Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051592 (Ccnb3)
Chromosomal location
Chr X: 6556778 - 6618745 (-)
Description
cyclin B3 Gene [Source:MGI (curated);Acc:Ccnb3-001]
RefSeq_dna
NM_183015 
RefSeq_peptide
NP_898836.2 
UniGene
Mm.448624 
MGI
MGI:2183443 
Uniprot/SWISSPROT
Q810T2 
Uniprot/SPTREMBL
A2AEP2 Q8VDC6 Q8VDC7 
Human Ortholog
ENSG00000147082 (CCNB3)
Omim not available
UniTrap UNI13493
Vector Insertion
Chr X: 6582474 - 6584137
Public Clones CMHD-GT_281B06-3 (cmhd) IST13191F11 (tigm) IST14601E9 (tigm) IST12482F10 (tigm)
IST11430B3 (tigm) IST10886H6 (tigm) IST11430D8 (tigm) IST11640B4 (tigm)
IST14869D1 (tigm) IST14522F10 (tigm) IST11512A4 (tigm) IST13719B10 (tigm)
IST13533C5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36211
Vector Insertion
Chr X: 6572636 - 6582474
Public Clones IST10765D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115752
Sequence
GCGAGGCCGGCCGTTACTCCGTTGCTGAGGCCGTTATGCTAAGACAGACG ATGCCTTGGAACTGGAGTTACAGGCAGTTGTGAGTTGTCAT CTCTATC

