Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051705 (Senp8)
Chromosomal location
Chr 9: 59582070 - 59598445 (-)
Description
SUMO/sentrin specific peptidase 8 Gene [Source:MGI Symbol;Acc:MGI:1918849]
RefSeq_dna
NM_027838 
RefSeq_peptide
NP_082114.1 
UniGene
Mm.279070 Mm.469182 
MGI
MGI:1918849 
Uniprot/SWISSPROT
Q9D2Z4 
Uniprot/SPTREMBL
Q3UWN3 
Human Ortholog
ENSG00000166192 (SENP8)
Omim not available
UniTrap UNI11930
Vector Insertion
Chr 9: 59585676 - 59598384
Public Clones E078H03 (ggtc) Q011B02 (ggtc) IST14144E11 (tigm) IST14508H12 (tigm)
IST14317F10 (tigm) IST14846H10 (tigm) IST15047B10 (tigm) IST13601F3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000051039
Sequence
ACTTTCCGGCCAGTACAGAGCTCCCTGAAGGCTGGTTGGGTTGGTGAGGCCTGAGGAATAG - UNI11930 - CTTCTGGAATTTCTGAGAATCCCTG

CTCAATACAAGATGGACCCTGTGGTCTTGAGTTATATGGACAGTCTATTGCGGCAATCAGATGTCTCACTATTGGACCCTCCAAGCTGGCTCAACGACCA

CATTATTGGGTTTGCCTTTGAATACTTTGCCAATAGTCAGTTTCATGACTGCTCAGACCATGTCTGTTTCATCAGCCCTGAAGTCACCCAGTTCATTAAG

TGCACCAGCAGCCCTGCAGAAATTGCCATGTTCCTTGAACCCCTGGATCTTCCCCACAAAAGAGTGGTATTTTTAGCCATCAATGATAATTCTAACCAGG

CAGCCGGAGGTACCCACTGGAGTTTGTTGGTTTATCTCCAAGATAAAAATAGCTTCTTTCATTATGATTCCCATAGCAGGAGCAACTCAATCCATGCAAA

GCAGGTAGCAGAGAAACTGAAGGCTTTCTTAGGCAGCAAAGGAGACAAACTGGTCTTTGTGGAAGAGAAAGCCCCAGCTCAAGAGAACAGCTATGACTGT

GGGATGTACGTGATATGTAACACCGAGGCCTTGTGTCAGAGTCTCTTTAGACGGCAGCCAGAGTCCCCGCTGCAGCTACTCACCCCGACATACATCACAA

AGAAGAGAGGAGAATGGAAAGATCTAATTGCCAGACTTGCTAAAAAAAACGAAGTAGCTACTGAAGAATGCTCGTGATGTTTGAAGTCTGGTCTTTCTGC

CTTTCTCTATGGTGACAGCCTCAGTGCCTGAGGGAAAACCACTAGTAGATGAAAGTTTACAATTCCTGCTTCTTTATTGTTCTGTAAGAATGTCATCCTC

TGTGTTCTCTGAATGGGAAGTTTCACTGTAATCCTGAGGAAAGCGGTACATTCTGTGGAAATGTCTTGAACTTACGTACCAAAACTTTAGTAACAAACCT

CTCATTACACAGTTTCAAGTAAGAGCCTTCTTTTCTTGTTGGTATAAAACTATTATCCCTTTTGGTCTCCCTTCCTTGTTGGCTTATTCCAAAGAAGTGA

TGTTCCAAAGCAAACCAATAACATGAAGTCTAAAGACATGCATGAAGAAAACAGCAGAAGAACCAACATCTTTGTTTCACAGCCATAGTGAGGCGTCCGA

CTGGAGGTGGATCATTACCTAACTCCACTTATAGCCTTCGGTTTATAAAAATAAGGCATTCTCGGGTGCAAAGGCTTTCCCGTCTGCAAATACTTAATAA

AGATGACTTTAGCTCATCTTTATCTATTTCCTGGAATGCTTTAAGAACATGGAACGTCATTAAAATAAATGGCTATAGACTGGGAGCATAACTTTGAGGA

AGAGCACCTGCTGTGGTGTGCAGGAAGACTTGAACTCAATTCCAAATTGCAGTAAATAAAAACAAAACAAAACCACCTGCGGGTGTGTGGTGCATCTCTG

GTTTCCCTGAGTGAGTGGGTGACTCAGCTCTAAGTGATGGTGACTTTGTCTTGTCCTTTACATGGATTTAGTCCCTCCCTTTACCTAACGTGCTGTAGTT

CTCAAGCTCACAGGATAACCAGCCAAGATTAGCTGTTATTTCAGACATGTTCTACTTTTGGTAGATAGAGCTTTTACACTAATCTAGCAGAGTTGTTTTC

