Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051747 (Ttn)
Chromosomal location
Chr 2: 76542037 - 76820604 (-)
Description
titin Gene [Source:MGI (curated);Acc:Ttn-019]
RefSeq_dna
NM_011652 
RefSeq_peptide
NP_035782.3 NP_082280.2 
UniGene
Mm.373672 Mm.398923 Mm.398928 Mm.402907 Mm.452281 Mm.453292 Mm.473358 
MGI
MGI:98864 
Uniprot/SWISSPROT
A2ASS6 
Uniprot/SPTREMBL
Q3TZL3 Q62319 Q812E1 Q8BID4 Q8BIH3 Q8BM32 Q8BUC9 Q8BUJ0 Q8BUJ6 Q8BUX4 Q8C139 Q8R4N1 Q8R4N3 Q9CTL3 Q9CV48 A2AT58 A2AT59 A2AT60 A2AT61 A2AT63 Q3UT48 Q8R112 A2AT56 A2AT67 A2AT70 A2AT65 A2AT68 Q9D6N4 
Human Ortholog
ENSG00000155657 (TTN)
Omim not available
UniTrap UNI36362
Vector Insertion
Chr 2: 76656792 - 76659242
Public Clones IST11346G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17655
Vector Insertion
Chr 2: 76654599 - 76654663
Public Clones not available
Private Clones OST438844 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35827
Vector Insertion
Chr 2: 76646807 - 76648177
Public Clones IST11838A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35899
Vector Insertion
Chr 2: 76646576 - 76647075
Public Clones IST11838A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32138
Vector Insertion
Chr 2: 76646047 - 76646717
Public Clones IST10946F12 (tigm) IST11691D8 (tigm) IST14939E12 (tigm) IST10333F2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33036
Vector Insertion
Chr 2: 76645117 - 76646175
Public Clones IST11752B6 (tigm) IST12416B3 (tigm) IST11691D8 (tigm) IST10570E3 (tigm)
IST11681G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16643
Vector Insertion
Chr 2: 76641349 - 76641474
Public Clones not available
Private Clones OST456411 (lexicon) OST142288 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32541
Vector Insertion
Chr 2: 76641349 - 76645261
Public Clones (sanger) IST10817F11 (tigm) IST10815A11 (tigm) IST10606A9 (tigm)
IST11168G2 (tigm) IST12641G6 (tigm) IST12946D3 (tigm) IST10860H2 (tigm)
IST11008D11 (tigm) IST12657D12 (tigm) IST13126A9 (tigm) IST15089G10 (tigm)
IST11863A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14991
Vector Insertion
Chr 2: 76640287 - 76641474
Public Clones PST3310-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111882
Sequence
GAGCAGTCGCGCATTCCCACCTCGCCTCGGGTGTAGGGATTGCATAGGAAACAAAACCACACAGTCAAGACTGTGTGGTTTTGTTTGGAGGGTTAGAGGC