TTGGAGGAAACACTGCTGAATCTGCATAAAGATGCCACCACCACTACTACCCAAAAGATCCAAACTGGAGACTGAGAAGGCTCAGTCTAACAAGATCACA

CCTAGAGAGGAGCAGCAATCTGAAAAG ATTGGAAAGAGTAACCATGCAGCATCTTCATCTTCATCTTCAACTCAAGGCGCAGTAAAGAGGAGATCAGTG

TTTGAAGATGTAACTAAT GCATCTCATAGTCAATGTGTCCAGTCAAAGGAAGACAATATAGAGCTTAAAAGCCATGTTTCCAAAAGGACAAAGAAGGGA

GTTGGTGAAGTTACTCAGAAAAAAATAAAAAG TTCTAAGATGGGGCATGTTACTTCACTGTCAAACATGGAGAAAGAGTTTATTCTGGATATACCCAAC

AAGCCTAAAACACTAACTACTGAGGAACCATCTGTCTTTCAAAAGACATTAGTTTTAAATGAGGAGCCTGCTACTAAAGAGACATGCCTTATGAGGAAGA

CATTAAAGAGTTGTGCATTTCATCAGGAGACACTTCTAATGGAGAAGCCACTAACCTTGCTGGTGGAGACTGAAGATTACAATGAGTTTGATACAGAACT

GATGACTTCTAAAAAGAAGGATAAACCTGAAGATCCAACCATCATTGAGGAG ATGACTGATTTGAAGAAGTCTGTTATTAGGAAGGTGACGCTCACCTC

AAGCCCATTATGGTTAAAGAATAAACATGTTGTTCAAGAAGAGAAACCTGTGATTCAGGAGAAGAGTTCATTCAAGAAGATATCATTAGTATCAAATGTG

GTGACTACTAAAGAGAAGCCACCAGTCAAAAAGCCACATTTCAGGAAAAAAAAGCCTACCACTGAGATGAAGTCTTTGTTACAGGAGCCATCACTGGAAG

AGAAATATAATACTCAAGAAGATGCAAGCATCTTGAAGAAGCCACAGGTGTTACAAGAGAATACAAATAACAAAGATGCTACTTTAACAGAGCCAGTTAC

TTTTAAAGGGAAACATAGTGCCAATGAAGCAACCCATACAAAGAAGCCATCCTCTTCTAAAAATAATCCTGACCCTCAGGGAAAAGGCACTAATTTGAGG

CCACTAAGAGTTCATCCAGTCACCTATGAAAATGAGCCAATGTCCTCTAAGAAGTCAACTACTAAGAAGAAAGATTCCCATTTCCATGGGCCATCTGTAC

TGCCAGACAAGCATAGCCCTCAAATGGAGGTGTCCACTGTGAAAAAATCCCTGGCTCTGCCAAATCCTACCACTGAGGAGAAGATGTTACATTTTCCAGT

AGCTACAGTTTTGGAGAAGCAGCATAACATGGGCGAGGCCCCTTGCCTGAAGAAGCCCTCACCTTTAAGGAAGCAGCAGCAGCTCCCTAAAAGAAGACGT

TTCTTCAGTAACTCTGCAGTACAAGAAACAGTCATTCGCAAGCCATTGTTCTTTAAGATGTCTACCACTGAGAAAGATCCCCCTTCCCAGTGGCCATCTG

CACTGCCAAAGAAGCATATCAGTCCTGGGGAATTGTCCAAACAGAAGAAGCAGCATGTCTCACCAAAGCATAACATGGAGGAGGACTCACAGTGTTGGTT

AGATTCAGCTTTTAAGAAACAGCTCAGCAGGGAGGAGCCAGCCTCCACCCATACGCCTTTAAAGTTAGAGATGCAGCAGGCTATTACTAAAGAGACAGGG

TTCCATTTGAGAAACCCACTAGTATTACCAACAGTCACTTCAGAAGCAAAGTCACTGACTAAGGAGCCTCCATCCTTTAGGGAACAAAATACATCTTTAC

TGAAAAGAAAGAGTACTACTCACACAATAACCTTACAGCAAGCACAGTCAGAGTGGCAGGAAATGACAGATGAAGACAGAAATTTGTTTTCTATAAAGCC

TGGATCACATAGGAAGGAACCTATACCTGAGTTCCTTCAGAATCCATTGCCACCAAATGAAAATTGCTTAATTTCACAAAAACTATCCCACTCAATGCCA

TTTGCCTCACAGAAGACCACCAGTCAAGAAAGAGCACATAGGAAGGAATCGGTGGCTTCAAATGATGACAAGAACTTCTTCTCGCAGGACCTATTTTCTC

CTTTCAGTTCTGCTGATGAAGATACATTGAAATTCCATAAGTCTTTGGACTTTCAAGAGCAGGTTGATAGAAAAAATGACTCCCACAAAAAAATGTTTGA

CTCCCAGGACAGTGTTTCCGAAGAAGAGTCCTTTTTAAGAAAGCTATTTTGTAAGGACAGATGCTCCTCTACTGAAGAATTAAGCCAAGAGAGGACTGTT

