Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051550 (Zfp579)
Chromosomal location
Chr 7: 4944456 - 4947703 (-)
Description
zinc finger protein 579 Gene [Source:MGI Symbol;Acc:MGI:1915740]
Human Ortholog
not available
Omim not available
UniTrap UNI35680
Vector Insertion
Chr 7: 4944455 - 4947634
Public Clones IST13606G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108572
Sequence
CCCACCCCTCCCACTACGCTCAACCCCCTCCCTCTCCGCCACCACTGTCCGCGATCGCCCGGCCGCAGGGAAGGAAGAAAGGAGCGCAGGAGGTGGAG -

 UNI35680 - GCATGGATCCACAGCCCCCTCCACCCGCCCAGGGCAGCCCACCTCACCGTGACCGTGGCCGAGGCCGAGGCCGTGGCCGTGGCCGTGG

CCGAGGCCGTGGTCGTGGCAGAGGGGGTGCTGGAGCCCCTAGGGCGCCTCTGCCCTGCCCAACCTGTGGTCGCCTCTTCCGCTTCCCTTACTACCTGTCT

CGACACCGGCTGAGCCACTCGGGTCTCCGGCCCCATGCCTGCCCTCTGTGCCCCAAAGCTTTCCGCAGGCCTGCCCACCTTTCCCGCCACCTTCGTGGCC

ACGGGCCCCAGCCCCCGCTGCGCTGCGCTGCCTGCCCACGCACCTTCCCGGAGCCAGCCCAGCTCAGGCGCCACCTGGCCCAAGAGCACGCAGGTAGCGA

GGTGGATCTGTCCACGCAGAGGGCAGTGAAGGAGGAGCCTGAGGCCAGTTGGGGTCCGCAGGACGAGGGAGTGGAACAGCCCGCCACGGTGGTGGTGGCC

GGGGCTGAGGAGGAGGCGACCACACAGTGGCCCGCAGGGGACTCGGCTCCTGCGGCTGTCCCCACGAGTACGGATCCTCGGGAATCAGAGGCCAAGGAGG

CCGAGGCCGGGGCAGCGGAGCTAAGGGCAGAGTTGGCACTGGCCGCGGGGCGACAGGAGGAGAAACAGGTCCTTCTCCAGGCCGACTGGACGCTGCTGTG

TCTCCGCTGTCGCGAAGCCTTCGCCACCAAGGGGGAGCTCAAAGCCCACCCGTGTCTGCGCCCCGAGGGCGAACAGGAGGGCGAAGGAGGACCCCCGCCC

CGCCCCAAGCGACACCAGTGTTCCATCTGCCTCAAGGCTTTCGCCAGGCCCTGGTCCCTATCGCGTCACCGGCTAGTCCACTCCACCGATCGACCTTTTG

TGTGTCCAGACTGCGGCCTGGCCTTCCGCTTGGCCTCCTACCTCCGCCAGCACCGCCGCGTCCATGGTCCACTCAGCCTGCTGGCCCCGTTACCCGGGGC

CGGCAAGAAGGATGACAAGGCCTCGGGCGGACGGAACTCAGGGAAAGGGCCCGAGGGGGGCGAAGGGGCAGAATGTGGGGGTGCATCGGAAGGGGGTGAA

GGCGGGCATAATGGAGGAGATGCCACCCCAGCCCGGCCTCCGGCGGGGGAGCCACGTTTCTGGTGTCCTGAGTGTGGCAAAGGTTTCCGACGCCGGGCAC

ACCTACGCCAGCATGGGGTCACCCACTCCGGGGCGCGCCCTTTTCAGTGCGTGCGCTGCCAGAGGGAATTCAAGCGACTGGCGGACCTGGCCCGCCACGC

GCAAGTCCATGCTGGGGGTCCCGCCCCGCATCCGTGCCCGCGATGCCCACGCCGCTTCTCTCGCGCTTACAGCCTCCTGCGCCACCAACGCTGCCACCGC

GCCGAGCTGGAACGGGCGGAGCTGGAGAGGGCTGCAGCGCTGCAGGAACTCCAGACCCAGGCCTCACAGTCGCCCCAGCCTCCGCAGCCACTTAAGCAGG

AGGCAGAAGGGCTCCCTCTGCCCATCGCGCACATCAAGGAAGAGCCTCCCTCACCTGGCACACCACCCCAGTCCCCGCCGGCTCCACCTGTCTTTCTCAG