TCACCGATTCATGTCGGAGATGGTTGGAAAAACCAACTCTACGTAGGACGTCGTTTCAGAAGCAAACTTGGGCTTGGTCCCACCCTTTTTGGGCACTCCT

GAGAAATCAG AGTGCCTGAAAAGATGACTACTCAAGCACCGATGTTTACGCAGCCGTTACAAAGCGTTGTGGTACTGGAGGGTAGTACCGCAACCTTTG

AGGCTCACGTTAGTG GTTCCCCAGTTCCTGAGGTGAGCTGGTTTCGGGATGGCCAGGTGATTTCAACTTCCACTCTGCCCGGCGTGCAGATCTCCTTTA

GCGATGGCCGCGCTAGATTGATGATCCCCGCCGTGACTAAAGCCAACAGTGGACGATACTCCCTGAGAGCCACCAATGGATCTGGACAAGCGACTAGTAC

TGCTGAGCTTCTTGTGACAG CCGAGACAGCACCACCCAACTTCAGTCAGCGGCTGCAGAGCATGACTGTGAGACAAGGAAGCCAAGTGAGACTCCAAGT

GAGAGTGACTGGAATCCCTACACCTGTGGTGAAGTTCTACCGGGATGGAGCCGAAATCCAGAGCTCCCTTGATTTCCAAATTTCTCAAGAAGGAGACCTC

TACAGCTTACTGATTGCCGAAGCATACCCTGAAGACTCCGGGACCTATTCTGTAAATGCCACCAACAGCGTTGGAAGAGCTACTTCCACTGCAGAATTGG

TGGTTCAAG GTGAAGAAGTAGTACCTGCTAAAAAGACAAAGACGATCGTGTCGACTGCTCAGATTTCAGAAACAAGACAAACCCGGATTGAAAAA AAG

ATTGAAGCCCACTTTGATGCCAGATCAATCGCAACAGTTGAGATGGTCATAGATGGTGCCACTGGACAGCTGCCACATAAAACACCTCCCAGGATACCTC

CTAAGCCCAAGTCCAGGTCTCCGACACCACCTTCCATTGCTGCCAAAGCACAGCTGGCCAGACAACAGTCCCCATCACCAATAAGACACTCTCCCTCCCC

AGTCAGACACGTGCGGGCACCAACCCCATCTCCAGTCAG GTCCGTGTCTCCAGCGGGGAGGATCTCCACTTCCCCGATCAGATCCGTGAAGTCGCCACT

GCTCATTCGCAAGACTCAGACCACCACCATGGCCACAGGCCCCGAGGTGCCTCCCCCTTGGAAGCAAGAGGGCTACGTGGCCTCCTCGACTGAGGCTGAG

ATGAGAGAGACGACAATGACAAGCTCTACCCAGATCAGAAGAGAAGAGAGGTGGGAAGGGAGATACGGGGTCCAGGAGCAAGTGACCATCAGTGGAGCCG

CGGCTGCTGCGGCCAGTGCGTCGGTCAGCTCGTCATTCACGGCAGGAGCCATCACCACTGGGACTAAGGAG GTGAAACAAGAGACAGACAAGAGTGCAG

CTGTTGCGACTGTCGTTGCTGCTGTTGATATGGCCAGAGTGAGAGAACCAGCCATCAGTGCTGTAGAGCAAACTGCTCAGAGGACAACCACGACTGCTGT

GCATATACAACCTGCTCAAGAACAG GCGAGAAAAGAGGCGGAGAAGACCGCAGTAACCAAGGTTGTAGTTGCTGCCGATAAAGCCAAGGAACAGGAACT

AAAATCACGAACCAGAGAAGTGATGGTGACAACGCAAGAGCAGACTCACATATCTCATGAGCAG ATAAGAAAAGAAACTGAAAAAGCATTTGTACCAAA

GGTAGTGATCTCCGCAACCAAAGCCAAAGAGCAAGAAACTAGAATCACGGGAGAAATTACTACAAAACAAGAGCAAAAGCGAATAACTCAAGAAACA AT

AAGACAGGAAACTGAGGAAATTGCTGCATCCATGGTAGTGGTTGCCACCGCCAAGTCCACAAAACTAGAGGCAGCTGTGGGAGTTCAAGAAGAGACTGCC

ATACAACAGGATCAAATGCACCTCACTCATGAACAG ATGATGAAGGAAACTAGGAAAACAGTGGTACCCAAAGTCATAGTTGCCACGCCCAAGATTAAA

GAGCAAGATTTAGTATCAAGAAGTAGAGAAGCCATCACTACCAAAAGAGATCAAGTTCAAATAACTCAGGAAAAG AAGAGAAAGGAAGTGGAAACAACT

GCCTTGTCTACAATAGCAGTTGCTACTGCTAAAGCCAAAGAGCAAGAAACAGTTCTGAGGTCTAGAGAAGCCATGGCCACTAGACAAGAACACATCCAAG

TTACCCATGGACAG GTGGGCGTTGGGAAGAAGGCAGAAGCCGTGGCAACAGTTGTAGCTGCTGTGGACCAGGCCCGAGTGAGGGAACCCAGAGAGCCTA

CGCATGTGGAGGAATCGCATTCTCAGCAGACTACGTTAGAGTATGGCTACAAAGAACACATTTCCACCACAAAGGTCCCAGAGCAGCCCCGGCGCCCAGC