AGGTATGTTGTGGTAATCTCCATACTATTAATGATCTAAAACATAGGAGCAGTTTATTTTTTAAATATAAAGGAAAAAAAATGTCACCTTCCTCAAACTT

AATCCAAAAAGTAAATGGTATAACTTTAAAATATGGAAACAAGACTAAAATGAAATACTACTCCCCACAAAGCTATTGATAAATTTTTCTACTTGTTTCA

AGTAATTAACACAAGAAGTTGGGCACACATAATAATTAGACCCCGATAACAATTTGCAGTGTATATGGGATGTAAAACACAAAGATGTGATTCACTCACT

GAAACTGACTTCAGCTACTTCTCCACTCTAACCCTGACCCCAGCGTTCATAACCCAAAATAACCTCTCCAGTCAGCAACTACAGAGGTACTCAGTTCCCT

GGAGCCAGGAAGAGGAAGATGGTAAAAGTGTAAAAGCACAGGCTGCATAAGCAGGCTTCAGTGTATGGGATCTGAAACAAGTTTAAAAAAGGAAAAAAAA

AAAATGGGAGAGAGGGGATTCCATTTCAAGTGAGCCCATTTCAAACCAAAAGACTTAATGAAAGATAGGCAGGAAAATGTTAGAAATTGGCAGTGAGCCA

TAAATGAAAGAGACAGGACAGGGAGAGCAAGCGTAGGGACACAGGTTCTGATAGGCCACCAGTGGAGATAAAGGCAGCAAGCAGTGTCATTTCAGTGACT

GTTTACTTAGGCAGCTGATCTAGACCTTCGGAGAGTCTGCCCTCTCAGGGGAAGGTTATCTTTCGGGTAATACACAGTATGCTTGTTTACTTAAACATCA

GCCTGTCTCCCCTTTAATAGCTAATACATGCGAGAGCAGTCTTGTCTAATTCCCTAAGGTTTGTCCCAGAATTATTTTTTAACTAAACTATTGTCTTTAT

TTAAAAACATAAAAATATACAATCTTTTTCCAAATACATAACATGTTTGTAATCAAACTTTAAGTTAGTCTTTTGTTGAGTAGGCTTTGTGAGACAGCTC

AGAGGATTAACACACTTACCACCAACCCTGATTTGACCCCCAGGTCCTACTTAGTAAGATGAGAGAATTGGATTGGCTCCTTGTAAGTTGTCCTGTCTCC

CAATGTACACCTTGGCATACTTGTAACTACTCACAATATATATAAATAAGTGTAAGAGAATCTTGAGTAGATAATTTGAAAATCTTGACTTTGTAAATAA

CAGATTTTGAGCTTACACGTAGTATTTCACTAGATACTAGGATAGTCCATAAGGTATATACCTGCTTAACCATACACCATTAATGTAATACTCATAATAC

TATACTAATAATATAAATACATTGATAATAATATTAATATATTTTATTTCAAATATCCAATTGTGCTGCCCCACAAGTATATTTGAATATGTCTAACCTG

GGTCTCAATATGGAATTGAGAAGTTACATATATAAACCCAACATTAGCTGGGAGTAATATATATGTGTATTCTCTACCTCAGGGCTATACCTTCAGCCCT

ATTTTTTATTTTTTGACTTTGTGGGTTTGGTTTGGTTTGGGTTATTTTGTTGGTGGTGGTGGTGGTTTTTTGTTTTTGTTGCTGTTGTTGTTGTTTTATT

TTGTTGAAAAAGGGTTTCTCTGTGTAGCCCTGGAACTCAGGTCATGGACCATTCTGTGTTGTGCAGTTAAATACTTTAGATACCCTTAAAAATATATGTC

CATGTGTTGCTATAATTTAAAGTACTAGATAACATTATAAAGGTTTTATGCATTTATAGCCATTTTTATTGTTGGTTTTTTTCAATGGTAGAGGAATTGA

GACAGTCTCTCATGGCCCAGGCTGGCCTACAACTTGATATGTAGTCACTTCTGATCCTCAGACCTCCAGCTCTGGAGGAATAAGATTACAGGTATATGCC

ACCACTCCTGGCTAATTTCATTTATTCTTATATTTTTCCAAGTGGTCTTATTCCTATTTTATAATAAATAAATGCAATGTC
Translation
 - UNI11930 - MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVCFISPEVTQFIKCTSSPAEIAMFLEPLDLPHKRVV

FLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSIHAKQVAEKLKAFLGSKGDKLVFVEEKAPAQENSYDCGMYVICNTEALCQSLFRRQPESP

LQLLTPTYITKKRGEWKDLIARLAKKNEVATEECS

For any suggestions or comments, please send an email to unitrap@crg.es