACGTCTATGCCCGGGGCACTGACTACGATATGGAC

TTTACCCTTCTGGTGCCCGCCCTTAAGCTGCATGACCGTAACCAGCCTGTGACGCTCGATATGCGCCACTCAGCCCTGTGCCACTCCTGGCTGAGCCTCA

GGCTCTTTGATGAGGGGACAATCAGTAAATGGAAAGGTTGCTGCACAATCGCCGATCACATCAACGGTGCCACCAACTACTTCTTCTCCCCCACCAAAGT

GGCTGACTGGTTCTATGACTCCATCAGCATCGTCCTCTCGGAGATACAGAAGAAACCCCAGAGAGGGATGCCGAAGGTGGAGAAGGTAGAGAAGAACGGT

ACCATCATCTCCATCATTCTGGGCGTGGGGAGCAGCCGCATGTTGTACGACATCGTCCCCGTGGTGTCCTTCAAAGGCTGGCCCGCGGTGGCTCAGAGCT

GGCTCATGGAGAACCACTTTTGGGATGGGAAGATCACCGAAGAAGAGGTCATCAGTGGCTTCTACCTGGTGCCAGCTTGCTCCTACAAAGGCAAGAAGGA

CAATGAGTGGCGACTGTCCTTCGCCAGGAGCGAGGTACAACTGAAGAAGTGCATTTCAGGCAGTCTAATGCAGGCCTACCAAGCCTGCAAAGCCATCATC

ATCAAACTCCTGTCGAGGCCCAAGGCCATCAGCCCTTATCACCTGCGGAGCATGATGCTCTGGGCCTGTGATCGACTCCCTGCCAGCTACTTGGCTCAAG

AAGACTATGCAGCCCACTTTTTGCTGGGCCTCATTGACGACCTGCAGCACTGCCTGGTCAACAAGATGTGCCCTAATTATTTCATCCCTCAGTGCAACAT

GCTGGAGCATCTGTCAGAGGAGACAGTCATGCTCCACGCCCGGAAGCTCTCCTCGGTTCGCTCCGATCCCGCAGAGCACCTGCGCACCGCCATTGAGCAC

GTGAAGGCAGCCAATCGGCTGACGCTGAAGCTCCAGCGTCGGGGCAGCACCACCAGCATCCCCTCCCCACAGTCGGATGGCGGGGACCCCAATCAGCCTG

ATGACCGTCTGGCAAAAAAACTGCAGCAGCTAGTGACTGAGAATCCAGGGAAGTCCATCTCGGTCTTTATTAACCCCGATGACGTCACGAGGCCCCATTT

CAGAATCGATGATAAATTTTTCTGAGTGTTTTGTTGACTTTTTTCCCCCTATCTTTCTTGGTTCTAAAATTTACGTACCGTGTAGTGTGATTTGTGACTG

TCGTTCTGTTTTTTACATATCCAGCTAACATTGGACTTGGTAAGAACACAGGTTCTGCAGGATGGTGCGGGCTCTGAAACAGTATTATTACTATTTCATA

TTCTGCCTGATTTTGCTGTTTGTTTTCTAGTTATTGTGGATTTTTATTTTTCTTGGTTTTCATTGTTTTAAAGGAGAACTTGAGCCATAGACGACACTGC

CCACGAATCCTCTTGCTTGCTTTCTGTCCCACACCCAGTGTAGATTTGTTGGTGGGTTTGGGGGAACACATCTCCTCCTGGCATATTTGAACACATTCTC

TTCCTCTTCGGCTGATGTTCTGTCTTTGACCTCGTTCTTCTCCCGAGTTTTCACTGAGAGTCCTAAGAACCTGCGGCCCTGTGCATGCTGGCTGCGTTTA

TTTCTTTGCACCAGCAGTCAGAACAGTTTCCCCTTTCTACGAGACATGGAAACTTCAAGAGAGAGAGAGAGAGTGATGTCTATTGTGTTTCTGAGCAACC

TCATTGAATGTAATTGTTCTCGAATCAGCAAACATTGGATGGTTTGGAGGGAGGGTTTGATAGCTTTCCAAACAGAATTAAGGTTTCCAAATGTTAGTTT

TAGTGTTTGTAATTATTTGAAGCCTTATTTAAATCCTATTAAGGAGCACACCATTCTAATTGTTATTTGCACTAATGAAGTCTTTGCCATTGTCATAAGC

TTCGATGTGTGTTTTAGCGTCCATTGACATCTCTCTGGAAAAGGCTGTTGTCGCCTCTCGTTTAGTCCAGTTCTCCCGGTCAGTAGGATGAGTCTCTACA

TTTTGTCTAGTTCTCCTTTCATTGTGGGTCCCGTTTTGCCCTCTTTGATAGCTCTGGTTTCTGCCTTACTGAGGGGAGTTCTTAAAGCTTTATACCTATT

CACTGACCATCTGAAGCTGGGGGAGATAGGAGATAATACTTGATCAAGTGGGTGTCTTTGTATTTATTTCTTTGAGGGAGGGGTTCTAGAGATCTTCTCT

TCCCCCTTTTCTTTTATAAAGTCCCTTTACGTCTCCTGAGATCTTGAGGGAAACTGACAGGCAGAATTGTTCCCAGATTGAAGATAACCATGCCTGTTCA

AAGCAGGTGTCACTGTAGAGCAGGAACCAGGAAATACCTAGGTAGCTCTGTTGGAAGAAGGGAGTCCTATTATCTGACAGGAACTATTTGCCAGATTTGG

GTGCTTCAGGGTGTGTTGGCCCCTGTTTGGGTGTGAACTCAAGGCAAACCGTGGTGCTTGAGTCGTGGACGGCCCTGCTGACATAGATGACACCGATGAT

GTCTGCTGATGGAAGAGTCAAGCAAGCAACAGTGGCTGTTTTGGTCTTGAGTGTCCAGACTCATATAGGTTGGATTTTGGCCAGTTGGAATCAGGCTCTT

GGAGTTTTGCATGGGAATTAATGTAATGCTTATAAATCACTCAACAATCTCAAGTCAAACACAAAAATAAAAGAGAAACATACTGGCCTTGGAA
Translation
MKMAAPTASKAASLGCNNKPAFPELDFRSGARVEELNKLIQEFTRHDQREYDDQRALEIHTAKDFIFSMLG - UNI29873 - GMVQKLDQKLPVANE

YLLLSGGVREGVVDLDLDELNVYARGTDYDMDFTLLVPALKLHDRNQPVTLDMRHSALCHSWLSLRLFDEGTISKWKGCCTIADHINGATNYFFSPTKVA

DWFYDSISIVLSEIQKKPQRGMPKVEKVEKNGTIISIILGVGSSRMLYDIVPVVSFKGWPAVAQSWLMENHFWDGKITEEEVISGFYLVPACSYKGKKDN

EWRLSFARSEVQLKKCISGSLMQAYQACKAIIIKLLSRPKAISPYHLRSMMLWACDRLPASYLAQEDYAAHFLLGLIDDLQHCLVNKMCPNYFIPQCNML

EHLSEETVMLHARKLSSVRSDPAEHLRTAIEHVKAANRLTLKLQRRGSTTSIPSPQSDGGDPNQPDDRLAKKLQQLVTENPGKSISVFINPDDVTRPHFR

IDDKFF

For any suggestions or comments, please send an email to unitrap@crg.es