CTCAGAGCCCCACGTTGTCCCTCAAGCAGTCAAGCCTGCTGTGATTCAGGCTCCTTCTGAGACTCATATCAAAACTACTGACCAAATGGGAATGCATATA

TCGTCACAG GTCAAGAAAACTACAGATATCTCAACAGAAAGATTAGTTCATGTGGATAAACGCCCCCGCACAGCGAGCCCTCACTTTACTGTTTCAAAA

ATTTCTGTACCTAAGACAGAACATGGATATGAG GCATCGATAGCTGGTAGCGCTATCGCCACACTACAAAAAGAATTGTCAGCCACATCTTCAACTCAG

AAGATCACCAAATCCGTGAAGGCACCCACCGTGAAGCCTGGGGAGACGAGAGTAAGGGCGGAGCCCACCCCTTCCCCACAGTTCCCCTTTGCTGACATGC

CGCCGCCAGACACTTACAAGAGTCAGGCTGGCATTGAGGTGAAGAAGGAAGTCGGGGTGAGCATCAGTGGCAGCACCGTTCGTGAGGAGCACTTCGAAGT

ACTGCGCGGACGTGAAGCCAAG GTAACAGAGACAGCACGAGTGCCTGCTCCTGCTGAAGTGCCTGTTACTCCGCCTACCTTGGTCTCG GGCTTAAAAA

ACGTGACTGTCATAGAAGGCGAATCTGTCACCTTGGAGTGCCACATCTCTGGATACCCATCCCCCAAGGTGACATGGTACAGAGAAGACTACCAAATCGA

AAGTTCCATTGATTTCCAGATAACCTTCCAGGGTGGAATTGCTCGTCTCATGATCCGCGAAGCCTTTGCGGAAGACAGCGGACGGTTTACCTGCAGCGCC

GTGAATGAGGCCGGGACCGTCAGCACTTCCTGCTATCTTGCTGTGCAAG TGTCAGAAGAGTTTGACAAGGAAACAACTCTGACTGAGAAATTTGCCACC

GAAGAGAAACG CTTCGTGGAGTCAAGAGATGTAGTCATGACCGACACCAGCATCACAGAGGAGCAGGCAGGGCCTGGAGAGCCTGCTGCGCCTTTCTTC

ATTTCAAAGCCGGTGGTCCAGAAACTGGTGGAGGGTGGGAGTGTTGTGTTTGAATGCCAGATCGGCGGCAACCCAAAGCCCCACGTCTACTGGAAAAAAT

CTGGCGTTCCTCTCACCACTGGATACAG ATACAAAGTGAGTTATAACAAGCAGACTGGGGAATGCAGACTGGTGATTTCTATGACGTTCGCTGATGATG

CTGGAGAATACACTATTGTCATCCGAAACAAGCACGGGGAGACGTCTGCATCTGCCTCCTTGCTGGAGGAAG CTGATTACGAGGCATTGGTGAAGACTC

AGCAAGAAATGCTTTACCAGACACAAATGAGCACATTTATTCAAGAACCCAAAGTGGGGGAAATAGCACCTGGATTTGCATATTCTGAATATGAGAAGGA

ATATGAAAAGGAACAGGCCTTAATTAGGAAGAAAATGGCCAAAGATACTGTGATGGTCAGGACTTTTGTAGAAGACCAA GAATTCCACATCTCTTCTTT

TGAAGAGAGGCTCATTAAAGAGATTGAATACAGAATAATAAAGACTACGCTGGAAGAACTTCTTGAGGAGGATGGAGAAGAGAAGATGGCAGTCGACATT

TCTGAATCTGAAGCTATCGAGTCAGGATTTGATATAAGGATAAAAAATTATAGAATTCTTGAGGGGATGGGTGTCACTTTTCATTGCAAGATGTCTGGAT

ATCCGTTACCCAAG ATTGCGTGGTATAAGGATGGCAAGCGCATCAGACATGGGGAAAGATATCAAATGGACTTTCTACAAGATGGCAGAGCCAGCCTGC

GTATACCTGTTGTCCTTCCAGAGGACGAGGGCATCTATACTGCATTTGCCAGCAATATCAAAGGAAATGCGATTTGCTCTGGGAAGCTGTACGTGGAGCC

TGCTGCACCATTTAGCGCTCCAACTTACATGCCCACACCAGAAGCAGTGAGCAGAATCAG GTCTGTCTCTCCACGTTCACTGAGCAGGTCACCTATACG

TATGTCTCCTGCGATGTCCCCTGCACGAATGTCCCCCGCACGGATGTCCCCTGCACGGATGTCCCCCGCACGGATGTCTCCTGGACGCAGGCTGGAGGAG

ACAGATGAATCACAGCTGGAGAGACTGTATAAGCCAGTCTTTGTATTAAAACCTGCTTCTTTCAAATGTTTAGAAGGACAGACTGCCAGATTTGACTTGA

AGGTTGTGGGCAGACCCATGCCAGAGACATTCTGGTTTCACAATG GACAGCAAATTGTCAATGATTATACGCACAAAGTCGTCATTAAAGAAGATGGAA

