Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051413 (Plagl2)
Chromosomal location
Chr 2: 153053508 - 153067114 (-)
Description
pleiomorphic adenoma gene-like 2 Gene [Source:MGI (curated);Acc:Plagl2-001]
RefSeq_dna
NM_018807 
RefSeq_peptide
NP_061277.2 
UniGene
Mm.103199 Mm.407374 
MGI
MGI:1933165 
Uniprot/SPTREMBL
Q8CFT9 Q3UZI7 Q6ZQG6 Q925T4 Q9QZJ1 
Human Ortholog
ENSG00000126003 (PLAGL2)
Omim not available
UniTrap UNI32661
Vector Insertion
Chr 2: 153063394 - 153067115
Public Clones IST14494F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26322
Vector Insertion
Chr 2: 153061535 - 153061909
Public Clones not available
Private Clones OST125171 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000068166
Sequence
ACAATGCACCGCACAATGGCCCGACCGCCGCCACTACCGGGGCCTGAGCGGGCCTGGCGGAGCCCGAGCGCGGCCCGGCCCGCAGCGCGGGGTCCCGAGC

GCA - UNI26322 - - UNI32661 - GTGAAGAGACTGTTTTCTGAAGGCTGCGTTGGAGGCTGTGACCGAGCAGAGAGCCCATGTGAACTGATGG

GGAGGCTTTCTGAATAACATGGCCTTTTGCCATTAGCCTTGCCATGACCACATTTTTCACCAGCGTCCCTCCCTGGATTCAAGATGCAAAGCAGGAGGAG

GAAGTGGGCTGGAAACTAGTTCCCAGGCCTCGGGGCCGGGAGGCAGAGAGTCAAGTGAAGTGCCAATGTGAAATCTCGGGGACACCATTTTCAAATGGGG

AGAAGCTAAGGCCTCACAGCCTTCCCCATCCGGAGCAGAGACCATATAGCTGTCCTCAGCTGCACTGCGGCAAGGCTTTTGCCTCCAAGTACAAGCTGTA

TAG - UNI26322 - GCACATGGCCACCCACTCGGCCCAGAAACCCCACCAGTGCATGTACTGTGACAAGATGTTTCACCGAAAGGACCATCTGCGGA

ACCACTTGCAGACCCATGACCCCAACAAAGAGGCCCTCCACTGCTCTGAGTGTGGTAAGAATTATAATACAAAGCTGGGATACCGTCGTCACCTGGCCAT

GCATGCTGCCAGCAGTGGTGATCTCAGCTG CAATTTGGATTTTCTCCAAGTACATCATGACACCTTCGTCCTCCTGAACTGGAGAGGGGAAGAAATGAA

AGGCATCCCATATCAACCATTTCCTCAGTCCCTGACCCCACCCTGGACATCATGA
Translation
 - UNI26322 - - UNI32661 - MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSLPHPEQRPYSCPQL

HCGKAFASKYKLYR - UNI26322 - RHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSC

 CNLDFLQVHHDTFVLLNWRGEEMKGIPYQPFPQSLTPPWTS
Transcript ENSMUST00000056924
Sequence
ACAATGCACCGCACAATGGCCCGACCGCCGCCACTACCGGGGCCTGAGCGGGCCTGGCGGAGCCCGAGCGCGGCCCGGCCCGCAGCGCGGGGTCCCGAGC

