Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051650 (B3gnt2)
Chromosomal location
Chr 11: 22734857 - 22760336 (-)
Description
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 Gene [Source:MGI (curated);Acc:B3gnt2-002]
RefSeq_dna
NM_016888 
RefSeq_peptide
NP_058584.3 
UniGene
Mm.416828 Mm.440664 
MGI
MGI:1889505 
Uniprot/SWISSPROT
Q9Z222 
Uniprot/SPTREMBL
Q3TVJ9 
Human Ortholog
ENSG00000170340 (B3GNT1)
Omim not available
UniTrap UNI11393
Vector Insertion
Chr 11: 22759704 - 22760217
Public Clones W168C07 (ggtc) Q012C05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6407
Vector Insertion
Chr 11: 22737196 - 22759493
Public Clones YHC081 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10281
Vector Insertion
Chr 11: 22734864 - 22737196
Public Clones KST308 (baygenomics) CMHD-GT_474B1-3 (cmhd)
Private Clones OST319699 (lexicon) OST181220 (lexicon) OST176635 (lexicon) OST131449 (lexicon)
OST131117 (lexicon) OST53965 (lexicon) OST45110 (lexicon) OST42188 (lexicon)
OST39999 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29460
Vector Insertion
Chr 11: 22734856 - 22759704
Public Clones (sanger) E068E02 (ggtc) D139D04 (ggtc) E125A04 (ggtc) E027F11 (ggtc)
D109F05 (ggtc) E114G05 (ggtc) D188C01 (ggtc) D106C05 (ggtc) P151C09 (ggtc)
E030B09 (ggtc) D111G12 (ggtc) E026B09 (ggtc) E114A04 (ggtc) D171C11 (ggtc)
H001C07 (ggtc) E028B12 (ggtc) IST11525D6 (tigm) IST12999G7 (tigm)
IST14652C8 (tigm) IST10284B7 (tigm) IST14982E3 (tigm) IST13441A9 (tigm)
IST14784E11 (tigm) IST14556B1 (tigm) IST13566F12 (tigm) IST14606G7 (tigm)
IST10891E9 (tigm) IST11934G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055549
Sequence
CTCATCGTGTCTTTGATGGCTTCATAACCTGAAGGTCCGAAGAGGCCAGATAGGCACCACCCTCAGGCCTTGGGCATCTATCTAGGTGGCTGCCGCTACT

