Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051344 (Plekhm1l)
Chromosomal location
Chr 1: 64835695 - 65003398 (-)
Description
pleckstrin homology domain containing, family M, member 3 Gene [Source:MGI (curated);Acc:Plekhm1l-001]
RefSeq_dna
NM_001039493 
RefSeq_peptide
NP_001034582.1 
UniGene
Mm.239534 Mm.402115 Mm.409896 Mm.416199 Mm.436441 
MGI
MGI:2443627 
Uniprot/SWISSPROT
Q8BM47 
Human Ortholog
ENSG00000178385 (PLEKHM3)
Omim not available
UniTrap UNI34305
Vector Insertion
Chr 1: 64984270 - 65003399
Public Clones IST13969C2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30750
Vector Insertion
Chr 1: 64968123 - 64985114
Public Clones IST14421H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7297
Vector Insertion
Chr 1: 64866668 - 64907760
Public Clones RRT428 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097713
Sequence
CTGGAACTCTGTGTAATCGGATCCTGTTGCCGGGCTGCCGCGGGGAAGCTTTTGGGCGTGGGACCGCGAGAAGCCGCTTGTAAACAGAGCCGGGCCGGGA

TGGTCGGCAGCTGGAGCGCAGTCGCTGGCG - UNI30752 - - UNI34305 - GAAACTGAGGATTGGCCATACATTGCTTTGGCAAACACCGCCC

GCCCTGCTGTCTTCCCTGAGATCTCTAAGAACAAGGCCCGTGCTCCTGTGCTTAGCCTTCTCTAGGCAGCCAGATGAAGATTGCTTCCTCTTGTTTTCAC

AGTTGTATTGCTGAACCACCTCTCTCTGTTGGCTGAGTGTTCATGACACCTCTTCCTGAAGCAGGTTAGAAGCTTGGACCCTGTGTCATGGAAGCTTTGG

AAGTAGATGACATCAGCCCCGCCTTAGAGGTTACTGAGGATTTCTTTAGTACTTTTGACAGTAAGCTGGAAAAGGCTGTCCAACAAGCAGAGGTTTACGG

GATCCAAGAAGTCCCTGAACTGGTGGGGCATGAGGTACTTGGTAACATAGCAGATAATGGTGCTTTAAGAAGCGTTGCTTCCCTGGGCAAGGGGACAATG

ATTTGGGACCACTGTAAGAGCAGGCTTTTAGAAACCAAAGCTCAAAATGTCTTCCCTGCCAAAGAACAGCTTATGGTCCAGAGAGGGACAGCCCCAGATA

ATCTTTCCTGGATGGCACAAAAGGAAGCGTCAACCTTCAATTTTTTCAACATCTGTCAGCGTCGGAGGGACAGACCTCGTTCTGTGAATGACTTATTGGA

TGAGACCACAACTTTCAAGCCAGGCCATGCTCGGTCAAGGTCCGATGTTACCCACGTAGACTGGCGGGTAGTCCTTAGCACCATGCCTTTGCAGCAGCAG

CAGCAGCAGCAGCAGGCGTCCCTTCAAGGCATTCACTTTCCCGGGCCATCTTTTCTGTTGTCTTCACCCAGCAAGGTTGAAGATGCTCAAGGAAATACAG

 - UNI30752 - - UNI34305 - AACACAAGCAGACATTCCCAAACATCCTGAAGAAGGGTTATCTGGAGATCAGGAAGAACCATGACAGTTACTG

GCAGAGCTGTTATGCAGAACTCTCACCCTACAACTTAAACTTCTACAGCCTTGATAGCAGTGGCAATCAAAACCTGTATGCCACATACCAGCTTTCCCAC