GCA - UNI26322 - - UNI32661 - GTGAAGAGACTGTTTTCTGAAGGCTGCGTTGGAGGCTGTGACCGAGCAGAGAGCCCATGTGAACTGATGG

GGAGGCTTTCTGAATAACATGGCCTTTTGCCATTAGCCTTGCCATGACCACATTTTTCACCAGCGTCCCTCCCTGGATTCAAGATGCAAAGCAGGAGGAG

GAAGTGGGCTGGAAACTAGTTCCCAGGCCTCGGGGCCGGGAGGCAGAGAGTCAAGTGAAGTGCCAATGTGAAATCTCGGGGACACCATTTTCAAATGGGG

AGAAGCTAAGGCCTCACAGCCTTCCCCATCCGGAGCAGAGACCATATAGCTGTCCTCAGCTGCACTGCGGCAAGGCTTTTGCCTCCAAGTACAAGCTGTA

TAG - UNI26322 - GCACATGGCCACCCACTCGGCCCAGAAACCCCACCAGTGCATGTACTGTGACAAGATGTTTCACCGAAAGGACCATCTGCGGA

ACCACTTGCAGACCCATGACCCCAACAAAGAGGCCCTCCACTGCTCTGAGTGTGGTAAGAATTATAATACAAAGCTGGGATACCGTCGTCACCTGGCCAT

GCATGCTGCCAGCAGTGGTGATCTCAGCTGCAAGGTGTGCCTGCAGACCTTTGAGAGTACCCAGGCCCTATTGGAGCACCTGAAGGCTCACTCACGCCGG

GTAGCAGGAGGTGCTAAGGAGAAGAAGCACCCCTGTGACCATTGTGACAGGCGGTTCTATACTCGGAAGGATGTCCGACGGCACCTAGTGGTGCACACAG

GTCGTAAGGACTTCCTGTGTCAGTACTGTGCCCAGAGATTTGGCCGCAAGGATCACCTGACACGCCATGTCAAGAAGAGCCACTCACAGGAACTGCTCAA

GATCAAGACAGAGCCAGTGGATATGTTAGGCTTGCTCAGCTGTAGCTCTACAGTCAGTGTAAAGGAAGAGCTGAGCCCTGTGCTTTGCATGGCCTCTCGG

GACGTGATGGGGGCTAAGGCCTTTCCTGGCATGTTGCCCATGGGTATGTATGGTGCCCACATCCCTACCATGCCCAGTGCGGGCATGCCACACTCCCTGG

TGCACAACACACTGCCCATGGGTATGAGTTACCCTCTGGAATCTTCTCCTATCTCCTCCTCAGCTCAGCTCCCTCCAAAATACCAGCTTGGATCTACCTC

ATACTTGCCCGACAAACTGCCCAAAGTGGAGGTGGATAGTTTTCTGGCAGAGCTTCCTGGAAGCCTGTCTCTCTCCTCGGCTGAACCTCAGCCCGCCTCA

CCTCAGCCGGCGGCAGCTGCAGCCCTCCTGGATGAAGCACTGCTCGCCAAGAGTCCCGCCAACCTCTCCGAGGCCCTCTGCGCTGCTAATGTGGACTTTT

CCCACTTACTGGGCTTTCTTCCGCTCAACCTACCCCCATGTAACCCACCAGGGGCCACAGGAGGCTTGGTTATGGGCTACTCCCAAGCTGAGGCACAGCC

TTTGCTCACCACTTTGCAGGCTCAGCCTCAAGATTCCGCTGGAGCTGGGGGACCCCTGAACTTTGGGCCTCTGCACTCCTTACCTCCTGTCTTCACCTCT

GGCCTGAGTACCACCACCCTGCCTCGTTTCCACCAAGCATTCCAGTAGCCCCCATGAAGGTCCCCCAACTCAGTTTTTTGCTTCTGCCAGGGAGCCTAAG

TACCCACCCCGTCCACCTCCCCCATGAAGGCAGCTGAGCTTTCAGAGCTGGGTTCAAAAAGAAAATTCTAGTGTCTATATGGAGCACTTGGTTTGGGGGT

