Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051730 (Mettl5)
Chromosomal location
Chr 2: 69709271 - 69723661 (-)
Description
methyltransferase like 5 Gene [Source:MGI (curated);Acc:Mettl5-001]
RefSeq_dna
NM_029280 
RefSeq_peptide
NP_083556.2 
MGI
MGI:1922672 
Uniprot/SWISSPROT
Q8K1A0 
Uniprot/SPTREMBL
A2AV02 Q3UZW4 
Human Ortholog
ENSG00000138382 (METTL5)
Omim not available
UniTrap UNI24703
Vector Insertion
Chr 2: 69719469 - 69723305
Public Clones IST10111H12 (tigm) IST11007B6 (tigm) IST11109D6 (tigm) IST12060H8 (tigm)
IST11260H9 (tigm) IST11063C4 (tigm) IST12630B12 (tigm) IST14740G11 (tigm)
IST14937E8 (tigm) IST12372H12 (tigm) IST14481E6 (tigm) IST11867F3 (tigm)
IST10653C12 (tigm)
Private Clones OST209482 (lexicon) OST67456 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13568
Vector Insertion
Chr 2: 69719006 - 69719353
Public Clones CMHD-GT_268F2-3 (cmhd) CMHD-GT_304E11-3 (cmhd)
Private Clones OST310077 (lexicon) OST59923 (lexicon) OST38422 (lexicon) OST37695 (lexicon)
OST37692 (lexicon)
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25837
Vector Insertion
Chr 2: 69715804 - 69717242
Public Clones not available
Private Clones OST159181 (lexicon)
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35187
Vector Insertion
Chr 2: 69711940 - 69717242
Public Clones IST11680H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12780
Vector Insertion
Chr 2: 69709839 - 69711940
Public Clones CMHD-GT_367G9-3 (cmhd) IST12456C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15869
Vector Insertion
Chr 2: 69709374 - 69709788
Public Clones not available
Private Clones OST471245 (lexicon) OST413662 (lexicon) OST412326 (lexicon) OST396960 (lexicon)
OST391133 (lexicon) OST345065 (lexicon) OST318955 (lexicon) OST154761 (lexicon)
OST133285 (lexicon) OST18709 (lexicon) OST8645 (lexicon)
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000060447
Sequence
GGAGGGACCGCGAGGACCAGCTAGAGGCATACGAGTGCTTTCCTGGAGCGTCTGGGTTCCACGGGCGGCGATCCCCGCGAGGCTCGTGGGATCCCCTCGC

TGAGTCCTAAATAGTCTGTCCCCGACCCTCCACCCCACCCCCACCCTGCACCGCTGGGGAGTTTCGGGTTAGGTAGACTTCCCTGCAGCTCCCGTGCTGT

GAAGCCCCAGGAGCCCAAACTTTAAAATACAGAGAAAACGATGAAGAAGTTAAAGCTTAAGGAACTAGAGAGTCGCCTGCAAGAAGTGGATGGATTCGAA

AAGCCCAAGTTACTTCTAGAACAGTATCCCACCAGGCCGCACATTGCAG - UNI24703 - CATGCATGCTTTATACAATCCATAACACATACGATGA

CATTGAAAACAAAGCGGTTGCAGATCTAGGATGTGGCTGTGGAGTACTTAGCATCGGAGCGGCAATGCTAGGAGCAGG - UNI13568 - GTTGTGTG

TTGGATTTGACATAGATGAAGATGCACTGGAAATATTTAATAAGAATGTGGAAGAGTTTGAGCTAACAAATGTTGATATGATTCAGTGTGATGTGTACTC

ATTATCTAACAGAATGTCCAAGTTATTTGATACAGTAATTATGAATCCTCCCTTTGGGACCAAAAATAATAAAG - UNI25837 - - UNI35187 -

 GGACAGATATGGCTTTTCTGAAGACTGCTTTGGGAATGGCAAGAACAGCAGTATATTCTTTACACAAGTCCTCAACTAGGGAA - UNI25837 - - 

UNI35187 - CATATTCAAAAGAAAGCTGCTGAATGGAAAGTCAAGATAGAAATTATTGCAG - UNI12780 - - UNI35187 - AGCTTCGATA

TGATCTACCAGCATTATACAACTTTCATAAAAAGAAATCT - UNI15869 - GTGGACATCGAAGTGGACCTAATTCGCTTTTCTTTTTAAAAGCTTC

TGAAGACAAAAAGCAGCTTAAAATCTAACTAAGGAATAAAAACACTGCTTACTAAAT
Translation
MKKLKLKELESRLQEVDGFEKPKLLLEQYPTRPHIAA - UNI24703 - ACMLYTIHNTYDDIENKAVADLGCGCGVLSIGAAMLGAG - UNI1356

8 - GLCVGFDIDEDALEIFNKNVEEFELTNVDMIQCDVYSLSNRMSKLFDTVIMNPPFGTKNNKG - UNI25837 - - UNI35187 - GTDMAFL

KTALGMARTAVYSLHKSSTRE - UNI25837 - - UNI35187 - HIQKKAAEWKVKIEIIAE - UNI12780 - - UNI35187 - ELRYDLP

ALYNFHKKKS - UNI15869 - VDIEVDLIRFSF
Transcript ENSMUST00000112258
Sequence
ACTGCGGGGAGGGACCGCGAGGACCAGCTAGAGGCATACGAGTGCTTTCCTGGAGCGTCTGGGTTCCACGGGCGGCGATCCCCGCGAGGCTCGTGGGATC