GCTCTGGAACAGGAATTCCTCTTAATAAAAATATTGAATGAGAATACCAGTAGTGATGTTGATGAGCCTCTTAGTCATCAGTCACCTCATATTCAGAACC

ATTCTGACACTACGAAGGAGGCCTTGGAGGCCTCAGAAGCCTTGGAGGCCCCAGAAGCCTTGGAGACCTTAGAAGCCTTGGTGGCCTCAGAAGACTTGGA

GGAACCTCTAAACATTTTAGAAGAACTCAGCACTGAGAATATGGTTGCCCTCATGAAGATGTTGGTCACAGAAGATGAGTCTACTAAGGATTCTTTTAGC

GGGAATTACACTGCTGCCAGGGAAGCTCATGCTGAGAAATCCTTGTCCTTGGAAGAGACCAGCATCAATGAAGCGGCAACTTTGAAGGAGTCCTTATCTT

CACAGGAGAAGCACAGAGCTGAGCTGGTGACTGTTCTGAAGGAGCTACTTGTTTTAATGAAGAATCCCAGTCTGAAGAGGGTGGCCTTAGCGTTTCAGGA

GAATCCATCTAATAACGTAGAGACTCTCTTGAGGGAAGTATTGGCATTGGTGGAGAACTCTACAGCTGACGAATCTACTCTGCAGGAGAAACCTAGCACT

AAAACAGATGTTACCCCAAAGGAACTATTGGCCTTGGAAGAGAATTCCAGCAATAAAAAGGCAAACCCCATGGACTCTTTATCCTTTGATCATAAGCCTG

ACACTGAGATGGGTGAAATAGCCAGAATGGTATTAACTGATGAAGAGTACAACATAGATACCCTGTATGAGAGAGTATTAGCACTGAGTCAGGGACTCAT

TGCTGCAGACCAGTTGTCCTTTACAGATCTACAGAATTTTGAAGAGACTAAAATTGTTGATGAAGAGGAATTTTTCAAATCATTCCTTGTCTTTGAAAAT

AAGAATAGCCCTAATATGTCCAGCAATGCTTTTGAATCCAGAACAGACAATTCCAGTGCTATCATGCCAAGTTCAAAGGCATTCAATCCTGTCGAGAACT

CCAACCCATATGTGTCTAGTTCCAAAAGCTTTAAGTCAACTCTGGGTGCAAAAGAAACTGAG - UNI13493 - - UNI36211 - ATAACCATACA

GGATGACAGTGACAGCCTGGAAAGAATTGAAAAGGAAGGCCAAGATCCATTATTGAACACTATATATGCCAAAGACGTCTTCAATTACTTGAAAGAAAGA

GAG - UNI36211 - GAAAAGTTCCTAGTTCAGAAATACATGGATGGGCAGATGGAACTCACCAGTGATATGAGAGCCATTCTTGTGGACTGGTTGGT

GGAGATACAG - UNI36211 - GGATCCTTTCAGATGACCCATGAGACCCTGTATTTGGCAGTGAAGATAATGGATCTCTACCTAATGAAGGCACAAT

GCAAGAAGAATCATCTACAACTCCTTGGTTCCACTACTTACATGATTGCAGCCAAATTTGAG GAATCCTATCCCCCTTCTCTGTCAGAGTTCCTGTTCA

TTTGTGAAGATATGTATGAAAAGAGTGATATGGTATCTTTGGAAAGCAGCATCCTGCAAACTCTCAACTTTGACATCAATATTCCCACAGCATATAATTT

TCTGCGTAGATATGCTTCG TGCATCCATGCTAGCATGAAGACACTAACCTTATCCCGCTTCATCTGTGAGATGACCCTGCAAGAATATGAGTATATTGA

AGAGAGGCCTTCAAAGCTAGCTGCAGCCTCTTTCATCTTGGCCCTCTATATGAGGAATCTCAGCAATTGT GTTCCTACACTGGAATATTTCACTGGGTA

CAAGATGGCAGAACTCCATATCTTGGTCAGGAAGTTAAACCATTTGCTGAACTTCCGATCCCATAGTATCCTCAAGAATGTGTTTGAGAAGTATTCTGAA

GA GACCTACTTTGAAGTCGCCAAAATCCCTCCTTTGAGCAAGCAAGATCTAGAGAATCTTTTGAATTGTGCATTATTCCACTGAGGACCTCTGACAGCA

GTTGTCAGGGCTGGGCAGAAATACCAATAGTATGAATTTATTCATTTATCTTATGCATGAAGTTTCCCTATTGTTAACTTTTCATTAATATTTTTCCTCT

CTTTATTTTCCTAAACTGATAGTTATGGAACCTTAAAAATCTTGAAATTACTTTTATGAAAGAAGAGAAATTGTTTTGTTATATTTGTTTAAAAAATTTA

ATAAAATACAATGGTTACT
Translation
  MPPPLLPKRSKLETEKAQSNKITPREEQQSEK IGKSNHAASSSSSSTQGAVKRRSVFEDVTN ASHSQCVQSKEDNIELKSHVSKRTKKGVGEVTQK