TCAGGCTCCAGGATCAATTTAGAGGGATCCTTGAACCCAGCCCCGTGAACAATCTATCATAGGACTTTCAGGTATTTTTACTTTTATTTTTTGATCTGAA

CTGGGAGCTATATTTAGCCCTCTGCCTCTCCAAAGCATCAGAACCACCTTCAGTCTGGAGAAGGGGAAGCCTCTTGGAGACAGAGGGTTTCACCTTATAT

GACCTCAAGAGAAACAGCCTAAGAAGCCCGCCTTCTGGTCCCAATCTGCAGACCCTCCAGCAGTTGGCTGTTGAGTCCCTGCTGTGGAAGTTCTCTTGAC

TATCACCTGCTTCCAGCTACCAGGCAAGAAAGAGGGCCTCTGTTCTCAACCATCCCACCCCACCCCACCCACAGCTCCCCTTCAGTCAGTGTTGTCCAGC

AACGGTACCGTTTACACATTCACCTCCGACACGCCATTTCACCTCCCTCGCCACACTGTTAGCCTTAGTGATTGCAGTGAACACTGTTTACACACCGTGA

ATCCATTCCCACCAGTCCATTTCAGTTGCCACCAGCCTGAACCACTCGGTACCTGGTGTTAACTGGAGCCCTGTTTACAAGGCGGAGTCGGGTCTTGCTG

ACTTCTCTTCACTTGAGGTCACATTTTTCCCCCGTGGGGAAATAAACTGACTTTGGACTGCTTCAGTTTCTGCCATCTTCCATGACTGCTTCTATTCCTG

CCTTCCATGGCAGTGTCCACAGGAGATAGGCAAGAAGATTGGAGCAGCTTTCTCACAGGTCTGCAATTTGGATTTTCTCCAAGTACATCATGACACCTTC

GTCCTCCTGAACTGGAGAGGGGAAGAAATGAAAGGCATCCCATATCAACCATTTCCTCAGTCCCTGACCCCACCCTGGACATCATGAGCAGTTATCCGTC

TTGGCAGGAGGGGTTCTGGGGTTCGGGCTGGATAGCAGAGGAGAGGGATGAGCCCTGCGTTTATTTCCCTTCTGCTCGTCCTTTTCCAGGACACAATGGA

ACTGTCGGAAGAAGAGTTTCTAGAAAGTTAGGATTGGGCAGATAGTTGAGTCCTAATCTATCAAATCATTGTTGCCTCTCATACCAAAATGTTCTTACCC

ACTGTCCTTC
Translation
 - UNI26322 - - UNI32661 - MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSLPHPEQRPYSCPQL

HCGKAFASKYKLYR - UNI26322 - RHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSC

KVCLQTFESTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHSQELLKIKTEPVDMLG

LLSCSSTVSVKEELSPVLCMASRDVMGAKAFPGMLPMGMYGAHIPTMPSAGMPHSLVHNTLPMGMSYPLESSPISSSAQLPPKYQLGSTSYLPDKLPKVE

VDSFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAKSPANLSEALCAANVDFSHLLGFLPLNLPPCNPPGATGGLVMGYSQAEAQPLLTTLQAQPQ

DSAGAGGPLNFGPLHSLPPVFTSGLSTTTLPRFHQAFQ
Transcript ENSMUST00000109795
Sequence
AGGCTGAGATGCATTATTCGGATATGAAATTGGAGCAGAATTTTGCTTTTTGAAGGTAGGAGAAATTCTCTCTAAACTAGATGTGCATACTCAGAGCCCA

