Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051451 (Crebzf)
Chromosomal location
Chr 7: 97591239 - 97596227 (+)
Description
CREB/ATF bZIP transcription factor Gene [Source:MGI (curated);Acc:Crebzf-002]
RefSeq_dna
NM_145151 
RefSeq_peptide
NP_660133.2 
UniGene
Mm.29496 Mm.470786 
MGI
MGI:2675296 
Uniprot/SWISSPROT
Q91ZR3 
Human Ortholog
ENSG00000137504 (CREBZF)
Omim not available
UniTrap UNI26889
Vector Insertion
Chr 7: 97592598 - 97592809
Public Clones not available
Private Clones OST88063 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000061767
Sequence
ATCTCGCGATACTCTGGCTGGAGCGAAGCGCGTTTTTGTGGGCGGGGTGGGCAGAGAGTAACTTCCGGCCAGGCCGCTGTCTGGGTGGCGCGGCCGAGTC

CTCCCCCGGGCCTCGCCGCTTCGCGCTTCCACTGCCTTCCCCCCGCCTCGTGCGGGGGGTTGGGCGGCCGCCGGAGGCCACTCGGACCTTGCCCCGCGCC

TGCGGTCGGCCCGGCGCCGTGGCTCTGCGCGCTGGGGGCCCGGGGTCGGAGTGGCTGCGGCCTACCCGGGCCCGCCGCTCAGCCCCATGAGGCACAGCCT

GACCAAGCTGCTGGCAGCCTCGGGCCGCGACTTCCCGAGCCGCCGCGACAGCCGGGAGCCGCCCGCCACGCGCGCGCCGCCCCGGGAGCCGAGCGGGGCA

GCCGCGGGGGCGGAGACCCCGAGGCCCGGATCGCCTGACCGCGAGCAACCTCACGGGGACGGGGACGGGGGCGAGCCGGAGGCCCGGAGCGGGAGCCGCG

GCAGCGTGGCCGTGCGCGCGCCCGCGCCCTCGCCCCTGAAGATGGAGGAGGAGGAGGAGGACGCGATCGCCATGGTCCCCAAGGAAGAGCCGGAGGACAT

GGACTTTCTCTCCGGGCTGGAGCTGGCCGATCTGCTGGACCCTCGGCAACCGGACTGGCACCTGGAGCCCGGGCTCAGCTCGCCCGGGCCCCTGTCCTCG

TCCGGCGGAGGCTCGGAGAGCGGCGGCCTGTTGAGGGGGGACGACGACGACGACACCGCGGCCGCCGAGATGCAGCGCTTCTCCGACTTGCTGCAGAGGC

TGTTGAACGGCATCGGAGGCTGCAGCAGCGGCGGTGACCGCGGCGGCGGGGAGAAGAGGCGGAGAAAGTCCCCGGGAGCAGGAGGCGGTGGCGCCAACGA

CGGCAACCAGGCGGCGACCAAGAGTCCCCGGAAGGCGGCGGCGGCCGCTGCCCGTCTTAATCGGCTCAAGAAGAAGGAGTACGTGATGGGGCTGGAGAGT

CGGGTCCGGGGACTGGCAGCCGAGAACCAGGAGCTGCGGGCCGAGAATCGGGAGCTGGGCAAGCGCGTGCAAGCACTGCAGGAGGAGAGTCGCTACCTAC

GGGCCGTCCTGGCCAACGAGACCGGACTAGCTCGCCTGCTGAGCCGACTGAGCGGCGTGGGACTGCGGCTGACCACCTCCCTCTTCAGAGACTCGCCCGC

CGGCGACCACGACTACGCCCTGCCGGTGGGGAAGCAGCCGCCGGAGCCGCGGGAAGAGGACGACGCGGCGGGAGGAGTGTGTCTCCATGTGGACAAGGAT

AAGGTGTCGGTGGAGTTCTGCTCGGCGTGCGCTCGGAAGGCGTCGTCGTCTCTTAAAATGTAGGGTCAAGTAATCTGCTCTTTATCCGCGTTTACCCCTT

TCTCCTCCCTTACACCATGTCAAACACCTTAGTGGGACATCGTCACCGGACGCATTTCAGAGGCGGAAAAAAAAGTAATATTAAATCTTTTAAGTGTTTA