CCCTCGCTGAGTCCTAAATAGTCTGTCCCCGACCCTCCACCCCACCCCCACCCTGCACCGCTGGGGAGTTTCGGGTTAGGTAGACTTCCCTGCAGCTCCC

GTGCTGTGAAGCCCCAGGAGCCCAAACTTTAAAATACAGAGAAAACGATGAAGAAGTTAAAGCTTAAGGAACTAGAGAGTCGCCTGCAAGAAGTGGATGG

ATTCGAAAAGCCCAAGTTACTTCTAGAACAGTATCCCACCAGGCCGCACATTGCAG - UNI24703 - CATGCATGCTTTATACAATCCATAACACAT

ACGATGACATTGAAAACAAAGCGGTTGCAGATCTAGGATGTGGCTGTGGAGTACTTAGCATCGGAGCGGCAATGCTAGGAGCAGG - UNI13568 - G

TTGTGTGTTGGATTTGACATAGATGAAGATGCACTGGAAATATTTAATAAGAATGTGGAAGAGTTTGAGCTAACAAATGTTGATATGATTCAGTGTGATG

TGTACTCATTATCTAACAGAATGTCCAAGTTATTTGATACAGTAATTATGAATCCTCCCTTTGGGACCAAAAATAATAAAG - UNI25837 - - UNI

35187 - GGACAGATATGGCTTTTCTGAAGACTGCTTTGGGAATGGCAAGAACAGCAGTATATTCTTTACACAAGTCCTCAACTAGGGAAGTAAGCTCA

TAATATTATCATTTTAGGTGGCCCACACCTTTAATCCCAGCACTCAGGAGGTAGAGGCAGGTGGATATCTGAGTTCAAGACCAGCCTGGTCTATGAAATG

AGTTCCAGGACAGCCGGGACTATACAGAGAAACCCTGTCTGAGAAAACAACAACAAATAATAATTATTTTTATTATTTTATTTCCTGATTGATTTTCATG

TATATGTGTGAGCACATATCAACATACATATGGAGGTCAGATCAACCTAGGAATCAGTTCTCTTCACCATGAAAATCTCCAAGACCAAACTCAGACCCAC

CATCAGGCTGGGTAGCAAGTGACCTTTACCCACTGAGCCATCTCACTCATCCGAGGGTAAATTTTTATAAAAACACAGCTTAAAGCAAAATAGATCTGAG

TTCAGAAGCCACCTATTCTAGGCTGGTGAGATGGCTCAGTGGACTAGGGACTGGGTTGCTGGCAAGCAAGACTACTTGAATCAGATCTCTAGAACCCACG

TGTGTGCTATGGAATACATCACACAAATATATGAATATTATAAAAAGAAAAAAAGCTCATATAATACTATGTACAAGATGTATTTCAGGACATGGTGACG

AGTTATTATTTGAATGTTACTATAGCATGACTCTAGACCCAGACTGTCCTGAATTAGCACATAAGCTCTGCTACATCTTAGCTGTTACCCTGCTCAAAAT

TACTTGGGTTTCAGTACCATCTATACTATATGACCCTGTGTTCTTAGGAACTAAGAATAGGCTGTACTTCATATACTTTTCTGGATTAAATGAGTTAGTA

TGTATGAAACATTTAGGTCTGTGTCTGGCATATTTGCTAGTTGTTATTTTTACCTGAAATTATATATCTAAAGATTTGGTTTTGTTAATCTTATGTATAT

AAGGAATGTTTTGCCTGTATGTTTGTATTCAACATGTGTGCCTGGTGCCCAAGGAGACCAGAAGAGGGCATCATTCCTAGGACTGGATTTATAGATAGTT

GTGATCTATCAAGTGTGCTAGAATTTTTTTTTTAATTTATTTACGTATTTAATGTATGAGTGCTCTGCTGCATGTACACCCATGCACCCAGGAGAGGGCA

TCAAATTCCGATTGAACTCAGGACCTCTGGAGTAGCAGCCAGTGCTCTAAATGGTTGAGCCATCTCAACACCTGTGCTAAGAATTTAACCAGGTCCTCTG

AAGTACAGCAAGTGCTCTAACTGCTAAGTCACCATTCCACCCTCCTTGTTTTCACCTGCCCTTATCTAAGAAAAGTTAAGACAGCAAAAGAGAAAGACAC

CAAATATCAACCCAATATCAACATGCCATGTATATACATGCACAC
Translation
MKKLKLKELESRLQEVDGFEKPKLLLEQYPTRPHIAA - UNI24703 - ACMLYTIHNTYDDIENKAVADLGCGCGVLSIGAAMLGAG - UNI1356

8 - GLCVGFDIDEDALEIFNKNVEEFELTNVDMIQCDVYSLSNRMSKLFDTVIMNPPFGTKNNKG - UNI25837 - - UNI35187 - GTDMAFL

KTALGMARTAVYSLHKSSTREVSS

For any suggestions or comments, please send an email to unitrap@crg.es