ATGTACGCTGAGAGCAAAG - UNI6407 - - UNI10281 - - UNI11393 - - UNI29460 - GTATGAGAGATGAGTGTGGGGCGTCGAAG

AGTCAAGTTGCTGGGCATCCTGATGATGGCAAATGTCTTCATTTATTTGATTGTGGAAGTCTCCAAAAACAGTAGCCAAGACAAAAATGGAAAGGGAGGA

GTAATAATCCCGAAAGAGAAGTTCTGGAAGCCACCCAGCACTCCCCGGGCATACTGGAACAGGGAACAGGAGAAGCTGAACAGGTGGTACAATCCCATCT

TGAACAGGGTGGCCAATCAGACAGGGGAGCTAGCCACATCTCCAAACACAAGTCACCTGAGCTATTGTGAACCAGACTCGACGGTCATGACAGCTGTGAC

AGATTTTAATAATCTGCCGGACAGATTTAAAGACTTTCTCTTGTATTTGAGATGCCGGAATTACTCGCTGCTTATAGATCAACCGAAGAAATGTGCAAAG

AAGCCCTTCTTACTATTGGCGATAAAGTCCCTCATTCCACATTTTGCCAGAAGGCAAGCAATTCGGGAGTCTTGGGGCCGAGAAACCAACGTAGGGAACC

AGACAGTAGTGAGGGTCTTCCTGTTGGGCAAGACACCCCCAGAGGACAACCACCCTGACCTTTCGGACATGCTTAAGTTTGAGAGTGACAAGCACCAGGA

CATCCTCATGTGGAACTATAGAGACACATTCTTCAACCTGTCCCTGAAGGAAGTGCTGTTTCTTAGGTGGGTGAGCACTTCCTGTCCAGACGCAGAGTTT

GTCTTCAAGGGCGATGATGACGTGTTTGTGAACACCCATCACATCCTTAATTACTTGAATAGCTTATCCAAGAGCAAAGCCAAAGACTTGTTCATAGGTG

ACGTGATCCACAATGCTGGGCCTCACCGGGATAAGAAACTGAAGTACTACATCCCAGAAGTCTTCTACACCGGCGTCTACCCACCGTATGCCGGGGGTGG

TGGATTCCTGTACTCCGGCCCCCTTGCCTTGAGGCTGTACAGTGCGACTAGCCGGGTCCATCTCTACCCTATTGATGATGTTTATACGGGAATGTGCCTT

CAGAAACTGGGCCTTGTTCCAGAGAAGCACAAAGGCTTCAGGACATTTGATATTGAAGAGAAAAATAAGAAAAATATTTGTTCCTATATAGACCTAATGT

TAGTACATAGCAGAAAACCTCAAGAGATGATTGATATCTGGTCTCAGTTGCAAAGTCCTAATTTAAAATGCTGAAATAGACATGAGCTGCATTTCACAGA

AAGGCCTAGCCTGACTAGTTCCCATGGTGTGCTCTCACAATAGGTGAGTTCTGTGTGAGGCTATTAGCCTTCATGAGCAGGTAGCCCCTGGGCTCCCAAG

CCCTCAGTCCTTCCCTTGCCTTGTGAAGAGGGAAGGCTGAAGACAGCTCAGCATGGCAGGGTGAGTGGTTATGACCCTTCCTCTGGCTGCCGGTCCTCAG

TTTCTAATTTGTTTTCTTTCTCCTCCACAATTATGTATGTATGTGTGTATATATGTGTGTGTGTACATACATACATATATATATATGTAGGACACAACCT

GGTGGCTTTGTGAAATGGAATTCTATGTATTTTCATAAGATTTTGAAAGTTGTCTAGAAAGTAGACTGATGTCAATCTCCCGTCACCCAGCAGTATTGTC

CTTGTTACTAGAAACCGTTACTTCCTTTATGCAAGGAAAGCCACGCAGTGCGTGTAGTTCATCTTGTCAGGGCTTATGGCCATGAGGACAGAGGGGATTT

TCTTTTTACTTGTGTTTGGTTTCCTGGGTGGCATCATGGTAGTTAACCTATTTTTAGTATTTGAAGATCATGAGTGTGATTCCCTAATGGCCAACTGGAG

ACTGAGTAGCCCGACAGCCATGGGTCTGTGAGTGTTCAGAGACTGGGAAGCATTCGCCACTTCTGAGCTTTGGACGTGATTAGTCAGTTAAAACCCCAAG

ATTCTATTCTTGCCATATTATCACGTATTCCTTAGATAAAATTCTGGGTAGTGACACTTCCCTGTCTCAGTGTAGAAGTGCCTGTGCTTTTATTTATTGT

TCAGATCAAACACCAAAACATTTTCTTAAAAAATATTTTGTGTAATATTTTATTTGTATACAGTGTTTGTGAAATATTTAACTAGAGCATGATATTTTAT

TTTTTCTCATTTTTAATTCTTTGAGAATTTCATACAATGTGTTTTGATTGTATTCACCTCCCCATCTCCTCCCAGATCCAGCATGATGTTTTAAATGTTA

AGCTGTAACATGTTAGATAAAGTTAACTCTTATTTTTGAATTTTAAAATTTGGATGGGGGGGTATGAACTGCTAGAGAAAATAAAGTTCTGCCAAAATAT

TG
Translation
 - UNI6407 - - UNI10281 - - UNI11393 - - UNI29460 - MSVGRRRVKLLGILMMANVFIYLIVEVSKNSSQDKNGKGGVIIPKEKF

WKPPSTPRAYWNREQEKLNRWYNPILNRVANQTGELATSPNTSHLSYCEPDSTVMTAVTDFNNLPDRFKDFLLYLRCRNYSLLIDQPKKCAKKPFLLLAI

KSLIPHFARRQAIRESWGRETNVGNQTVVRVFLLGKTPPEDNHPDLSDMLKFESDKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDAEFVFKGDDDV

FVNTHHILNYLNSLSKSKAKDLFIGDVIHNAGPHRDKKLKYYIPEVFYTGVYPPYAGGGGFLYSGPLALRLYSATSRVHLYPIDDVYTGMCLQKLGLVPE

KHKGFRTFDIEEKNKKNICSYIDLMLVHSRKPQEMIDIWSQLQSPNLKC
Transcript ENSMUST00000062844
Sequence
GAGAGTAAGGCTCAGCGGCCGCCGCGGCAACAAGTGCTGGAGCTGAGGCGAGCCGGAGCCGCCCAGACCCCGCCGGGCCGCCCGTCCGCGCATTGCGCAT

GGAGCGAGAGCGGCGGCGGTCGCGGGGCTGAGCCGCAAGAGCGGCTGGGACGTGGATGCGGCCGCGGTCTTCCGCCCCGCCCCGCCGAGCTGGAGGTGTC

CCTAGACAAG - UNI6407 - - UNI10281 - - UNI29460 - GTATGAGAGATGAGTGTGGGGCGTCGAAGAGTCAAGTTGCTGGGCATCCTG

ATGATGGCAAATGTCTTCATTTATTTGATTGTGGAAGTCTCCAAAAACAGTAGCCAAGACAAAAATGGAAAGGGAGGAGTAATAATCCCGAAAGAGAAGT

TCTGGAAGCCACCCAGCACTCCCCGGGCATACTGGAACAGGGAACAGGAGAAGCTGAACAGGTGGTACAATCCCATCTTGAACAGGGTGGCCAATCAGAC

AGGGGAGCTAGCCACATCTCCAAACACAAGTCACCTGAGCTATTGTGAACCAGACTCGACGGTCATGACAGCTGTGACAGATTTTAATAATCTGCCGGAC

AGATTTAAAGACTTTCTCTTGTATTTGAGATGCCGGAATTACTCGCTGCTTATAGATCAACCGAAGAAATGTGCAAAGAAGCCCTTCTTACTATTGGCGA

TAAAGTCCCTCATTCCACATTTTGCCAGAAGGCAAGCAATTCGGGAGTCTTGGGGCCGAGAAACCAACGTAGGGAACCAGACAGTAGTGAGGGTCTTCCT

GTTGGGCAAGACACCCCCAGAGGACAACCACCCTGACCTTTCGGACATGCTTAAGTTTGAGAGTGACAAGCACCAGGACATCCTCATGTGGAACTATAGA

GACACATTCTTCAACCTGTCCCTGAAGGAAGTGCTGTTTCTTAGGTGGGTGAGCACTTCCTGTCCAGACGCAGAGTTTGTCTTCAAGGGCGATGATGACG

TGTTTGTGAACACCCATCACATCCTTAATTACTTGAATAGCTTATCCAAGAGCAAAGCCAAAGACTTGTTCATAGGTGACGTGATCCACAATGCTGGGCC

TCACCGGGATAAGAAACTGAAGTACTACATCCCAGAAGTCTTCTACACCGGCGTCTACCCACCGTATGCCGGGGGTGGTGGATTCCTGTACTCCGGCCCC

CTTGCCTTGAGGCTGTACAGTGCGACTAGCCGGGTCCATCTCTACCCTATTGATGATGTTTATACGGGAATGTGCCTTCAGAAACTGGGCCTTGTTCCAG

AGAAGCACAAAGGCTTCAGGACATTTGATATTGAAGAGAAAAATAAGAAAAATATTTGTTCCTATATAGACCTAATGTTAGTACATAGCAGAAAACCTCA

AGAGATGATTGATATCTGGTCTCAGTTGCAAAGTCCTAATTTAAAATGCTGAAATAGACATGAGCTGCATTTCACAGAAAGGCCTAGCCTGACTAGTTCC