GCTAAAAGCATGAATGTGACACTGTAACCAACTCCTAATGATAACCTGTGACTATTAAATCTCTCTGACAGTTTCTTTTTTAGGTGATTTCCTTCCTGCC

AGGCTCCGTTGTAGGGGTTACAGAGCAGTCGTTCCCGCCTCACAACCTGGTAAGGATCCATCTCTTCCCGTAACGCTCATGCTCGGCTGCTTAGGCTACT

TTAATGGGCAGACATCTCAATGTGTGTGTGTGTGTGATATCTTTTTCTGTTTGTTTTTCTTTTTGAAAGGTGGTGGGAGGGGAATCTTAATTTGGGCCTT

GTCCACCCTGGAAACAGACTTGTGCTGGTCATTAATGTACTTAAGTTGCTTCTGGTTGAAATAGCTGTTAAATGTGTCCCCTTGTTCAGAGTTGCGTGTA

CCTAGCTCTTCTGTCCCCAGTGTGGACATGGCCTTGGATGACATCGGTTCCAACTGTACACAGAAACCTGCTAATAGAGATACAGTTTGGAGACAGTCAA

ACAGGTGAAGTTGAATGGAAGTTCCGAGTTGTACAAGGTGCAAATTGGAATTCCAATTGTAGAGCAACTTTTCAGAGGTTGACAATAAGTATTGAGGCAT

GCGCAAATGTGGTATTTTTCTGGAGATGACAAGTCTCCTAAAATACTTAATGAATGCCTTATAGTTTTCAGTAGAAAATGCAGAAATACAGTCTATTTAA

AGACCCTAATAGTTCACCACTTGAGAAGTTGGAAATTAACATACCCATCAGATTTCTGTGTTTTAATTAGAAGACGATAAATGAAATGTTTCTTTGAGGA

CCAGCACAGTAATTACTAATCAATGAGTATGAAGAAATTGTTGAAAGTATTTATTTTTGTTGTATTAAAATTTAGGCTAAATTTCTGTATGATTAGATAT

TGAAGGTTGTGAAATGTGAATGAAAACATGTAAAGTGAGGCTTCACAAAGAATCTTTTCTCCATATTTCTAAAACTTTTGTCCTATTTAAAAATACTTGT

TTAAATTAATGAAATGATCGATACTGTTTTTCCAAAGACGGAAAAGTCTTTCCTTAAAATACTGTTTTTTTGTCCACTTGTCTTAAGTGTGTGTTCTGAT

GCTCTGAAATGCAAGAGACATTAAATTCTTTGTGAAACATCACTGTTTGATAAAGGATATACGTATTTAGCATCCTTGTTTTTCTTTGTGCTAAAGTGGA

TACAGCTGTTGGGGCAGAAGAGACGGGACCAGCTGCTGGCCACATTTCCTGCTTTATTTTAAAAGGTAGTATAAGAAATAAGGAAACAGAGGTAATATCA

GGGCTTCTGCTGTCTTTTATTTTTAAAATGTTCATAATTAAGTATTTTCCAGCAGTCCAAAGATGTAAGTTATCCTACACGTAAGATGTTTTATTTTGTT

ACTTGGTTATGGAAATGGAATCTTGTTCTTGCACAACTGTAAATGTTTTGTTGCTAGATAATATGATTTTGAGACCTAAATTAGTCTCTGGTTTTTCAGT

CTATCACATTTTGTAAAAATCTCTACTGCACTTGAGCATGAATGGGTAGTAGCCAAACTCACAACTTGGAGTGACGGACCTGCTTCTACAAGGGTAGGAT

ACAAGCCCCACAATGCAGCTGCATGGATTTCAGTGCCTATGAATTATATATATATATATATACATAGATATAGAAACCAAAAGTAGTTGGAAATTTATTT

GAAATGACTAATTTGTGCTCTTTCTGAAGTATGTTAAATGTAGCTTTTGAAACAGAAGCCTTGAATTGAAATTTAATACTTGAACATTTTTGTATATATT

TCTTTGTATATAATTTTGTGCAGAACCAATGACAAACATATGGTGTCATAATAAAATCAGGTTTGTTGATCTTTCA
Translation
MEEEEEDAIAMVPKEEPEDMDFLSGLELADLLDPRQPDWHLEPGLSSPGPLSSSGGGSESGGLLRGDDDDDTAAAEMQRFSDLLQRLLNGIGGCSSGGDR

GGGEKRRRKSPGAGGGGANDGNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLL

SRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQPPEPREEDDAAGGVCLHVDKDKVSVEFCSACARKASSSLKM
Transcript ENSMUST00000107205
Sequence
CGGCCGCTGCCCGTCTTAATCGGCTCAAGAAGAAGGAGTACGTGATGGGGCTGGAGAGTCGGGTCCGGGGACTGGCAGCCGAGAACCAGGAGCTGCGGGC

CGAGAATCGGGAGCTGGGCAAGCGCGTGCAAGCACTGCAGGAGGAGAGTCGCTACCTACGGGCCGTCCTGGCCAACGAGACCGGACTAGCTCGCCTGCTG

AGCCGACTGAGCGGCGTGGGACTGCGGCTGACCACCTCCCTCTTCAGAGACTCGCCCGCCGGCGACCACGACTACGCCCTGCCGGTGGGGAAGCAGCCGC

CGGAGCCGCGGGAAGAGGACGACGCGGCGGGAGGAGTGTGTCTCCATGTGGACAAGGATAAGGTGTCGGTGGAGTTCTGCTCGGCGTGCGCTCGGAAGGC

GTCGTCGTCTCTTAAAAT - UNI26889 - TTTCTTTTTTAGGTGATTTCCTTCCTGCCAGGCTCCGTTGTAGGGGTTACAGAGCAGTCGTTCCCGCC

TCACAACCT
Translation
MGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQPPEPREEDDAAGGVCL

HVDKDKVSVEFCSACARKASSSLKI - UNI26889 - IFFFR
Transcript ENSMUST00000107206
Sequence
AGAGAGTAACTTCCGGCCAGGCCGCTGTCTGGGTGGCGCGGCCGAGTCCTCCCCCGGGCCTCGCCGCTTCGCGCTTCCACTGCCTTCCCCCCGCCTCGTG