GTCTACCCAGTTCTGAGGTATATAGTAATCGCTATTATTATAAACAGGTAATTCCACCCTTGCATAGGATGGGGGAATTTGAACAATGGAAGCCAGCCAT

CAGAGGCCTTTGAGGTGTATAGGGAGCAGGCATTTAACTAAAAGGCTCAA - UNI26322 - - UNI32661 - GTGAAGAGACTGTTTTCTGAAGG

CTGCGTTGGAGGCTGTGACCGAGCAGAGAGCCCATGTGAACTGATGGGGAGGCTTTCTGAATAACATGGCCTTTTGCCATTAGCCTTGCCATGACCACAT

TTTTCACCAGCGTCCCTCCCTGGATTCAAGATGCAAAGCAGGAGGAGGAAGTGGGCTGGAAACTAGTTCCCAGGCCTCGGGGCCGGGAGGCAGAGAGTCA

AGTGAAGTGCCAATGTGAAATCTCGGGGACACCATTTTCAAATGGGGAGAAGCTAAGGCCTCACAGCCTTCCCCATCCGGAGCAGAGACCATATAGCTGT

CCTCAGCTGCACTGCGGCAAGGCTTTTGCCTCCAAGTACAAGCTGTATAG - UNI26322 - GCACATGGCCACCCACTCGGCCCAGAAACCCCACCA

GTGCATGTACTGTGACAAGATGTTTCACCGAAAGGACCATCTGCGGAACCACTTGCAGACCCATGACCCCAACAAAGAGGCCCTCCACTGCTCTGAGTGT

GGTAAGAATTATAATACAAAGCTGGGATACCGTCGTCACCTGGCCATGCATGCTGCCAGCAGTGGTGATCTCAGCTGCAAGGTGTGCCTGCAGACCTTTG

AGAGTACCCAGGCCCTATTGGAGCACCTGAAGGCTCACTCACGCCGGGTAGCAGGAGGTGCTAAGGAGAAGAAGCACCCCTGTGACCATTGTGACAGGCG

GTTCTATACTCGGAAGGATGTCCGACGGCACCTAGTGGTGCACACAGGTCGTAAGGACTTCCTGTGTCAGTACTGTGCCCAGAGATTTGGCCGCAAGGAT

CACCTGACACGCCATGTCAAGAAGAGCCACTCACAGGAACTGCTCAAGATCAAGACAGAGCCAGTGGATATGTTAGGCTTGCTCAGCTGTAGCTCTACAG

TCAGTGTAAAGGAAGAGCTGAGCCCTGTGCTTTGCATGGCCTCTCGGGACGTGATGGGGGCTAAGGCCTTTCCTGGCATGTTGCCCATGGGTATGTATGG

TGCCCACATCCCTACCATGCCCAGTGCGGGCATGCCACACTCCCTGGTGCACAACACACTGCCCATGGGTATGAGTTACCCTCTGGAATCTTCTCCTATC

TCCTCCTCAGCTCAGCTCCCTCCAAAATACCAGCTTGGATCTACCTCATACTTGCCCGACAAACTGCCCAAAGTGGAGGTGGATAGTTTTCTGGCAGAGC

TTCCTGGAAGCCTGTCTCTCTCCTCGGCTGAACCTCAGCCCGCCTCACCTCAGCCGGCGGCAGCTGCAGCCCTCCTGGATGAAGCACTGCTCGCCAAGAG

TCCCGCCAACCTCTCCGAGGCCCTCTGCGCTGCTAATGTGGACTTTTCCCACTTACTGGGCTTTCTTCCGCTCAACCTACCCCCATGTAACCCACCAGGG

GCCACAGGAGGCTTGGTTATGGGCTACTCCCAAGCTGAGGCACAGCCTTTGCTCACCACTTTGCAGGCTCAGCCTCAAGATTCCGCTGGAGCTGGGGGAC

CCCTGAACTTTGGGCCTCTGCACTCCTTACCTCCTGTCTTCACCTCTGGCCTGAGTACCACCACCCTGCCTCGTTTCCACCAAGCATTCCAGTAGCCCCC

ATGAAGGTCCCCCAACTCAGTTTTTTGCTTCTGCCAGGGAGCCTAAGTACCCACCCCGTCCACCTCCCCCATGAAGGCAGCTGAGCTTTCAGAGCTGGGT

TCAAAAAGAAAATTCTAGTGTCTATATGGAGCACTTGGTTTGGGGGTTCAGGCTCCAGGATCAATTTAGAGGGATCCTTGAACCCAGCCCCGTGAACAAT