TTCCAGAGCATCTCTGTTTTAGGCAATCTTGAAGCTAGGATGGTAGACACTGTTCTCTATGACAATTCTCAACTGCAGCTAAAGGCAGAGTCTCCATGGG

AGGCATTGGACTGGGGGCAGAAGCTCTGGGAAGTCGTGCATGCTGCTGTACCCAATTACATGGGACGGCAGGGTGAGATGGCAAACTCTCCAGGACTCAT

CCATCATGGTGACTGTGCACAGAACCACTGTTTACAGAAGAAATCCAGTGGGCTGCTGGCCTCCCCTGTCTTGGATAGCCCCAAACAGTACCAAAATATC

CTCAAATCAGGGACACTCTACAGACTGACTGTCCAAAACAACTGGAAGGCCTTTACATTTGTGCTGAGCAAGGCCTATCTTATGGCTTTCCACCCCGGCA

AGCTAGACGAAGATCCCCTGTTGAGCTACAATGTGGATGTGTGTCTGGCTGTGCAGATAGACAACCTGGATGGTTGTGACTCTTGCTTTCAAGTCATTTT

TCCCCAGGATGTCCTCCGCCTCCGGGCTGAGACCCGACAGAGGGCTCAGGAATGGATGGAGGCTCTGAAGACAGCAGCCAACGCTGCAAGGAGTTCTGAG

CAAAACCTGCAAGTCACACTGCGGAACAAGCCCAAGGATCAGCTAGATGGCCGCGAGCTGCGGAAGAACAAACGCCAGTCTGTGACCACCAGCTTCCTGA

GCATCCTGACCACGCTGTCTTTGGAGCGAGGACTCACTGCTCAGAGTTTCAAATGTGCAG - UNI30752 - GGTGCCAGCGATCTATTGGTCTCTCT

AACGGAAAGGCCAAGGTGTGCAATTATAGCGGGTGGTACTACTGCAGCAGCTGCCATGTGGACGACAGCTTTCTCATCCCAGCACGCATAGTTCACAACT

GGGACACCTCAAAATACAAG GTATCCAAGCAGGCCAAGGAGTTTCTGGAGTATGTGTACGAAGAACCTCTGATCGACATCCAGCAGGAGAACCCCATGC

TGTACCTCCATGCTGAGCCACTGGCCACCGTTGTACGGCTTCGACAGCGGTTGAAGTCACTCCGGGCCTATTTGTTCAGCTGCCGGGCAGCAGTGGCGGA

GGATCTGCGCCGCAG AATTTTCCCCAGAGAATATCTCCTTCAACAGATCCACCTGTACTCTCTCGCTGACCTGCAGCAG - UNI7297 - GTGATAG

AGGGAAAGCTGGCTCCATTCTTGGGAAAGGTCATTAAATTCGCCACCGCGCATGTCTACAGCTGCAGTCTCTGTAGCCAGAAAGGGTTCATCTGTGAGAT

CTGTAACAACGGCGAGATCCTCTACCCCTTCGAGGACATTTCAACAAGCAG ATGTGAAAGCTGTGGAGCTGTCTTCCATTCTGAGTGCAAAGAAAAGTC

TGTCCCCTGCCCACGGTGTGTCCGACGGGAACTGCAGAAGAAGCAGAAGTCCTTCTGGCGGCAGCTGAACGTGGACGAGAGCCTGGAGGAGGCATGCGCC

ATGTTCGAGCTGTCCTACCAAAGCACCTGACTGTAGGCCAGGATGCACTCTCCACCGCCCAAGGGGCTGCCCGTGCCCATGCAGATGAGGCTGTTCCTTC

TTCAGCTAGATGTAGATAGATAAGTTATTTATTTATATTATATACACCTATACGTCCTGTACGTATGATGCTTTGTATAACTCATTGTCCAAGAAGTTCA

CAAAGATCTTGTGGATGAACTCCTACAGATAGCTGAGTTACCCTTGGCCATGACATTTGCTGCTTGCTCCCAGCAAATGTGATTGACACACATTGCTCTG

TAGTTCAGACCCCTTCATACACACTGGCTCTCAGGGCCAGTTGACTGCACAAGTATTGGAGGAAACACCTCTCACAGCAAAGCTTTGCATTGCTACTGAC

ATTTAGCCTTTGCTGGGGAAACTGAGGTAGAGCCATTGTCATCTGCTTCACAAGGACATCCCTAAAACACAAGAATGTTTCTGGATACTTCCAGGCCCAG

AGTCTTTGGCAGAGATGGGAAGAGTGAAGCAGAGCCACATAGCAGAAAGCGAGAGGCCCCTTCCTTCAACAGAGAGCATCAGGAACTGAGCTGCGTTGGG