KIKS SSKMGHVTSLSNMEKEFILDIPNKPKTLTTEEPSVFQKTLVLNEEPATKETCLMRKTLKSCAFHQETLLMEKPLTLLVETEDYNEFDTELMTSKK

KDKPEDPTIIEE MTDLKKSVIRKVTLTSSPLWLKNKHVVQEEKPVIQEKSSFKKISLVSNVVTTKEKPPVKKPHFRKKKPTTEMKSLLQEPSLEEKYNT

QEDASILKKPQVLQENTNNKDATLTEPVTFKGKHSANEATHTKKPSSSKNNPDPQGKGTNLRPLRVHPVTYENEPMSSKKSTTKKKDSHFHGPSVLPDKH

SPQMEVSTVKKSLALPNPTTEEKMLHFPVATVLEKQHNMGEAPCLKKPSPLRKQQQLPKRRRFFSNSAVQETVIRKPLFFKMSTTEKDPPSQWPSALPKK

HISPGELSKQKKQHVSPKHNMEEDSQCWLDSAFKKQLSREEPASTHTPLKLEMQQAITKETGFHLRNPLVLPTVTSEAKSLTKEPPSFREQNTSLLKRKS

TTHTITLQQAQSEWQEMTDEDRNLFSIKPGSHRKEPIPEFLQNPLPPNENCLISQKLSHSMPFASQKTTSQERAHRKESVASNDDKNFFSQDLFSPFSSA

DEDTLKFHKSLDFQEQVDRKNDSHKKMFDSQDSVSEEESFLRKLFCKDRCSSTEELSQERTVALEQEFLLIKILNENTSSDVDEPLSHQSPHIQNHSDTT

KEALEASEALEAPEALETLEALVASEDLEEPLNILEELSTENMVALMKMLVTEDESTKDSFSGNYTAAREAHAEKSLSLEETSINEAATLKESLSSQEKH

RAELVTVLKELLVLMKNPSLKRVALAFQENPSNNVETLLREVLALVENSTADESTLQEKPSTKTDVTPKELLALEENSSNKKANPMDSLSFDHKPDTEMG

EIARMVLTDEEYNIDTLYERVLALSQGLIAADQLSFTDLQNFEETKIVDEEEFFKSFLVFENKNSPNMSSNAFESRTDNSSAIMPSSKAFNPVENSNPYV

SSSKSFKSTLGAKETE - UNI13493 - - UNI36211 - ITIQDDSDSLERIEKEGQDPLLNTIYAKDVFNYLKERE - UNI36211 - EKFLV

QKYMDGQMELTSDMRAILVDWLVEIQ - UNI36211 - GSFQMTHETLYLAVKIMDLYLMKAQCKKNHLQLLGSTTYMIAAKFE ESYPPSLSEFLFI

CEDMYEKSDMVSLESSILQTLNFDINIPTAYNFLRRYAS CIHASMKTLTLSRFICEMTLQEYEYIEERPSKLAAASFILALYMRNLSNC VPTLEYFTG

YKMAELHILVRKLNHLLNFRSHSILKNVFEKYSEE ETYFEVAKIPPLSKQDLENLLNCALFH
Transcript ENSMUST00000115753
Sequence
TTCTGATTGCAGCTCTATCTTGGAGGAAACACTGCTGAATCTGCATAAAGATGCCACCACCACTACTACCCAAAAGATCCAAACTGGAGACTGAGAAGGC