CATGGTGTGCTCTCACAATAGGTGAGTTCTGTGTGAGGCTATTAGCCTTCATGAGCAGGTAGCCCCTGGGCTCCCAAGCCCTCAGTCCTTCCCTTGCCTT

GTGAAGAGGGAAGGCTGAAGACAGCTCAGCATGGCAGGGTGAGTGGTTATGACCCTTCCTCTGGCTGCCGGTCCTCAGTTTCTAATTTGTTTTCTTTCTC

CTCCACAATTATGTATGTATGTGTGTATATATGTGTGTGTGTACATACATACATATATATATATGTAGGACACAACCTGGTGGCTTTGTGAAATGGAATT

CTATGTATTTTCATAAGATTTTGAAAGTTGTCTAGAAAGTAGACTGATGTCAATCTCCCGTCACCCAGCAGTATTGTCCTTGTTACTAGAAACCGTTACT

TCCTTTATGCAAGGAAAGCCACGCAGTGCGTGTAGTTCATCTTGTCAGGGCTTATGGCCATGAGGACAGAGGGGATTTTCTTTTTACTTGTGTTTGGTTT

CCTGGGTGGCATCATGGTAGTTAACCTATTTTTAGTATTTGAAGATCATGAGTGTGATTCCCTAATGGCCAACTGGAGACTGAGTAGCCCGACAGCCATG

GGTCTGTGAGTGTTCAGAGACTGGGAAGCATTCGCCACTTCTGAGCTTTGGACGTGATTAGTCAGTTAAAACCCCAAGATTCTATTCTTGCCATATTATC

ACGTATTCCTTAGATAAAATTCTGGGTAGTGACACTTCCCTGTCTCAGTGTAGAAGTGCCTGTGCTTTTATTTATTGTTCAGATCAAACACCAAAACATT

TTCTTAAAAAATATTTTGTGTAATATTTTATTTGTATACAGTGTTTGTGAAATATTTAACTAGAGCATGATATTTTATTTTTTCTCATTTTTAATTCTTT

GAGAATTTCATACAATGTGTTTTGATTGTATTCACCTCCCCATCTCCTCCCAGATCCAGCATGATGTTTTAAATGTTAAGCTGTAACATGTTAGATAAAG

TTAACTCTTATTTTTGAATTTTAAAATTTGGATGGGGGGGTATGAACTGCTAGAGAAAATAAAGTTCTGCCAAAATATTGCATATACT
Translation
 - UNI6407 - - UNI10281 - - UNI29460 - MSVGRRRVKLLGILMMANVFIYLIVEVSKNSSQDKNGKGGVIIPKEKFWKPPSTPRAYWNR

EQEKLNRWYNPILNRVANQTGELATSPNTSHLSYCEPDSTVMTAVTDFNNLPDRFKDFLLYLRCRNYSLLIDQPKKCAKKPFLLLAIKSLIPHFARRQAI

RESWGRETNVGNQTVVRVFLLGKTPPEDNHPDLSDMLKFESDKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDAEFVFKGDDDVFVNTHHILNYLNS

LSKSKAKDLFIGDVIHNAGPHRDKKLKYYIPEVFYTGVYPPYAGGGGFLYSGPLALRLYSATSRVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEK

NKKNICSYIDLMLVHSRKPQEMIDIWSQLQSPNLKC

For any suggestions or comments, please send an email to unitrap@crg.es