TGTGAACTCAGTCCCTGAGAGAGAGTACAGAAAGCGAGGACCTCAGTGGCCAGTCACTTCATGTCGTTGTCTGTTGGCTGGTACGAAGCCCAGCACCTTC

CTGATGATCAGAGTCTACAATGCCTGCCAGAGAGTGCACATGGGTGCCCTAAGAACAGTTCCAAGCGTGGAATGGAGGACACTGGTCATGTTTTTCACGG

TGCTGCCCAGGAGGAAGTGTCCCAGGATTGCACTCAAGCGCATCAGTGCATAGTCTGCTAGGTAGAGTTTACTGCACGCATCTTGGAGGACCGGATGTTT

CCTTCCCCAGAGCCCTCCATCGGCAGGACCCACCTGTCGTTTGAATGTTTTATTTCTCCTTGTCCTTCACAGCACTTTTGACCTTTATTCAGTCCGCGTA

ACTACTCTTGCTTTTGTATCCTGGATGTTTTGTTTGTTTGGGATGGGGACATATTTTAAGACAGGGTCCTGCTATATATCCCTGGCTGGCCTCTAACCTG

TGACCCTGCTGCCTCATCCTCCAAATGCTGGGACTATAGGTATGCACCATCATACCTGGCTTTACTTGTTTTTAATTATTTTTAAAAAATATTTAAAAGT

AAAAATTATGTAATTATTAAAAGTTATTAAGAAGTAACATTTTGAAAAATACAAACCTAAACTATTAAGAAAATACCAAACATAAATAGAATTAATGAAT

TAATATTATCGAAATAAGTAGATATATACATATATAATTGCCACCTTACAGTAACACAAAGAGTAACTAGCGTGGTAGGAATGGGAAGTGGATCACTTCG

CTCTTTGGAGGGTAGTGTACTCCCACTGTGATCCCCTTCCTTGTAAGAGCCTGCATAGTTGTCACTGTGACCAAGATGGCTGCTAGGAAGGCACTGAGAC

CCTGGCGGCCAGCATTCCTTCTTCCTTAACTCTTTCCAAGGCAGGAGAATGGACTCACCAGGAAGTACTTGTTTGTGTCTTTCACCTGGAGCTGGTGTTG

CCCACTGCCGCCCATGCTTCTGTCCTTTGGGATTTTCACTGCTGTTCAGATCAGGGGAAACACTGGCTCACAGAGAACGCAGGGGTTCAACTCCAAGTTG

CTCCCACAGGCACCAGCTCTCGATGCTTCAGTCTAGTGGGAGACATTCAGCTGACTTGTGCAGTTAGAGGCAAGCATTTCACCTCTTGGCCCACACCATT

TCCTTTGGCCCCAGACCATGCAGTTGAACGCCACACGTGTGTTCATTTCCTAGCTACCCGGAAGCTATAGCCAAGGCATGAAACTTGGTAAAAGGCCAGG

GCCCTATTTACCAGACACCTCACGGTGCCTTTTATAAACTCTTGGGAAGGCAGGTTGACCTCACTGGAATGAGTGGTAGGGAATGTTGCGCATAAAGGAC

AAAGGTGGGAAGTCTCAAACACTTGGCAAAACAGACAAACAGATTTGAGTCTCTCTCTTCCTCCTCTTGTTCATGAAATACAGTATTTATATTTTCCAGC

CTCAGAGAACAGAACATGATCTTTCACTGGAGAATTCTAGACCTGCTTATTATGAAACAGATGTGCTCCCGTGGCACAGTGCCTTCTCCCTCCACCCCCA

GTCCCTGTCACCGTAGCTTACTCTTGACCTTTGCTGAAACTAATGTATCTGTGATTCTGACTGTCAGAGACGCCATTCCCAGCACACTGAGCACAGAGAC

TTGAAGAACAGAGCCCCCGACCCCAGGTTGGCCCCATGTCCTGCCCCAACTCACAGGTGCCCAAGATTAGACCTAATAAAAGCCGAGGGTGAAATCTGGA

TCCCTGTTTAGCACACCTGAGTTGTCTGTCCCCACTGCCCCTTAGAGGGCCTTGCTGTGTGTGAGCGGACCTTGGACACTCCTAAGACCTTTCCCTGGAC

ATTGCTTCGTGTTTATTTTTTAAAGGGAAAGATAAGCATGCTGTCACTCATGATCTGGAATTGGAGCCATGTCCTGCTACTTCTGTTTTCACTATGGTCC

ATGCCCGCTCAGGACTCACAACAGCGTTCTCTGCCACCACCACCGGAATCTGATAGGACACCGTGGAGCCAGATCAGGAGTTGGATCTGCCATGAAAATT