CTATCATAGGACTTTCAGGTATTTTTACTTTTATTTTTTGATCTGAACTGGGAGCTATATTTAGCCCTCTGCCTCTCCAAAGCATCAGAACCACCTTCAG

TCTGGAGAAGGGGAAGCCTCTTGGAGACAGAGGGTTTCACCTTATATGACCTCAAGAGAAACAGCCTAAGAAGCCCGCCTTCTGGTCCCAATCTGCAGAC

CCTCCAGCAGTTGGCTGTTGAGTCCCTGCTGTGGAAGTTCTCTTGACTATCACCTGCTTCCAGCTACCAGGCAAGAAAGAGGGCCTCTGTTCTCAACCAT

CCCACCCCACCCCACCCACAGCTCCCCTTCAGTCAGTGTTGTCCAGCAACGGTACCGTTTACACATTCACCTCCGACACGCCATTTCACCTCCCTCGCCA

CACTGTTAGCCTTAGTGATTGCAGTGAACACTGTTTACACACCGTGAATCCATTCCCACCAGTCCATTTCAGTTGCCACCAGCCTGAACCACTCGGTACC

TGGTGTTAACTGGAGCCCTGTTTACAAGGCGGAGTCGGGTCTTGCTGACTTCTCTTCACTTGAGGTCACATTTTTCCCCCGTGGGGAAATAAACTGACTT

TGGACTGCTTCAGTTTCTGCCATCTTCCATGACTGCTTCTATTCCTGCCTTCCATGGCAGTGTCCACAGGAGATAGGCAAGAAGATTGGAGCAGCTTTCT

CACAGGTCTGCAATTTGGATTTTCTCCAAGTACATCATGACACCTTCGTCCTCCTGAACTGGAGAGGGGAAGAAATGAAAGGCATCCCATATCAACCATT

TCCTCAGTCCCTGACCCCACCCTGGACATCATGAGCAGTTATCCGTCTTGGCAGGAGGGGTTCTGGGGTTCGGGCTGGATAGCAGAGGAGAGGGATGAGC

CCTGCGTTTATTTCCCTTCTGCTCGTCCTTTTCCAGGACACAATGGAACTGTCGGAAGAAGAGTTTCTAGAAAGTTAGGATTGGGCAGATAGTTGAGTCC

TAATCTATCAAATCATTGTTGCCTCTCATACCAAAATGTTCTTACCCACTGTCCTTCCCCCTTCTCTGCTTTGCAGTCCCCATGGACTCTGGGCATGGTG

CACTGTCGTCTTTGCTCTTCATTGAGGATCTTCCACCCACCATGGTCCCCTCAGTTGCACCTAGTGTCTAGCAATGTGTCTTGCAAGAAATTCCTAATTC

TTCTGCTGACTTGGAGCTCGCTGCCACAGACAGCACAGCCCTTGCCCAGAAGCAGCTGAACAATTCCTAACCCATTTCATCTCGGTTCTGTATGGGTTTT

TCCCGTGCATGGAAGGGAGGCAGCTCAGGGACCACCATTGTGGAGCCTTTGAGACCTCTCTGATTCAGAAACACACTTCTACCTCTTTACTGTTAACTCC

AACAGATGTAGCCAGCAGCCTGGGCACTTGTGTTAGTGGTGCCGTTTGCTGGCTTCTCCACTAGGGTTTCAGGACAGACTACCTAGGAACTGCCTCAACC

TCCCACCAGTTCTTCCCTGCCCCTCCCTTCTGTCTAGATTCACTTCAGTTTATTGTTGGGAACTGTGCAGGTCCAAGACCTGGACTCCTGCTTCAGCCCA

GGCCAGTACTCCTTGTCTGAGGTGAAAGCCTTCAGTTTAGCTCCCTGGCCCTTGTGTGGAAGCAATGTGGAGTGAATGAGCATATTTTGATTTAAGCAAG

GTAGCTTGGAATACCTTTTTTAAAAACAACTGGATATAAATATGTCTGACAGGATTGGAATCAGACTATGTGATTTGCTTGTAAAGATTAGTTTCAGTGA

GTCCCAGGGACTAATTAAGGTTTATTTTTAAAAGCGTCTGCCTTGGTGCGCAACCACCTCCTGCATGCTATGCATGCTGTTGGGACTCGTATTACAGGGA

ATGGCATTGAGAAGCCAAGTGGGACTCACTGCTGCCATTCTCCTTGTGCTTGGTCTTCACTAGACCCCAGCCCCCTCTACCCTTCTTACCACCTCCCTAT

AGCCTCAGCTTCAGAAGCCAGTAGCCTCCAGCCACAGAGTATCGTGTTGTGGGCTGTTTGAGAAGACCTGTCCTCCTGAGCTGCTCCTTCCCATGGTGCT

