Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051111 (Sv2c)
Chromosomal location
Chr 13: 96731235 - 96858821 (-)
Description
synaptic vesicle glycoprotein 2c Gene [Source:MGI Symbol;Acc:MGI:1922459]
UniGene
Mm.441155 
MGI
MGI:1922459 
Uniprot/SWISSPROT
Q69ZS6 
Uniprot/SPTREMBL
A2RSH4 Q3UVQ0 
Human Ortholog
ENSG00000122012 (SV2C)
Omim not available
UniTrap UNI13839
Vector Insertion
Chr 13: 96731419 - 96745942
Public Clones CMHD-GT_226D2-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055677
Sequence
CAGCCGAGCTGCTGAACATTCTCCGTGGACTCTTCCCTGCCACACCTTGCCCATCAGCCGAGATAAAATGGAAGACTCCTACAAGGATAGGACTTCACTG

ATGAAGGGTGCCAAGGACATTGCCAAAGAGGTGAAGAAGCAGACGGTGAAGAAGGTGAACCAGGCAGTGGATCGGGCCCAGGATGAATATACCCAGCGGT

CCTACAGTCGGTTCCAGGATGAAGAGGACGATGATGACTACTACCCACCTGGCGAAACCTACAGTGGGGAGGTCAATGATGATGAAGGCTCAAGTGAGGC

CACTGAGGGTCACGACGAGGAGGATGAGATCTATGAAGGGGAGTACCAGGGCATCCCCAGCACGAACCAGGGGAAAGACAGCATCGTGTCTGTAGGACAG

CCCAAAGGTGATGAGTACAAGGACCGCAGAGAGCTAGAGTCAGAGAGGAGGGCTGATGAGGAAGAGCTCGCCCAGCAGTATGAGCTGATAATCCAAGAGT

GTGGCCACGGCCGTTTCCAGTGGGCCCTTTTCTTCGTCCTGGGCATGGCTCTCATGGCCGATGGCGTGGAGGTGTTTGTGGTGGGCTTCGTGCTACCCAG

TGCAGAGACAGACCTATGCATACCAAATTCGGGATCTGGATGGCTAG GTAGCATAGTGTACCTCGGGATGATGGTGGGGGCGTTCTTCTGGGGAGGACT

GGCAGACAAAGTAGGAAGGAAGCAGTCTCTTCTGATTTGCATGTCTGTCAACGGATTCTTTGCCTTCCTCTCCTCATTTGTCCAAGGTTACGGCTTCTTT

CTCGTCTGTCGGTTGCTTTCTGGATTCGG GATTGGAGGCGCCATTCCCACTGTGTTCTCCTACTTCGCTGAAGTCCTGGCCCGGGAGAAGCGGGGTGAG

CACCTCAGTTGGCTCTGCATGTTCTGGATGATTGGCGGCATCTACGCCTCCGCCATGGCCTGGGCCATCATTCCCCACTACG GGTGGAGCTTCAGCATG

GGTTCAGCCTACCAGTTCCACAGCTGGCGCGTCTTCGTCATCGTCTGTGCGCTCCCGTGCGTCTCCTCTGTGGTGGCTCTCACCTTCATGCCAGAAAGCC

CTCGGTTCTTGCTGGAG GTGGGAAAACATGATGAAGCCTGGATGATTCTGAAGTTAATTCATGACACCAACATGAGAGCCCGGGGCCAGCCAGAGAAGG

TCTTCACG GTAAATAAAATCAAGACTCCCAAACAAATAGATGAGCTGATCGAAATTGAGAGCGACACGGGAACCTGGTACAGGAGGTGTTTCGTTCGGA

TCCGCACCGAACTGTACGGA ATTTGGCTGACATTCATGAGATGCTTCAACTACCCAGTCAGGGAAAACACCATCAAGCTTACGATTGTCTGGTTCACCC

TGTCCTTCGG GTACTATGGGTTGTCCGTTTGGTTCCCTGATGTCATTAAACATCTCCAGTCTGATGAGTATGCACTGCTAACTAGGAATGTGCAAAAGG

ATAAATATGCAAACTTCAGCATTAACTTTACCATGGAGAACCAGATCCACACTGGAATGGAATACGAGAACGGCAG ATTCCTCGGAGTCAAGTTCAAAT

CGGTAACCTTCAAAGATTCAGTGTTTAAGTCCTGCACCTTTGACGACGTGACCTCAGTCAACACCTACTTCAAGAACTGCACGTTTATTGATACCCTTTT

TGATAACACAG ATTTTGAGCCCTATAAATTCATAGACAGTGAATTTCAGAACTGCTCATTTCTTCACAATAAGACGGGGTGCCAGATTACTTTTGATGA

CGACTATAGTGCCTACTGGATTTACTTTGTCAACTTTCTTGGGACATTGGCAGTGTTGCCAGGAAATATCGTGTCTGCTCTCCTGATGGACAGGATCGGG

CGTTTAACGATGCTAG GAGGCTCCATGGTGCTCTCCGGGATCAGTTGCTTCTTCCTGTGGTTTGGCACCAGCGAATCCATGATGATAGGCATGCTGTGC

TTGTATAATGGGCTGACCATCTCAGCGTGGAATTCTCTCGATGTCGTCACGGTGGAACTGTATCCCACAGACCGGAG - UNI13839 - AGCAACGGG

CTTCGGCTTCTTGAACGCCCTCTGTAAAGCGGCGGCCGTCCTGGGAAACTTAATCTTCGGCTCCTTGGTCAGCATCACCAAAGCCATCCCCATCCTGCTG

GCTTCCACTGTGCTCGTGTGTGGAGGACTCGTGGGGCTGCGCCTGCCCGACACACGAACCCAGGTTCTGATGTGA
Translation
MEDSYKDRTSLMKGAKDIAKEVKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEEDDDDYYPPGETYSGEVNDDEGSSEATEGHDEEDEIYEGEYQGIPSTN

QGKDSIVSVGQPKGDEYKDRRELESERRADEEELAQQYELIIQECGHGRFQWALFFVLGMALMADGVEVFVVGFVLPSAETDLCIPNSGSGWLG GSIVY

LGMMVGAFFWGGLADKVGRKQSLLICMSVNGFFAFLSSFVQGYGFFLVCRLLSGFG GIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAM

AWAIIPHYG GWSFSMGSAYQFHSWRVFVIVCALPCVSSVVALTFMPESPRFLLE VGKHDEAWMILKLIHDTNMRARGQPEKVFT VNKIKTPKQIDEL

IEIESDTGTWYRRCFVRIRTELYG IWLTFMRCFNYPVRENTIKLTIVWFTLSFG GYYGLSVWFPDVIKHLQSDEYALLTRNVQKDKYANFSINFTMEN

QIHTGMEYENGR RFLGVKFKSVTFKDSVFKSCTFDDVTSVNTYFKNCTFIDTLFDNTD DFEPYKFIDSEFQNCSFLHNKTGCQITFDDDYSAYWIYFV

NFLGTLAVLPGNIVSALLMDRIGRLTMLG GGSMVLSGISCFFLWFGTSESMMIGMLCLYNGLTISAWNSLDVVTVELYPTDRR - UNI13839 - RA

TGFGFLNALCKAAAVLGNLIFGSLVSITKAIPILLASTVLVCGGLVGLRLPDTRTQVLM

For any suggestions or comments, please send an email to unitrap@crg.es