CAAAATTGCTATTTTCAGCCCAGAATGTCTCAGAGTGCATGAAGGCCCTTACTGTTTTCAGGTCTAACAAATGACTTGGTGCAGTGTTAGGTAGTTGTTC

CACTGCTTAGAAACCATCGAAACAAAAGCAAGCCTGTGCATTTCCACCTCCTTTTTTTTCATCTCAGTAAATACCATACACGTAAAGCATAATGGAAAAC

GGTCCATTAATCTCCTGGAGCTGCTTGCAAAGCCCAGGGAACGGCTTTTCACTAAACAGCCATTCCCTGGTGTAGCACAAGAATTCCCTCCTGCTAGTGC

CAGAAACTCATGTGTGACACCATCCAGCCCGGGGGAAGTGTTGGCACCCAACCCCACCGTTAAGAAACCAGTTCCTAAAATAGACCTGCATTTGCACCGC

AGTAGGAAGGCTGCAGGGTGCTCCAAAGGCAGTCAGCTCTGATGGGAGAGGAGTTCTTTCCAGGGCTGCCTGTTCCCAAAGTTGGACACAGCCTTATATG

AAAACCATGCAAACTCTGTCTTCCCCCTGACTTCATGTGCTGAATAACAGCCATCTTTTGGGAGTTTTTACATTTGATGAGCTGAAAGGTTAACTGCTTC

TTGATTCTTCTATAATAGGCCTCTACCAAAAAAAAAAAAAGGAGTGTGTGATTACAGTGCCTCGGGATTCGAAGGTTCCAATACAGTCTGAAATAGCCCC

GTGCTGTGATTCCCCTCAGCTGCCCCAAAACAAAGGTGTCTGTGTCACTCTGTCACTGTGGCTGAGTTGCAGCACACCCTCGGTGAGGTCTGGCCTGTCT

CTGCTTGTCATGTGTGCACACTGCACATGAGCACTGACAGATTGCTTTCTGCAACTCCTCCAGGAAGCTTGGCTTGCAGCCCTGCAAGTTCATTCTCCAT

CCGTGGCCCAGAGATCTCCAGACACAAACTACCTATGATAGCAGGAGCACAGTGATACAGGACCACAGTAATGCCACACACCCTGAGCACCAAGAGCAAA

GCCCGCTGCCAGCAAGGAAGTAGAGAAAAGTTCTGCTGCTAGTTCAGGGGAGCTCTGCCCTCTCACCCTGCAGATCAGCTCTGGGTCTTCTCCCAAGCTT

TGCTGAAATAGTCAGATTAGAAATTAGGCTTTGACCCTTAGTTGGAATACTGCCTGTTCCCAACACAGACTATTTTATTTTGTTTGATTTGGTTTTTCTT

ATGGTAAATAGGGAAGTGTGCAATATTGTTTTGGGAGTTTTCTACATGACTTTTCATCTTCTGAAATAATGTGGAGATGTCAGGAATTTGAGACAAAGGG

GAAAGAAGCTAGCCCTTTCTTCCTTGGCCACTTCTCCCTGGAGCCTCTGGCCCTTGTCATCCATTCCTTGGTACTGACTCAGTAGTGGTGGTGGGCATTA

GGAACGTGGCTCACTGCTCTGCCTGTCCCACTCGCCTGACCCCAGCATACTACAAGCTACGTGAGTAAACCCCTCAGCTAATCTAACCAATGCTGATCTC

TGTCACAGGGACAGTTTCTTAACAGTTAAGTTTTAGCACCCAGTAGTCTCTCTGTAGGCACTTCTGTCCTTTAGATTCAAAACTCTCTGACTTGAGGTTG

TTTGTTTGTTTGTTTGTTTGTTTTCTGGTATGTTTTAGTGGGTGCGGGGCTAAAACAAAAAAATCTACATCACTGTAAAACTCTGGGTGAAAGGGAAAAT

GTAGCTGAGCCTCTCCAGCATTTGCCAGTGTGTTTTATGTAAGATGGGTTCCTGGTGACCATGGCATGTAGCACTGTCTCCATAGAGTAGGCTCTGATGT

GATGGGAGGCACTAGTGAGAGGGACCCAGGCTGCTCTGCTAGGGCTCTGCTCTGAGGGAAAAGAGACGCTGGCTGCTGTCGTTTTAGAAAGCTCCCTAGT

GAAGCCACTTGTTTCCCAGGCCAGATGAACAAGACACCTAGGACAGCTCTTCCACAGTTGGGCCCATCTGGCCAGCCTTGGAAGCTGTAACCCAGCCCTG

TCCCCTCCCATGATTGCCTTGCCTGCTTGCTTCCTCAGCCCTGGGCCAGGTTTGAGGCTCATGTTAATAAACCACCTAGAGACCAACTGGCCAGCGGCCC