CGGGGGGTTGGGCGGCCGCCGGAGGCCACTCGGACCTTGCCCCGCGCCTGCGGTCGGCCCGGCGCCGTGGCTCTGCGCGCTGGGGGCCCGGGGTCGGAGT

GGCTGCGGCCTACCCGGGCCCGCCGCTCAGCCCCATGAGGCACAGCCTGACCAAGCTGCTGGCAGCCTCGGGCCGCGACTTCCCGAGCCGCCGCGACAGC

CGGGAGCCGCCCGCCACGCGCGCGCCGCCCCGGGAGCCGAGCGGGGCAGCCGCGGGGGCGGAGACCCCGAGGCCCGGATCGCCTGACCGCGAGCAACCTC

ACGGGGACGGGGACGGGGGCGAGCCGGAGGCCCGGAGCGGGAGCCGCGGCAGCGTGGCCGTGCGCGCGCCCGCGCCCTCGCCCCTGAAGATGGAGGAGGA

GGAGGAGGACGCGATCGCCATGGTCCCCAAGGAAGAGCCGGAGGACATGGACTTTCTCTCCGGGCTGGAGCTGGCCGATCTGCTGGACCCTCGGCAACCG

GACTGGCACCTGGAGCCCGGGCTCAGCTCGCCCGGGCCCCTGTCCTCGTCCGGCGGAGGCTCGGAGAGCGGCGGCCTGTTGAGGGGGGACGACGACGACG

ACACCGCGGCCGCCGAGATGCAGCGCTTCTCCGACTTGCTGCAGAGGCTGTTGAACGGCATCGGAGGCTGCAGCAGCGGCGGTGACCGCGGCGGCGGGGA

GAAGAGGCGGAGAAAGTCCCCGGGAGCAGGAGGCGGTGGCGCCAACGACGGCAACCAGGCGGCGACCAAGAGTCCCCGGAAGGCGGCGGCGGCCGCTGCC

CGTCTTAATCGGCTCAAGAAGAAGGAGTACGTGATGGGGCTGGAGAGTCGGGTCCGGGGACTGGCAGCCGAGAACCAGGAGCTGCGGGCCGAGAATCGGG

AGCTGGGCAAGCGCGTGCAAGCACTGCAGGAGGAGAGTCGCTACCTACGGGCCGTCCTGGCCAACGAGACCGGACTAGCTCGCCTGCTGAGCCGACTGAG

CGGCGTGGGACTGCGGCTGACCACCTCCCTCTTCAGAGACTCGCCCGCCGGCGACCACGACTACGCCCTGCCGGTGGGGAAGCAGCCGCCGGAGCCGCGG

GAAGAGGACGACGCGGCGGGAGGAGTGTGTCTCCATGTGGACAAGGATAAGGTGTCGGTGGAGTTCTGCTCGGCGTGCGCTCGGAAGGCGTCGTCGTCTC

TTAAAATGTAGGGTCAAGTAATCTGCTCTTTATCCGCGTTTACCCCTTTCTCCTCCCTTACACCATGTCAAACACCTTAGTGGGACATCGTCACCGGACG

CATTTCAGAGGCGGAAAAAAAAGTAATATTAAATCTTTTAAGTGTTTAGCTAAAAGCATGAATGTGACACTGTAACCAACTCCTAATGATAACCTGTGAC

TATTAAATCTCTCTGACAGTTTCTTTTTTAGGTGATTTCCTTCCTGCCAGGCTCCGTTGTAGGGGTTACAGAGCAGTCGTTCCCGCCTCACAACCTGGTA

AGGATCCATCTCTTCCCGTAACGCTCATGCTCGGCTGCTTAGGCTACTTTAATGGGCAGACATCTCAATGTGTGTGTGTGTGTGATATCTTTTTCTGTTT

GTTTTTCTTTTTGAAAGGTGGTGGGAGGGGAATCTTAATTTGGGCCTTGTCCACCCTGGAAACAGACTTGTGCTGGTCATTAATGTACTTAAGTTGCTTC

TGGTTGAAATAGCTGTTAAATGTGTCCCCTTGTTCAGAGTTGCGTGTACCTAGCTCTTCTGTCCCCAGTGTGGACATGGCCTTGGATGACATCGGTTCCA

ACTGTACACAGAAACCTGCTAATAGAGATACAGTTTGGAGACAGTCAAACAGGTGAAGTTGAATGGAAGTTCCGAGTTGTACAAGGTGCAAATTGGAATT

CCAATTGTAGAGCAACTTTTCAGAGGTTGACAATAAGTATTGAGGCATGCGCAAATGTGGTATTTTTCTGGAGATGACAAGTCTCCTAAAATACTTAATG

AATGCCTTATAGTTTTCAGTAGAAAATGCAGAAATACAGTCTATTTAAAGACCCTAATAGTTCACCACTTGAGAAGTTGGAAATTAACATACCCATCAGA

TTTCTGTGTTTTAATTAGAAGACGATAAATGAAATGTTTCTTTGAGGACCAGCACAGTAATTACTAATCAATGAGTATGAAGAAATTGTTGAAAGTATTT

ATTTTTGTTGTATTAAAATTTAGGCTAAATTTCTGTATGATTAGATATTGAAGGTTGTGAAATGTGAATGAAAACATGTAAAGTGAGGCTTCACAAAGAA

TCTTTTCTCCATATTTCTAAAACTTTTGTCCTATTTAAAAATACTTGTTTAAATTAATGAAATGATCGATACTGTTTTTCCAAAGACGGAAAAGTCTTTC

CTTAAAATACTGTTTTTTTGTCCACTTGTCTTAAGTGTGTGTTCTGATGCTCTGAAATGCAAGAGACATTAAATTCTTTGTGAAACATCACTGTTTGATA

AAGGATATACGTATTTAGCATCCTTGTTTTTCTTTGTGCTAAAGTGGATACAGCTGTTGGGGCAGAAGAGACGGGACCAGCTGCTGGCCACATTTCCTGC

