Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051184 (Zfp524)
Chromosomal location
Chr 7: 4967103 - 4970088 (+)
Description
zinc finger protein 524 Gene [Source:MGI Symbol;Acc:MGI:1916740]
RefSeq_dna
NM_025324 
RefSeq_peptide
NP_079600.1 
UniGene
Mm.19974 Mm.467415 Mm.468055 
MGI
MGI:1916740 
Uniprot/SWISSPROT
Q9D0B1 
Human Ortholog
ENSG00000171443 (ZNF524)
Omim not available
UniTrap UNI23051
Vector Insertion
Chr 7: 4967163 - 4969038
Public Clones IST14620E3 (tigm) IST14203C9 (tigm) IST11653B2 (tigm) IST14991A4 (tigm)
IST12285H1 (tigm) IST14853F12 (tigm) IST13671G7 (tigm) IST15047D2 (tigm)
IST12284A1 (tigm) IST15018G5 (tigm) IST14514F11 (tigm) IST13889F12 (tigm)
Private Clones OST278117 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000086349
Sequence
GCCCGTCGCCCCCGGCGCGCGCGCGCGTACACACGCGAGCCCAGGCAGCATGCAAATGAG - UNI23051 - CCGGCTCCAGTACCCAGACTCGAGCT

CCCCACTTCTCAATGGACAACCCCAGCTCAGACCCGTTGCCTTCAACTTTGTCTGGGGAGGAAGAAAAACCTCTGGCCTTACTGCCTCCTGTTCCCCGGG

GGCGCCGAGGCCGACCTCCAGGGGGAGCCACCACCTCCAATCGGACTCTCAAGTCCTCCCTCCCTCGAAAGAGGGGCCGTCCCCCCAGATCAGAGCAGGA

AACCCCGTTGACAGCACCAGTGGACAGCGGTGGCAGCAGCGATCTTCTGTTGATCGATGATCAGGGTGTTCCTTATACAGTTCCTGAAGGGTCAGCAGCA

GATGGGCCCCAGGGCTCTGGTTCCAAGAGGGCTCCGCACTTCTGTCCCGTGTGCCTGAGAGCCTTCCCCTACCTCTCTGACCTGGAGCGCCACAGCATCT

CACACTCAGAATTGAAGCCACACGTGTGCAAAGATTGCGGCAAGACCTTCAAACGGTCCAGCCACTTGCGGCGCCATTGTAACATCCATGCTGGCCTTAG

GCCCTTCCGTTGTGTGCTCTGCCCTCGCCGTTTCCGAGAGGCAGGGGAGCTCGCACATCACCACCGCATCCACTCTGGTGAGCGACCTTACCAATGTCCC

TCATGTAGGGTGCGCTTCACCGAGGCCAATACTCTCCGGCGCCATTACAAACGCAAACACCCAGAGCTTGTGGGGATGCCTGTGCGCCTGTGCCCCCCAA

ACCCAAGAACCCAACCGCTGTGGGACGACGACGAGGGCATCCCTGTTCAAGAAGGGGTACAGGAGGAGAGTCCTGAAGGAAAGGAGCCTACTTGGCCCAT

ATCCTCCACCACTTCTCCCCTGTCTGGGTTTACAGCAGGGGGTTCAGCTGGTGCTGGGCGCGGGCAAGAAGGCCAAGACACCCTTGTTTCTGGTGGTATT

CCCACCATGGAAGGGGATCAAAAGCAGGGACCTAAACCTCTGGGTCCTGGTGCCATTGGGCACCCTCCTGTGGACTGAGAAGCTCTGGGAGGCATGGGCT

GTGGAAATAAATCCCTGCCTACTG
Translation
 - UNI23051 - MDNPSSDPLPSTLSGEEEKPLALLPPVPRGRRGRPPGGATTSNRTLKSSLPRKRGRPPRSEQETPLTAPVDSGGSSDLLLIDDQGV

PYTVPEGSAADGPQGSGSKRAPHFCPVCLRAFPYLSDLERHSISHSELKPHVCKDCGKTFKRSSHLRRHCNIHAGLRPFRCVLCPRRFREAGELAHHHRI

HSGERPYQCPSCRVRFTEANTLRRHYKRKHPELVGMPVRLCPPNPRTQPLWDDDEGIPVQEGVQEESPEGKEPTWPISSTTSPLSGFTAGGSAGAGRGQE

GQDTLVSGGIPTMEGDQKQGPKPLGPGAIGHPPVD

For any suggestions or comments, please send an email to unitrap@crg.es