TTCCTTCCCACCGGTTCATCTCCCTGTAGGAGTGCCTTATAGTCTAGTCTAGTCTCTGACCCACTTGAAGCCTGCAGGACCCTTCAACCAACTATGGATC

CCTTCGCGCTTCCCTGCTGGCTCTTGTTCAGTACACAGCCCACCTGGAGCCTGTGTATTCCGAGATGCACGTCCACCTTTGCTTAACCTGGTGCCTTAAC

TTCACAAGTAAAGGGATTCACATTGCAAACGCATTATCTGAGTGAAACATCAGTTTCTTCGGTGCCATTGGCACTTTTACCAGGAAATACAATAGGCATA

ATCATACAATGTTTTGACTTTATTTTATGATGTTTCTCAGCCACTCTTTGTTTGCTTGCTTTCATTAACCAAACTCAGGGGAATGTCATGTCACCACAGT

CAATGGGGAAAGAAAGAAAACTAGCTATGCAGAAGTGAATGACAAAGTCTGTGAACTTAGTCTTTACTAGGTTCAGAAGTGACATCAACAGGAGGATTTT

TTTCCTTTATTGTATAAAGATTCTCTTTACTTGCCACCTGTGTTCCACGTAGAAGGTGGGAAGCCTCGGGGATGTGTGTGGATGACAGTGTCCCTATTTT

CGCCGGGGCAGTCCACCAAGCCACCGGATCAGGCCCTCATTGCAGTGAGCTCTGCCTCTGGTTACCTGTCCGGCTCTTACTGTAAACAGTCCTTACCTGT

CTCCAAGGAATGATAAAGGGAGGAGGACGCCAAGACTGCAGGTGAAGAGCAAGAGTGTGTGACGTGGATGGTCCTGTATAGCTCGTTCTCGGGCTCCTAG

CTCAGATCCGAGTCATTCCCCTTCCTTCTGCTCATGCGGTACAGAAGCAATCAGGATGTGCCTTTGAGCTGTTCCTTCTCTCTGTTAGTTATTCGCAATA

GCTAATGTGCTAGTTTACGTGGTCCCTGTTGTCTGGATCTGATTGCCTTTTTTGGTTAATTTATCCATATTTTTGTTTACATTATTTTTAAAGCTAGTAA

CTGTAATAGTATAAAATTGAAGTTGTGCTGTTGACAGGACATCTCTCTCTCTCTTTTTTTTTTACATTTATCTGTCACAATAATTTAAGTGCACCTGTTC

CTAATGTATAAAGTTCTCTCCCTCTCAATAAATGACAATGGAAGTA
Translation
 - UNI30752 - - UNI34305 - MEALEVDDISPALEVTEDFFSTFDSKLEKAVQQAEVYGIQEVPELVGHEVLGNIADNGALRSVASLGKGTMIW

DHCKSRLLETKAQNVFPAKEQLMVQRGTAPDNLSWMAQKEASTFNFFNICQRRRDRPRSVNDLLDETTTFKPGHARSRSDVTHVDWRVVLSTMPLQQQQQ

QQQASLQGIHFPGPSFLLSSPSKVEDAQGNTE - UNI30752 - - UNI34305 - EHKQTFPNILKKGYLEIRKNHDSYWQSCYAELSPYNLNFYS

LDSSGNQNLYATYQLSHFQSISVLGNLEARMVDTVLYDNSQLQLKAESPWEALDWGQKLWEVVHAAVPNYMGRQGEMANSPGLIHHGDCAQNHCLQKKSS

GLLASPVLDSPKQYQNILKSGTLYRLTVQNNWKAFTFVLSKAYLMAFHPGKLDEDPLLSYNVDVCLAVQIDNLDGCDSCFQVIFPQDVLRLRAETRQRAQ

EWMEALKTAANAARSSEQNLQVTLRNKPKDQLDGRELRKNKRQSVTTSFLSILTTLSLERGLTAQSFKCAG - UNI30752 - GCQRSIGLSNGKAKV

CNYSGWYYCSSCHVDDSFLIPARIVHNWDTSKYK VSKQAKEFLEYVYEEPLIDIQQENPMLYLHAEPLATVVRLRQRLKSLRAYLFSCRAAVAEDLRRR

 RIFPREYLLQQIHLYSLADLQQ - UNI7297 - VIEGKLAPFLGKVIKFATAHVYSCSLCSQKGFICEICNNGEILYPFEDISTSR RCESCGAVFH

SECKEKSVPCPRCVRRELQKKQKSFWRQLNVDESLEEACAMFELSYQST

For any suggestions or comments, please send an email to unitrap@crg.es