TCAGTCTAACAAGATCACACCTAGAGAGGAGCAGCAATCTGAAAAG ATTGGAAAGAGTAACCATGCAGCATCTTCATCTTCATCTTCAACTCAAGGCGC

AGTAAAGAGGAGATCAGTGTTTGAAGATGTAACTAAT GCATCTCATAGTCAATGTGTCCAGTCAAAGGAAGACAATATAGAGCTTAAAAGCCATGTTTC

CAAAAGGACAAAGAAGGGAGTTGGTGAAGTTACTCAGAAAAAAATAAAAAG TTCTAAGATGGGGCATGTTACTTCACTGTCAAACATGGAGAAAGAGTT

TATTCTGGATATACCCAACAAGCCTAAAACACTAACTACTGAGGAACCATCTGTCTTTCAAAAGACATTAGTTTTAAATGAGGAGCCTGCTACTAAAGAG

ACATGCCTTATGAGGAAGACATTAAAGAGTTGTGCATTTCATCAGGAGACACTTCTAATGGAGAAGCCACTAACCTTGCTGGTGGAGACTGAAGATTACA

ATGAGTTTGATACAGAACTGATGACTTCTAAAAAGAAGGATAAACCTGAAGATCCAACCATCATTGAGGAG - UNI13493 - - UNI36211 - AT

AACCATACAGGATGACAGTGACAGCCTGGAAAGAATTGAAAAGGAAGGCCAAGATCCATTATTGAACACTATATATGCCAAAGACGTCTTCAATTACTTG

AAAGAAAGAGAG - UNI36211 - GAAAAGTTCCTAGTTCAGAAATACATGGATGGGCAGATGGAACTCACCAGTGATATGAGAGCCATTCTTGTGGA

CTGGTTGGTGGAGATACAG - UNI36211 - GGATCCTTTCAGATGACCCATGAGACCCTGTATTTGGCAGTGAAGATAATGGATCTCTACCTAATGA

AGGCACAATGCAAGAAGAATCATCTACAACTCCTTGGTTCCACTACTTACATGATTGCAGCCAAATTTGAG GAATCCTATCCCCCTTCTCTGTCAGAGT

TCCTGTTCATTTGTGAAGATATGTATGAAAAGAGTGATATGGTATCTTTGGAAAGCAGCATCCTGCAAACTCTCAACTTTGACATCAATATTCCCACAGC

ATATAATTTTCTGCGTAGATATGCTTCG TGCATCCATGCTAGCATGAAGACACTAACCTTATCCCGCTTCATCTGTGAGATGACCCTGCAAGAATATGA

GTATATTGAAGAGAGGCCTTCAAAGCTAGCTGCAGCCTCTTTCATCTTGGCCCTCTATATGAGGAATCTCAGCAATTGT GTTCCTACACTGGAATATTT

CACTGGGTACAAGATGGCAGAACTCCATATCTTGGTCAGGAAGTTAAACCATTTGCTGAACTTCCGATCCCATAGTATCCTCAAGAATGTGTTTGAGAAG

TATTCTGAAGA GACCTACTTTGAAGTCGCCAAAATCCCTCCTTTGAGCAAGCAAGATCTAGAGAATCTTTTGAATTGTGCATTATTCCACTGAGGACCT

CTGACAGCAGTTGTCAGGGCTGGGCAGAAATACCAATAGTATGAATTTATTCATTTATCTTATGCATGAAGTTTCCCTATTGTTAACTTTTCATTAATAT

TTTTCCTCTCTTTATTTTCCTAAACTGATAGTTATGGAACCTTAAAAATCTTGAAATTACTTTTATGAAAGAAGAGAAATTGTTTTGTTATATTTGTTTA

AAAAATTTAATAAAATACAATGGTTACT
Translation
MPPPLLPKRSKLETEKAQSNKITPREEQQSEK IGKSNHAASSSSSSTQGAVKRRSVFEDVTN ASHSQCVQSKEDNIELKSHVSKRTKKGVGEVTQKKI

KS SSKMGHVTSLSNMEKEFILDIPNKPKTLTTEEPSVFQKTLVLNEEPATKETCLMRKTLKSCAFHQETLLMEKPLTLLVETEDYNEFDTELMTSKKKD

KPEDPTIIEE - UNI13493 - - UNI36211 - ITIQDDSDSLERIEKEGQDPLLNTIYAKDVFNYLKERE - UNI36211 - EKFLVQKYMDG

QMELTSDMRAILVDWLVEIQ - UNI36211 - GSFQMTHETLYLAVKIMDLYLMKAQCKKNHLQLLGSTTYMIAAKFE ESYPPSLSEFLFICEDMYE

KSDMVSLESSILQTLNFDINIPTAYNFLRRYAS CIHASMKTLTLSRFICEMTLQEYEYIEERPSKLAAASFILALYMRNLSNC VPTLEYFTGYKMAEL

HILVRKLNHLLNFRSHSILKNVFEKYSEE ETYFEVAKIPPLSKQDLENLLNCALFH
Transcript ENSMUST00000056725
Sequence
TTCTGATTGCAGCTCTATCTTGGAGGAAACACTGCTGAATCTGCATAAAGATGCCACCACCACTACTACCCAAAAGATCCAAACTGGAGACTGAGAAGGC