TTTATTTTAAAAGGTAGTATAAGAAATAAGGAAACAGAGGTAATATCAGGGCTTCTGCTGTCTTTTATTTTTAAAATGTTCATAATTAAGTATTTTCCAG

CAGTCCAAAGATGTAAGTTATCCTACACGTAAGATGTTTTATTTTGTTACTTGGTTATGGAAATGGAATCTTGTTCTTGCACAACTGTAAATGTTTTGTT

GCTAGATAATATGATTTTGAGACCTAAATTAGTCTCTGGTTTTTCAGTCTATCACATTTTGTAAAAATCTCTACTGCACTTGAGCATGAATGGGTAGTAG

CCAAACTCACAACTTGGAGTGACGGACCTGCTTCTACAAGGGTAGGATACAAGCCCCACAATGCAGCTGCATGGATTTCAGTGCCTATGAATTATATATA

TATATATATACATAGATATAGAAACCAAAAGTAGTTGGAAATTTATTTGAAATGACTAATTTGTGCTCTTTCTGAAGTATGTTAAATGTAGCTTTTGAAA

CAGAAGCCTTGAATTGAAATTTAATACTTGAACATTTTTGTATATATTTCTTTGTATATAATTTTGTGCAGAACCAATGACAAACATATGGTGTCATAAT

AAAATCAGGTTTGTTGATCTTTCAGTTATGGGCTCAAAGAATTTATTCATCTCTAACATGATATTGGAAAGTAATGGATGAAAATAGGAAAAATGGTTGT

TAATATAGACTTAATCGAAAGGTTCTGGAAGTAGTAAGTTTGTTTTCCTAAAAACTATACCATTTCTGTGGAATATTTTCTTAACCTCAGTGCTTTTCCT

GCATTTGAAGTGTGGGCTTGGGGAAAATTAGTTTCTGAATTGGGATGTTTTGAAATTCCAAGTACAGAGTCTTAGGCTGTCATTTCATAAATGGCAGTTT

GGAGAATTAGGAATTCTCAACAGTGGAAGATCAGAGTGTCCTGTTTTTAAAGCTGCTTTCTTAGGTTCCTTATGTCTTATTAACTGTGTTTTTGTTTCCA

TTTCATTGTTTTTTTCTAGTTTTGGTGACAGTGATTTTTGTCATTTTTTTTGCATCAACTCATGGTCTTGTTTTTACATGGTAACTGCATGTATGTAGGA

TCTATCAGGGGCTTTAAATAAATTTTGCTCATATTTATGTGTAAGCACATTTTACTGTAAATGTTTGGGTTTAATTTACAGCAGTTGTTTATTTCAGTGT

GTAGTAAACAGTATCTAGAGTGTTCTGTTCACTACTTGTTAATTAAAAAAGTTATGATTAATATAAAACTGTTGTCTTACTATTTTTAGAAAACTTTTGT

GAATAATTAGTATTTTGATAGAGAGTTCTGAAATACAAAATAGATTGCTTTGAAAATTTCAGGTTTGGGTGTATTTACTGTGATGTTGAGAACAATTTAG

TATTTGGGGAACTGTTTCAGGTTTTATTCTTGATTTGTACCTGTGTAAAAATGATAGAAAACCTTAAAATGTAGCTTTTAAATACCTGTCTTCCTATGGT

AGTTAATATTCATACATTAATTGACTAACACATATTGGCATAGTATTTCTATCATAGTAGCTTAAGTTTTTGTCCTTTTTTTAACCATACTTAAAAGTAT

GTTTGTTAAAAAATGTAGTCACACCTCTGATATATCCAACAAAGTATTCAAAATATTTTAAATATCTGTACATTTCATACTCGCTAAATTAATCTCTTTC

TCTTCTCTTTAAACAGCTTAGCAGTATCTGCAAAAACGAATCTTTTCCTACAACCTGTTAACTGACTGGACTGATGGTAACAGTAATTGTGGGAGCCATG

TCGGTCAAAAATTTGGCATCTGCTGAAAGACATGAATGCCATTTCCAAGGTCCCAAATTACTTCTATACTGATTACACTTTCCAGAAATGGAGATATGAA

AAGATTCTCTGGAATGCTTGAAAGACTTAATAGAAACCCATGAGACTAAGTTAATTTTGGAACAAAATTACACCTCTTTTTTTTCATTCATGGCAATTAA

CACTAAATTTATCGTATACTTTAAAAAATGGTAACCATTGGAGAAGAGAATTCTAGAGTTTCATCAAGAAACATTAGGTTTTACACAATCAAGGACACTT

TGTGGAATTAGACTTAGTGGGTTAGAATGACACAAGTGAGCTAGCAGTGATCACAAACCTCATGAGTTTGTATTCTGGGATGGAAAGAGCTGCTTTGGAA

GACAGACACGTTGCTGAGTAGAATAAAGTCCTTAACT
Translation
MRHSLTKLLAASGRDFPSRRDSREPPATRAPPREPSGAAAGAETPRPGSPDREQPHGDGDGGEPEARSGSRGSVAVRAPAPSPLKMEEEEEDAIAMVPKE

EPEDMDFLSGLELADLLDPRQPDWHLEPGLSSPGPLSSSGGGSESGGLLRGDDDDDTAAAEMQRFSDLLQRLLNGIGGCSSGGDRGGGEKRRRKSPGAGG

GGANDGNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLF

RDSPAGDHDYALPVGKQPPEPREEDDAAGGVCLHVDKDKVSVEFCSACARKASSSLKM

For any suggestions or comments, please send an email to unitrap@crg.es