Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051341 (Zfp52)
Chromosomal location
Chr 17: 21672503 - 21699565 (+)
Description
zinc finger protein 52 Gene [Source:MGI Symbol;Acc:MGI:99199]
RefSeq_dna
NM_144515 
RefSeq_peptide
NP_653098.2 
UniGene
Mm.296100 Mm.412368 
MGI
MGI:99199 
Uniprot/SPTREMBL
O88225 O88240 O88250 Q60918 Q8BJ45 Q8VDL3 Q9QWM8 
Human Ortholog
ENSG00000198633 (AC010320.10)
Omim not available
UniTrap UNI31343
Vector Insertion
Chr 17: 21675635 - 21691948
Public Clones (sanger) IST13177D2 (tigm) IST10090H2 (tigm) IST12387D12 (tigm) IST13898A6 (tigm)
IST11838C9 (tigm) IST13845B2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000079242
Sequence
CACTCGCCCAGAAATAGAGGATGGAAGATGTGGTACATTGGCTGGGTGTAGAGGAAGGGTGTAGTGTGGGTGGGATTAGAAGACTGAGGCCAGGGAAGCT

AGGAAGCAAGGTGTGTTAGCTTGGGAAGTGGGACTAAAAAGTCAAAGTCTGGAGTGTCAAGAATCCGGTACAAGACTGAGCTGGGGTTGGGGTTGAGGGG

TAGAGCGGCTGCACAGTGTGGAATCGCGTGGTGGAGACCTGAGTATGGAGGAAACGGCGGGGCTCGCAGAACCGGAAAACTTACCTATACCGCAG GGCT

CACTGAACACCCAGACCTCAGACCTGCTCACCTGTGAAACATAACAAAGAGCCCTAGAAGGTGGAGAGGGAGGAGACAGTACCTAAGGATCCAG - UNI

31343 - ACCACAATCTGGCTATTCATTGTTATTCAAAGAGAAAATCAAAGAAGAGAAACAGGAAGAAATGGCCAATTCTCCAGTAAACACATCCCAG 

GGTCTGTTGACATTCCGAGATGTGGCTGTGGACTTCTCCCAAGAGGAATGGGAATGCCTGGACTCTGCTCAGAGGGCTTTGTACATTGATGTGATGGTAG

AGAATTATAGCAACCTGGTCTCTGTGG AGAACTACTGCATATGTGATACTGTCCATCAACCTGTGAGGACTGAAAAGGAGTCTTGTCCATGTAATGAGC

TCAACGAAATGCTTCATGAACCCTCCAACTGTGCACTTTATAATAGAAGTGACACTACAGAAGCCTCTAACAACTACAGATGCTGTAATGAGAAGGATGC

CTCTGTTGACTCATCAAACGCAGATAGACACAAAAGTATGCACATCGGAGAAGAAGACACTTGCCAATCTAAAGACTGTGAGAAATCTTTCAATTTGTGT

TCCAACATTCGGCAATATCAAAGACTCAACACTGAAAAGAAAGAGCACAAGCAGGATGAACATGATGACCATTTCAGCTCTCTATATAGTCTCATGCAAG

AAACAGTTGACATGGAAGAAAAGCCATATCAATGTGGGCACTGCAGGAAATACTTCAGTACCACCTCAAGCCTCAGTATCCATCAGAGAATTCATACTGG

AGAGAAACCTTACAAATGCAATATTTGTGGCAAATCCTTTAATCAGTGGTCAAGCCTTAAAACAGATCAAACACTGCATACGGCAAAGAAACCATACAAA

TGCAAAGAAGGTGGAAAGTTACTTGTGCAGTTATCTGCACTTAAAAGCCATCAGAGAAGGCATACTGGAGAGAAGCCTTACAAATGTCAGCAGTGTGACA

GATCCTTTGCCCACTGTGCATCATTAAGATGGCATCAGAAAATTCATTCTCCTGAGATACATTATGAATGCAAAGAATGTGGTAAGTCCTGTTTTGAATT

ATCACATCTTAAAAGGCATTGCAGAATCCATACTGCCGAAAAGCCTTACAGATATGAGGTATGTGATACATCTATTACTGTGAATTCAACTCTTAAAACT

CATCATAAAATTCATACCAGAGAGAAACCTTACAGATATAGGGAATGTGACAAATCTATTACCAAGTGCTCATATCTTAGAACATATCAGAGAGTTCATA

CTGGAAAGAGACCGTATAGATGTACAGAATGTGACAAATTTTTTACTAAGCACTCAAATCTTAGACAACATCAGAAAATTCATACTGGAGAGAAACCTCC

