Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051346 (Spryd4)
Chromosomal location
Chr 10: 127646970 - 127648854 (-)
Description
SPRY domain containing 4 Gene [Source:MGI Symbol;Acc:MGI:1913951]
RefSeq_dna
NM_025716 
RefSeq_peptide
NP_079992.1 
UniGene
Mm.29694 
MGI
MGI:1913951 
Uniprot/SWISSPROT
Q91WK1 
Human Ortholog
ENSG00000176422 (SPRYD4)
Omim not available
UniTrap UNI19515
Vector Insertion
Chr 10: 127648448 - 127648764
Public Clones IST15042A6 (tigm) IST14461E11 (tigm)
Private Clones OST389813 (lexicon) OST308665 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000061995
Sequence
ACAAGATGGCGCTGCCCTTTGCACGCTGTTGGAAGTTGTACCGCTGGGGCACCAAGCGATGGGGGGTCCCTGCTGTGGAATCCCGGAGAG - UNI1951

5 - GCATCAGTTTCAAACTGGAAGAAAAAACGGCCCACAGCAGCCTGGCACTCTTCAGAGGCGACACGGGTGTCAAATATGGCTTGGTGGGACTGGAAC

CCACCAAGGTGGCCCTGAATTTGGAGCGCTTCCGGGAGTGGGCAGTGGTGCTCGGAGACACCACAGTCACCAGTGGCAGACACTACTGGGAGGTAACAGT

GAAGCGCTCCCAGCAGTTCCGGATAGGAGTGGCAGACGTGGACATGTCCCGGGACAGCTGCGTTGGTGCTGATGATCGTTCCTGGGTGTTCTCCTATGCC

CAGCGCAAGTGGCACAGCATGTTGGCCAACGAAAAAGCTCCAATTAAGGGTATTGGGCAACCAGAGAAGGTGGGGCTGCTGCTGGACTATGAGGCAAAGA

AGCTGAGCCTGGTGGATGTGAGTCGGATCTCTGTGATCCACACACTACAGACAGATTTCCGGGGCCCAGTGGCACCTGCTTTTGCTCTTTGGGATGGAGA

GCTGCTAACCCACTCAGGACTCGAAGTGCCCAAGGGCCTCTAATGTGGCCAAGACCCTGAATCGTGCTCATGGTCAGCTTTCTGTCCTTAGTGTCTAAAG

CGATTTTACTTTGTTTCAAGCAACTGGTAGCTCTCACAATTCTGTTGGGATCCTTTGTGCAATATTGTAGCCATCTTCCCCTGGGCCCTACTCTGTAAGA

GCTAGGTATACAGCCAAAGTCGCCAGTTTCCTAGGTCATCAGGGGATTCGCCTCCTCAGGCCAGTTCTTTGGGTCCTTCTACTTGTGCCCACACACCTTA

GACTGTTCAGTCCTGCGGTCCTGCCTCTCGGCCCGTCCCTTATCCACATGTAACTTGTTTTGGGGGCTCACCAGATTCTCTAGAGTAAATGCTCTCTACC

TCTGGCTGGAGGAGTGGCAGCCACAGGCTTGGCCTTTTCTCTGATGCACCTCAGATTCTTGGGTTCTGGCTTCCTCAGTTGTACCTCAGCACTAGAGATG

TCAGTCCAACCCAGATGCAGCTATCTCCACTCTGAGTCCATCTGTCTTCTGGATACCTGATACCTAGGCAGTTTGCCATAACCATTGTGCCAGTTATGTG

ACAAAGGGAAAGAGACACTAGGGAGACATGTATGGCTCTGGTGCCAGAAACGTTACCCTCGATAAGTTCCTTCTGTGTATCTGCCACAGTTCAAAGCTCC

AGAAAAAAGACAACTTTACACAATCCATTTTGGAGCCTGTTCAGACCCACAACTCCCATCTCCCTTGGCCACAGAATGTACTTAATAAAAGCAGTATTTT

GGTTTGAGGAAAACCTGGTGAAACAGTTGAATATGTATGCGGAATATTCAGTTTGGACTTGTCTGACCCTGGGTGCTACAATGGTGATAACTGATGATGT

CCTTAGGGGAGAAAGAGAACGACTAAATTTAGCAAAATATAAAATAAAAATTATAATTCATGTAATTAAAGTTTATTTGAAC
Translation
MALPFARCWKLYRWGTKRWGVPAVESRRG - UNI19515 - GISFKLEEKTAHSSLALFRGDTGVKYGLVGLEPTKVALNLERFREWAVVLGDTTVTS

GRHYWEVTVKRSQQFRIGVADVDMSRDSCVGADDRSWVFSYAQRKWHSMLANEKAPIKGIGQPEKVGLLLDYEAKKLSLVDVSRISVIHTLQTDFRGPVA

PAFALWDGELLTHSGLEVPKGL

For any suggestions or comments, please send an email to unitrap@crg.es