TCAGTCTAACAAGATCACACCTAGAGAGGAGCAGCAATCTGAAAAG ATTGGAAAGAGTAACCATGCAGCATCTTCATCTTCATCTTCAACTCAAGGCGC

AGTAAAGAGGAGATCAGTGTTTGAAGATGTAACTAAT GCATCTCATAGTCAATGTGTCCAGTCAAAGGAAGACAATATAGAGCTTAAAAGCCATGTTTC

CAAAAGGACAAAGAAGGGAGTTGGTGAAGTTACTCAGAAAAAAATAAAAAG TTCTAAGATGGGGCATGTTACTTCACTGTCAAACATGGAGAAAGAGTT

TATTCTGGATATACCCAACAAGCCTAAAACACTAACTACTGAGGAACCATCTGTCTTTCAAAAGACATTAGTTTTAAATGAGGAGCCTGCTACTAAAGAG

ACATGCCTTATGAGGAAGACATTAAAGAGTTGTGCATTTCATCAGGAGACACTTCTAATGGAGAAGCCACTAACCTTGCTGGTGGAGACTGAAGATTACA

ATGAGTTTGATACAGAACTGATGACTTCTAAAAAGAAGGATAAACCTGAAGATCCAACCATCATTGAGGAG ATGACTGATTTGAAGAAGTCTGTTATTA

GGAAGGTGACGCTCACCTCAAGCCCATTATGGTTAAAGAATAAACATGTTGTTCAAGAAGAGAAACCTGTGATTCAGGAGAAGAGTTCATTCAAGAAGAT

ATCATTAGTATCAAATGTGGTGACTACTAAAGAGAAGCCACCAGTCAAAAAGCCACATTTCAGGAAAAAAAAGCCTACCACTGAGATGAAGTCTTTGTTA

CAGGAGCCATCACTGGAAGAGAAATATAATACTCAAGAAGATGCAAGCATCTTGAAGAAGCCACAGGTGTTACAAGAGAATACAAATAACAAAGATGCTA

CTTTAACAGAGCCAGTTACTTTTAAAGGGAAACATAGTGCCAATGAAGCAACCCATACAAAGAAGCCATCCTCTTCTAAAAATAATCCTGACCCTCAGGG

AAAAGGCACTAATTTGAGGCCACTAAGAGTTCATCCAGTCACCTATGAAAATGAGCCAATGTCCTCTAAGAAGTCAACTACTAAGAAGAAAGATTCCCAT

TTCCATGGGCCATCTGTACTGCCAGACAAGCATAGCCCTCAAATGGAGGTGTCCACTGTGAAAAAATCCCTGGCTCTGCCAAATCCTACCACTGAGGAGA

AGATGTTACATTTTCCAGTAGCTACAGTTTTGGAGAAGCAGCATAACATGGGCGAGGCCCCTTGCCTGAAGAAGCCCTCACCTTTAAGGAAGCAGCAGCA

GCTCCCTAAAAGAAGACGTTTCTTCAGTAACTCTGCAGTACAAGAAACAGTCATTCGCAAGCCATTGTTCTTTAAGATGTCTACCACTGAGAAAGATCCC

CCTTCCCAGTGGCCATCTGCACTGCCAAAGAAGCATATCAGTCCTGGGGAATTGTCCAAACAGAAGAAGCAGCATGTCTCACCAAAGCATAACATGGAGG

AGGACTCACAGTGTTGGTTAGATTCAGCTTTTAAGAAACAGCTCAGCAGGGAGGAGCCAGCCTCCACCCATACGCCTTTAAAGTTAGAGATGCAGCAGGC

TATTACTAAAGAGACAGGGTTCCATTTGAGAAACCCACTAGTATTACCAACAGTCACTTCAGAAGCAAAGTCACTGACTAAGGAGCCTCCATCCTTTAGG

GAACAAAATACATCTTTACTGAAAAGAAAGAGTACTACTCACACAATAACCTTACAGCAAGCACAGTCAGAGTGGCAGGAAATGACAGATGAAGACAGAA

ATTTGTTTTCTATAAAGCCTGGATCACATAGGAAGGAACCTATACCTGAGTTCCTTCAGAATCCATTGCCACCAAATGAAAATTGCTTAATTTCACAAAA

ACTATCCCACTCAATGCCATTTGCCTCACAGAAGACCACCAGTCAAGAAAGAGCACATAGGAAGGAATCGGTGGCTTCAAATGATGACAAGAACTTCTTC