CAAGTGCAAAGATTGTGATAAATCCTTTCTCCGGATTTCTAGTGTTAGAATACGTCAGAAAATTCATGCTGGAGAGAGACGTTATCGATGTAAGGAATGT

GGCAGATCTTTTACCTGGTTCTCAAATCTTAGAGTCCATCAGCGAGTTCATACTGGAGAGAGACCTTACAGATGTAAGGAATGTGGCAAATCTTTTACTA

CGGGCTCAAATCTTAGAGTCCATCAGAAAATTCATACTGGAGAGAAACCTTACAAATGCAAAGACTGTGACATATCCTTTCTGTGGATTTCAAATCTTAG

AACACATCAAAAAATTCATACTGGTGAGAAACCTTACAAATGCCAGGAATGTAACAAATCTTTCACAAGGTGCTCATATCTTAGAGACCATCAGAAAATT

CATACTGGAGAGAAACTTTACAAATGCAAAGACTGTGACATATCATTTATGTGGATATCAAGTCTTAGAAGACATCAGAAAATTCATACTGGAGAGAAAC

CTTACAAATGTAGAGGATGTGAGAAATCCTTTACTCAGTGTTCAACTCTAAGAGACCATCAGAAAATTCATACTGGAGAGAAACCTTACAAATGCAAAGA

CTGTGGCATATCCTTTTTGTGGATTTCAAGTCTTAGAAGACATCAGAAAATTCACACTGGAGAGAAACCTTACAAATGCAAAGACTGTGACATATCCTTT

CTGTGGATTTCGAATCTTAGAACACATCAGAAAATTCATACTGGAGAGAAACCTTACAAATGTCAAGAATGTAACAAATCTTTTACTAGGTGCTCCTATC

TTAGAGTCCATCAGAGAACTCATTCTGGAGAGAAACTTTACAAATGCGAAAACTGTGACGTATCCTTTATGTGGATTTCGAATCTGAGAAGACATCAGAA

AATTCATACAGGAGGAAAACATTCCCTTGTAAATAATGTGACATAACATATATCTGGTATTCTCTGCTTGCAAATCAAATGAGATAAGTGATTGCAACAT

AAAGATAACATAACTAGATGGTTAAAGCCTTTAATGAGGATTGAAATCTTACAAAATGAATCAGAGTTTATATTAAAATAAAATTCTGCAAATGTAACTG

TGGGGAAAGCTTTTTATTTCTTTTAATATGTATGCCTGGCCTGTAAGTATTTCTGTGTACTACATGTATGCCTGGCGCACGTATAAGCCAAAAGAGAGCA

TCAGATCCCCTGAAGTTGGCATTATATACAGTTGTGTGTAGCTGTTTATATGTTGGGAATTGAACTCTTATCCTCTGGAATTGCAGCCAGTGCTCTTAAC

TACTGAGCCTTCTCTGCCATCCCTGAGAAAAGCTATAACAAAAACATATAGCTTATTCAACATCCAACCATTCATAATAATGACAGGTAAAATGGTACAT

GCCTTTAATCACAGCACACAGAAGACAGAGATCACTGTGAATCCAGTTCCAGGACTTCCCGAACTACATAGACCCTTTCTC
Translation
  - UNI31343 - MANSPVNTSQ GLLTFRDVAVDFSQEEWECLDSAQRALYIDVMVENYSNLVSVE ENYCICDTVHQPVRTEKESCPCNELNEMLH

EPSNCALYNRSDTTEASNNYRCCNEKDASVDSSNADRHKSMHIGEEDTCQSKDCEKSFNLCSNIRQYQRLNTEKKEHKQDEHDDHFSSLYSLMQETVDME

EKPYQCGHCRKYFSTTSSLSIHQRIHTGEKPYKCNICGKSFNQWSSLKTDQTLHTAKKPYKCKEGGKLLVQLSALKSHQRRHTGEKPYKCQQCDRSFAHC

ASLRWHQKIHSPEIHYECKECGKSCFELSHLKRHCRIHTAEKPYRYEVCDTSITVNSTLKTHHKIHTREKPYRYRECDKSITKCSYLRTYQRVHTGKRPY

RCTECDKFFTKHSNLRQHQKIHTGEKPPKCKDCDKSFLRISSVRIRQKIHAGERRYRCKECGRSFTWFSNLRVHQRVHTGERPYRCKECGKSFTTGSNLR

VHQKIHTGEKPYKCKDCDISFLWISNLRTHQKIHTGEKPYKCQECNKSFTRCSYLRDHQKIHTGEKLYKCKDCDISFMWISSLRRHQKIHTGEKPYKCRG

CEKSFTQCSTLRDHQKIHTGEKPYKCKDCGISFLWISSLRRHQKIHTGEKPYKCKDCDISFLWISNLRTHQKIHTGEKPYKCQECNKSFTRCSYLRVHQR

THSGEKLYKCENCDVSFMWISNLRRHQKIHTGGKHSLVNNVT

For any suggestions or comments, please send an email to unitrap@crg.es