Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051396 (Hspa14)
Chromosomal location
Chr 2: 3406126 - 3430028 (-)
Description
heat shock protein 14 Gene [Source:MGI (curated);Acc:Hspa14-001]
RefSeq_dna
NM_015765 
RefSeq_peptide
NP_056580.2 
MGI
MGI:1354164 
Uniprot/SWISSPROT
Q99M31 
Human Ortholog
ENSG00000187522 (HSPA14)
Omim not available
UniTrap UNI22915
Vector Insertion
Chr 2: 3428527 - 3429905
Public Clones not available
Private Clones OST281301 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30744
Vector Insertion
Chr 2: 3411769 - 3413992
Public Clones IST11529G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000027961
Sequence
TTCCGAGGAAGCTAGCTGAAGCTGCTGAAGGGTCCTTCGTTGAGCTGCCGTGGTCTCCGCCGCCTTATGGCGGCGATCGGCGTGCACCTGGGCTGCACAT

CAGCCTGTGTGGCTGTCTACAAG - UNI22915 - GATGGCCGGGCCGATGTGGTTGCAAATGATGCAGGGGATAGAGTCACACCAGCCATTGTTGCT

TACTCGGAACGTGAACAG GTGGTTGGACTGGCAGCAAAACAAAGTAGAATAAGACATGTTTCAAGCACAGTAGTGAAAGTGAAACAGATCCTTGGCAGA

AG CTCTGCAGATCCACAAGCTCAGAAATACATCTCAGAAAGTAAATGCTTA GTCATTGAGAAAAATGGGAAGTTGCGGTATGAAATAGATACAGGAGA

AGAAACAAAACTTGTTAATCCAGAAGATGTTGCCAGACTGATATTCAGTAAAATGAAAG AAACAGCGCATTCTGTCCTGGGCTCAGATGCAAATGACGT

GGTTGTCACTGTCCCATTTGACTTTGGAGAAAAGCAGAAGTCTGCTCTGGG GGAGGCGGCTGGAGCTGCTGGATTTAACGTGCTGCGGCTGATCCATGA

GCCGTCTGCAGCTCTCCTTGCTTATGGGATTGGACAAGACCACCCTACCGGGAAGAG CAATGTTTTGGTGTTTAAGCTTGGAGGAACGTCCTTATCGCT

CAGTGTCATGGAAGTTAACAGTGGGATGTATCGGGTCCTTTCCACAAACACCAGTGACAACATAGGGGGCGCACATTTCACAGACACCTTAGCACAGTAC

CTGGCTTCGGAGTTCCAGAG - UNI30745 - GTTGTTCAAACATGATGTGAGAGGAAATGCCCGAGCCATGATGAAATTGATGAACAGCGCTGAAGT

GGCCAAGCATTCTCTGTCAACCTTGGGAAGTGCCAACTGCTTTGTAGATTCCTTGTATGAAGGTCAAGACTTTGATTGCAATGTGTCCAG - UNI3074

5 - AGCAAGATTTGAGCTGCTCTGTTCTCCGCTTTTTAACAAATGTACAGAAGCAATCCGGGAGCTCTTGCGCCAGACTGGATTCACAGCAGATGATAT

CAACAAG - UNI30745 - GTTGTGCTGTGTGGTGGATCTTCCAGAATCCCAAAGCTGCAGCAGCTGATTAAAGATCTCTTCCCAGCCGTGGACCTCC

TCAACTCTATCCCTCCAGATGAGGTCATCCCTATTGGTGCAGCCATAGAAGCCGGGATTCTTGTTGGGAAAGAGAGCACGTCAGGAGATGACTCTGTCAT

GATAGAGTGTTCAGCCAAGGATATTTTAGTTAAG GGAGTGGATGAGTCAGGTGCCGACAGATTCACAGTACTGTTTCCCTCTGGGACCCCGCTGCCAGC

CCGAAGACAGCACACACTGCAGGCCCCCGGGAGGGTGTCTTCCGTTTGCCTTGAACTCTATGAGTCTGAGGGGAAGAACTCTGCTAAAGAGGAGGCCAAG

TTTGCACAG GTTGTACTCCAGGACTTAGATAAAAAAGAAAATGGATTGCGTGATATATTAGCTGTTCTTACTATGAAAAG GGATGGATCTTTACAGGT

GACGTGCACAGACCAAGACACCGGCAAGTGTGAGGCCATTACTGTTGAGGTTGCATCCTGACTCTTCAGATAAACCAAGATGGTTTTTAGAACTATAATA

TCAACATAATTTGGTTTTGTGTATAAGTGTTGTTTATAATAAACTGCTTTTTCAATGAAGGTATAAGCTATGTTTCTATTAAAATACAATTTATTACT
Translation
MAAIGVHLGCTSACVAVYK - UNI22915 - DGRADVVANDAGDRVTPAIVAYSEREQ VVGLAAKQSRIRHVSSTVVKVKQILGRS SSADPQAQKY

ISESKCL VIEKNGKLRYEIDTGEETKLVNPEDVARLIFSKMKE ETAHSVLGSDANDVVVTVPFDFGEKQKSALG GEAAGAAGFNVLRLIHEPSAALL

AYGIGQDHPTGKS SNVLVFKLGGTSLSLSVMEVNSGMYRVLSTNTSDNIGGAHFTDTLAQYLASEFQR - UNI30745 - RLFKHDVRGNARAMMKL

MNSAEVAKHSLSTLGSANCFVDSLYEGQDFDCNVSR - UNI30745 - RARFELLCSPLFNKCTEAIRELLRQTGFTADDINK - UNI30745 - V

VLCGGSSRIPKLQQLIKDLFPAVDLLNSIPPDEVIPIGAAIEAGILVGKESTSGDDSVMIECSAKDILVK GVDESGADRFTVLFPSGTPLPARRQHTLQ

APGRVSSVCLELYESEGKNSAKEEAKFAQ VVLQDLDKKENGLRDILAVLTMKR RDGSLQVTCTDQDTGKCEAITVEVAS

For any suggestions or comments, please send an email to unitrap@crg.es