TCGCAGGACCTATTTTCTCCTTTCAGTTCTGCTGATGAAGATACATTGAAATTCCATAAGTCTTTGGACTTTCAAGAGCAGGTTGATAGAAAAAATGACT

CCCACAAAAAAATGTTTGACTCCCAGGACAGTGTTTCCGAAGAAGAGTCCTTTTTAAGAAAGCTATTTTGTAAGGACAGATGCTCCTCTACTGAAGAATT

AAGCCAAGAGAGGACTGTTGCTCTGGAACAGGAATTCCTCTTAATAAAAATATTGAATGAGAATACCAGTAGTGATGTTGATGAGCCTCTTAGTCATCAG

TCACCTCATATTCAGAACCATTCTGACACTACGAAGGAGGCCTTGGAGGCCTCAGAAGCCTTGGAGGCCCCAGAAGCCTTGGAGACCTTAGAAGCCTTGG

TGGCCTCAGAAGACTTGGAGGAACCTCTAAACATTTTAGAAGAACTCAGCACTGAGAATATGGTTGCCCTCATGAAGATGTTGGTCACAGAAGATGAGTC

TACTAAGGATTCTTTTAGCGGGAATTACACTGCTGCCAGGGAAGCTCATGCTGAGAAATCCTTGTCCTTGGAAGAGACCAGCATCAATGAAGCGGCAACT

TTGAAGGAGTCCTTATCTTCACAGGAGAAGCACAGAGCTGAGCTGGTGACTGTTCTGAAGGAGCTACTTGTTTTAATGAAGAATCCCAGTCTGAAGAGGG

TGGCCTTAGCGTTTCAGGAGAATCCATCTAATAACGTAGAGACTCTCTTGAGGGAAGTATTGGCATTGGTGGAGAACTCTACAGCTGACGAATCTACTCT

GCAGGAGAAACCTAGCACTAAAACAGATGTTACCCCAAAGGAACTATTGGCCTTGGAAGAGAATTCCAGCAATAAAAAGGCAAACCCCATGGACTCTTTA

TCCTTTGATCATAAGCCTGACACTGAGATGGGTGAAATAGCCAGAATGGTATTAACTGATGAAGAGTACAACATAGATACCCTGTATGAGAGAGTATTAG

CACTGAGTCAGGGACTCATTGCTGCAGACCAGTTGTCCTTTACAGATCTACAGAATTTTGAAGAGACTAAAATTGTTGATGAAGAGGAATTTTTCAAATC

ATTCCTTGTCTTTGAAAATAAGAATAGCCCTAATATGTCCAGCAATGCTTTTGAATCCAGAACAGACAATTCCAGTGCTATCATGCCAAGTTCAAAGGCA

TTCAATCCTGTCGAGAACTCCAACCCATATGTGTCTAGTTCCAAAAGCTTTAAGTCAACTCTGGGTGCAAAAGAAACTGAG - UNI13493 - - UNI

36211 - ATAACCATACAGGATGACAGTGACAGCCTGGAAAGAATTGAAAAGGAAGGCCAAGATCCATTATTGAACACTATATATGCCAAAGACGTCTT

CAATTACTTGAAAGAAAGAGAG - UNI36211 - GAAAAGTTCCTAGTTCAGAAATACATGGATGGGCAGATGGAACTCACCAGTGATATGAGAGCCA

TTCTTGTGGACTGGTTGGTGGAGATACAG - UNI36211 - GGATCCTTTCAGATGACCCATGAGACCCTGTATTTGGCAGTGAAGATAATGGATCTC

TACCTAATGAAGGCACAATGCAAGAAGAATCATCTACAACTCCTTGGTTCCACTACTTACATGATTGCAGCCAAATTTGAG GAATCCTATCCCCCTTCT

CTGTCAGAGTTCCTGTTCATTTGTGAAGATATGTATGAAAAGAGTGATATGGTATCTTTGGAAAGCAGCATCCTGCAAACTCTCAACTTTGACATCAATA

TTCCCACAGCATATAATTTTCTGCGTAGATATGCTTCG TGCATCCATGCTAGCATGAAGACACTAACCTTATCCCGCTTCATCTGTGAGATGACCCTGC

AAGAATATGAGTATATTGAAGAGAGGCCTTCAAAGCTAGCTGCAGCCTCTTTCATCTTGGCCCTCTATATGAGGAATCTCAGCAATTGT GTTCCTACAC