CACAGGCCAGCAGAGCACCTCTTGTAGATCTTGTTCCACCTCTAATCTTTCCTCGTTGTCTGTTCTTATGTATTCTTCAGTTTTCCCACTTCTCAGTGTC

TTCACTCTAAGGACTTTTCCTGTCACTGTGAACTTTGCTGGTTATCTGCCTTCAATTTTTGGACCACAAACCACCCTGCAGCTTCTTAAACCTTTCCCCA

ACCTACCACCCAAAAGAACCTTTTGGCCAGTTGTTAAAAGGACAGGAATGATTTTATTCTGTAGTTGGAGCCCAAACTCATTAAGGTACCCTTTATGAGG

CCAAGAGAGCCAGAGGGGCATGCGCCCAGGACAGGAGCCATGGCATGTGGCACAGACCAATCAGGGACCAGAAAAGAATGATGTCCCTTTCCTTGCCATG

TCCTTGAGCCTGTCAGTAATGAACTGGCTGCAAGGGGACAGCACCTCTCAGCCTGCACAGCAGCTTGTCAGAGTGAGAACTGTCCTGGGGCCAGAGACTA

ACATGCCCAGGTGGTGTCGGCTCAGAGGATCCTAGCACCATCTTAAGCAGGTGGGAGGCAGGGAAGGGTGCACCAGCGTGTCTTTCCCTGACTTTACATG

GTGTTTTGTTAATGCAAATCCGGGAAGCAGGTGTGATTGCTTTTTGCTCGTAGATATTATCCTAAGTTGAAATCCCCTAAATCTCCCTTAGTAGCCTTTA

AGTTCCCCCTTCCCTTTTTGGTAGCTGTTTTCTCTACCCCTCCTCCATAATTAAAAAAACAAAAAACAGAAAAACAAACAAAAAAAGTTGTATTATACAG

GATCAATATTTTGCTTTTTAACAAGGATATTTATGTAATAAGAAACTTTGCCTTAGGTAGGTGTTGGCCAGAAAAGTCCAGATTTCTCTGTGACCTCACC

CTGGCCTCTCCTGGAGCTCTGAACCTGCTGTGGAAGGAAGTGGCTGTGACTTTAACCACTGGAGAGCGGAGTCTGTGGTGTGGAGAGGGTGTTCACTGTG

TAATCTTGGGCTGTGTGGAGTTGTTCTTATCACCTTGCTTCAGATGTTACTTTGGCGTCCTCCACCAGTTCTCCATGCGCACCTCTGCATGTCCGGCACT

AGAATCCCTGAACACTACTTCACACCTCCCCCACTGCCAGTTGGTTGATGCTCTAGAGCCACTCTTTCTTAATGCCAGATTATTTAAAGAAAAATACAAG

ACAAAAACCTTCTAGCACTTTGTAAACACAGTGAATAACCTCTTGGAGTATTTTTGGCTTTATATAAAACAAGGTTTTTAATTGTAAAATATAAGTGCCA

TTAGAAAATGCACAGGGCATATCTTTGTTAAAGTAGATTTTTTCAATGTTTTACAGAATTAATTTTCAAAAAAAAGTTTTTATAATGAAGTTGTTTATTA

AAAACTTCTGAA
Translation
 - UNI26322 - - UNI32661 - MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSLPHPEQRPYSCPQL

HCGKAFASKYKLYR - UNI26322 - RHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSC

KVCLQTFESTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHSQELLKIKTEPVDMLG

LLSCSSTVSVKEELSPVLCMASRDVMGAKAFPGMLPMGMYGAHIPTMPSAGMPHSLVHNTLPMGMSYPLESSPISSSAQLPPKYQLGSTSYLPDKLPKVE

VDSFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAKSPANLSEALCAANVDFSHLLGFLPLNLPPCNPPGATGGLVMGYSQAEAQPLLTTLQAQPQ

DSAGAGGPLNFGPLHSLPPVFTSGLSTTTLPRFHQAFQ

For any suggestions or comments, please send an email to unitrap@crg.es