CGCCTCCTGTTTTGACAGCCAAGACCATTCAGCCTTCGAGATGGAGGATGAGGAGATGGACAGTAAGGCCCACCTATGCGGATTGGGAGGCCTGGCCTCC

TGACCCTCACATCCACCCTCCGCCCTTCCAATTGCGCTCCCGGTTTGCAGTAAGGAAGAGGGAAGCTGAAGAAGAGGAACCTCCCCTGCCTGCCCCTGAA

GCCTGGATCATTCGTCTTCTCCTTTACCCACCCCTAAACCCCTGATGCTGGTTAGGAACTTCTCACCCCAACACGTGTCTTAAGTAAGGCAGGGCAAGGC

GGAGGACACTTGGCCAGAAGGATAGAGACTGCTGGGTTCGTCCCAGCCTGCCCATCCCTATTACAAACACTGGACACCATCACCTCTTTGGAACTGCCAG

ACCCTGGGAGTTCCCAGCGCGAAAGGTCTGCTCCCGTTCCTCTGTCTCTGTGAATAAATGTGAGTTCGTGC
Translation
 - UNI35680 - MDPQPPPPAQGSPPHRDRGRGRGRGRGRGRGRGRGRGGAGAPRAPLPCPTCGRLFRFPYYLSRHRLSHSGLRPHACPLCPKAFRRP

AHLSRHLRGHGPQPPLRCAACPRTFPEPAQLRRHLAQEHAGSEVDLSTQRAVKEEPEASWGPQDEGVEQPATVVVAGAEEEATTQWPAGDSAPAAVPTST

DPRESEAKEAEAGAAELRAELALAAGRQEEKQVLLQADWTLLCLRCREAFATKGELKAHPCLRPEGEQEGEGGPPPRPKRHQCSICLKAFARPWSLSRHR

LVHSTDRPFVCPDCGLAFRLASYLRQHRRVHGPLSLLAPLPGAGKKDDKASGGRNSGKGPEGGEGAECGGASEGGEGGHNGGDATPARPPAGEPRFWCPE

CGKGFRRRAHLRQHGVTHSGARPFQCVRCQREFKRLADLARHAQVHAGGPAPHPCPRCPRRFSRAYSLLRHQRCHRAELERAELERAAALQELQTQASQS

PQPPQPLKQEAEGLPLPIAHIKEEPPSPGTPPQSPPAPPVFLSASCFDSQDHSAFEMEDEEMDSKAHLCGLGGLAS
Transcript ENSMUST00000040415
Sequence
CCGCGATCGCCCGGCCGCAGG - UNI35680 - AAGGAAGAAAGGAGCGCAGGAGGTGGAG - UNI35680 - CCTCCTGCGCCACCAACGCTGCC

ACCGCGCCGAGCTGGAACGGGCGGAGCTGGAGAGGGCTGCAGCGCTGCAGGAACTCCAGACCCAGGCCTCACAGTCGCCCCAGCCTCCGCAGCCACTTAA

GCAGGAGGCAGAAGGGCTCCCTCTGCCCATCGCGCACATCAAGGAAGAGCCTCCCTCACCTGGCACACCACCCCAGTCCCCGCCGGCTCCACCTGTCTTT

CTCAGCGCCTCCTGTTTTGACAGCCAAGACCATTCAGCCTTCGAGATGGAGGATGAGGAGATGGACAGTAAGGCCCACCTATGCGGATTGGGAGGCCTGG

CCTCCTGACCCTCACATCCACCCTCCGCCCTTCCAATTGCGCTCCCGGTTTGCAGTAAGGAAGAGGGAAGCTGAAGAAGAGGAACCTCCCCTGCCTGCCC

CTGAAGCCTGGATCATTCGTCTTCTCCTTTACCCACCCCTAAACCCCTGATGCTGGTTAGGAACTTCTCACCCCAACACGTGTCTTAAGTAAGGCAGGGC

AAGGCGGAGGACACTTGGCCAGAAGGATAGAGACTGCTGGGTTCGTCCCAGCCTGCCCATCCCTATTACAAACACTGGACACCATCACCTCTTTGGAACT

GCCAGACCCTGGGAGTTCCCAGCGCGAAAGGTCTGCTCCCGTTCCTCTGTCTCTGTGAATAAATGTGAGTTCGT
Translation
PRSPGRR - UNI35680 - KEERSAGGGA - UNI35680 - ASCATNAATAPSWNGRSWRGLQRCRNSRPRPHSRPSLRSHLSRRQKGSLCPSRTS

RKSLPHLAHHPSPRRLHLSFSAPPVLTAKTIQPSRWRMRRWTVRPTYADWEAWPPDPHIHPPPFQLRSRFAVRKREAEEEEPPLPAPEAWIIRLLLYPPL

NP

For any suggestions or comments, please send an email to unitrap@crg.es