TGGAATATTTCACTGGGTACAAGATGGCAGAACTCCATATCTTGGTCAGGAAGTTAAACCATTTGCTGAACTTCCGATCCCATAGTATCCTCAAGAATGT

GTTTGAGAAGTATTCTGAAGA GACCTACTTTGAAGTCGCCAAAATCCCTCCTTTGAGCAAGCAAGATCTAGAGAATCTTTTGAATTGTGCATTATTCCA

CTGAGGACCTCTGACAGCAGTTGTCAGGGCTGGGCAGAAATACCAATAGTATGAATTTATTCATTTATCTTATGCATGAAGTTTCCCTATTGTTAACTTT

TCATTAATATTTTTCCTCTCTTTATTTTCCTAAACTGATAGTTATGGAACCTTAAAAATCTTGAAATTACTTTTATGAAAGAAGAGAAATTGTTTTGTTA

TATTTGTTTAAAAAATTTAATAAAATACAATGGTTACT
Translation
MPPPLLPKRSKLETEKAQSNKITPREEQQSEK IGKSNHAASSSSSSTQGAVKRRSVFEDVTN ASHSQCVQSKEDNIELKSHVSKRTKKGVGEVTQKKI

KS SSKMGHVTSLSNMEKEFILDIPNKPKTLTTEEPSVFQKTLVLNEEPATKETCLMRKTLKSCAFHQETLLMEKPLTLLVETEDYNEFDTELMTSKKKD

KPEDPTIIEE MTDLKKSVIRKVTLTSSPLWLKNKHVVQEEKPVIQEKSSFKKISLVSNVVTTKEKPPVKKPHFRKKKPTTEMKSLLQEPSLEEKYNTQE

DASILKKPQVLQENTNNKDATLTEPVTFKGKHSANEATHTKKPSSSKNNPDPQGKGTNLRPLRVHPVTYENEPMSSKKSTTKKKDSHFHGPSVLPDKHSP

QMEVSTVKKSLALPNPTTEEKMLHFPVATVLEKQHNMGEAPCLKKPSPLRKQQQLPKRRRFFSNSAVQETVIRKPLFFKMSTTEKDPPSQWPSALPKKHI

SPGELSKQKKQHVSPKHNMEEDSQCWLDSAFKKQLSREEPASTHTPLKLEMQQAITKETGFHLRNPLVLPTVTSEAKSLTKEPPSFREQNTSLLKRKSTT

HTITLQQAQSEWQEMTDEDRNLFSIKPGSHRKEPIPEFLQNPLPPNENCLISQKLSHSMPFASQKTTSQERAHRKESVASNDDKNFFSQDLFSPFSSADE

DTLKFHKSLDFQEQVDRKNDSHKKMFDSQDSVSEEESFLRKLFCKDRCSSTEELSQERTVALEQEFLLIKILNENTSSDVDEPLSHQSPHIQNHSDTTKE

ALEASEALEAPEALETLEALVASEDLEEPLNILEELSTENMVALMKMLVTEDESTKDSFSGNYTAAREAHAEKSLSLEETSINEAATLKESLSSQEKHRA

ELVTVLKELLVLMKNPSLKRVALAFQENPSNNVETLLREVLALVENSTADESTLQEKPSTKTDVTPKELLALEENSSNKKANPMDSLSFDHKPDTEMGEI

ARMVLTDEEYNIDTLYERVLALSQGLIAADQLSFTDLQNFEETKIVDEEEFFKSFLVFENKNSPNMSSNAFESRTDNSSAIMPSSKAFNPVENSNPYVSS

SKSFKSTLGAKETE - UNI13493 - - UNI36211 - ITIQDDSDSLERIEKEGQDPLLNTIYAKDVFNYLKERE - UNI36211 - EKFLVQK

YMDGQMELTSDMRAILVDWLVEIQ - UNI36211 - GSFQMTHETLYLAVKIMDLYLMKAQCKKNHLQLLGSTTYMIAAKFE ESYPPSLSEFLFICE

DMYEKSDMVSLESSILQTLNFDINIPTAYNFLRRYAS CIHASMKTLTLSRFICEMTLQEYEYIEERPSKLAAASFILALYMRNLSNC VPTLEYFTGYK

MAELHILVRKLNHLLNFRSHSILKNVFEKYSEE ETYFEVAKIPPLSKQDLENLLNCALFH

For any suggestions or comments, please send an email to unitrap@crg.es