CTCAGTCACTGATCATTGTCCCTGCGTCACCCAGCGATTCAGGAGAATGGACAGTGGTGGCCCAAAACAGAGCAGGAAAATCCACAATATCTGTGACTTT

AACTGTAGAAG CTGTGGAACACCAGATCAAGCCAGCATTTGTGGAAAAACTGAAAAATGTCAACATAAAGGAAGGTTCCAGGCTCGAAATGAAAGTCAG

AGCTACAGGCAACCCCAACCCTGACATTGTGTGGCTGAAAAACAGTGACATCATTGTTCCTCATAAATACCCAAGGATCAG GATTGAAGGAACCAGAGG

AGAAGCCGCCCTTAAGATTGATTCCATTATCAGCCAAGATTCAGCCTGGTATACAGCCACGGCTATTAACAAGGCAGGCCGAGACACCACAAGGTGCAAA

GTCAATGTTGAGGTTGAGTTTGCAGAACCTGAACCGGAAAGAAAGCTGATTATTCCACGAGGAACGTACAGAGCAAAGGAGATTGCTGCCCCAGAACTGG

AGCCTCTCCATTTGAGATACGGTCAAGAACAGTGGGAGGAGGGTGACCTCTATGACAAGGAGAAACAACAGAAACCGTTTTTCAAGAAAAAACTCACTTC

CCTCAGACTGAAGCGCTTTGGACCTGCCCACTTTGAGTGCAGACTCACACCAATTGGTGACCCAACCATGGTGGTGGAGTGGCTTCACGATGGGAAGCCC

CTGGAGGCGGCCAACAGGCTTCGGATGATTAATGAATTCGGCTACTGCAGCCTTGATTATGGAGCAGCGTATTCCAGAGACAGTGGTGTCATCACCTGCA

GAGCTACTAACAAATATGGGACAGATCACACCTCTGCTACTCTTATTGTCAAAGATGAGAAAAGCCTAGTGGAAGAATCTCAACTGCCTGATGGGAAAAA

AGGCTTACAGAGGATAGAAGAACTAGAGAGAATGGCTCACGAAGGTGCGCTGACAGGTGTGACAACAGATCAAAAAGAAAAACAAAAGCCAGACATTGTC

TTGTTCCCAGAGCCAGTGAGAGTGCTGGAAGGGGAGACAGCCAGATTCCGCTGCCGAGTGACAGGCTACCCTCAGCCCAAGGTCAACTGGTACCTCAATG

GACAGCTCATCCGGAAAAGCAAAAGGTTCAGAGTTCGCTATGATGGCATTCACTATCTGGATATTGTGGACTGCAAATCCTATGACACAGGTGAAGTCAA

GGTCACTGCGGAAAATCCTGAAGGTGTGACGGAACACAAAGTAAAACTTGAAATCCAACAGAGGGAGGATTTCAGATCTGTCCTTAGGCGTGCTCCCGAG

CCAAAGCCCGAGTTTCATGTACACGAACCGGGGAAACTTCAGTTCGAAGTGCAGAAGGTAGACAGACCCGTGGACACCAGCGAAACCAAAGAAGTGGTGA

AGCTGAAAAGGGCTGAAAGGATTACCCATGAGAAGGTGTCCGAGGAGTCTGAAGAACTGCGCAGTAAATTTAAGCGCCGGACGGAAGAGGGATACTATGA

AGCCATCACAGCCGTGGAGCTGAAGTCTCGCAAGAAGGATGAGTCTTACGAAGAGCTCCTCAAGAAAACTAAAGATGAGCTTCTGCACTGGACCAAAGAG

TTAACTGAAGAGGAGAAGAAAGCCTTGGCTGAAGAAGGCAAAATCACGATTCCAACCTTTAAACCTGAGCGAATCGAACTTAGCCCTAGTATGGAGGCAC

CCAAAATCTTTGAACGAATCCAGAGCCAGACCGTTGGCCAAGGATCTGATGCTCACTTTAGAGTCAGGGTTGTGGGAAAACCAGACCCTGAGTGTGAATG

GTATAAAAATGGTGTAAAAATTGAGCGATCTGACCGAATCTACTGGTACTGGCCAGAAGACAATGTTTGTGAACTGGTCATAAGAGATGTAACTGCAGAG

GACTCTGCCAGCATCATGGTAAAGGCCATCAACATAGCTGGGGAAACCTCAAGCCACGCATTCCTGCTCGTCCAAG CCAAGCAACTGATCACTTTTACA

CAAGAATTGCAAGATGTTGTTGCTAAGGAAAAGGACACCATGGCAACATTTGAATGTGAAACTTCAGAACCATTTATCAAAGTAAAATGGTATAAAGATG

GTATCGAAGTTCATGCAGGGGATAAGTATAGGATGCACTCTGACCGAAAAGTTCACTTCCTGTCTGTGCTGACCATCGACACATCTGATGCTGAAGACTA

CAGCTGTGTACTTGTGGAAGATGAAAATATCAAGACGACAGCGAAACTTATTGTGGAAG GTGCAGTAGTTGAATTTGTGAAAGAACTTCAGGACATAGA

AGTCCCAGAGTCATACTCAGGAGAGTTAGAGTGCATCATATCTCCAGAAAACATAGAAGGCAAATGGTATCACAATGATGTGGAGTTGAAGTCCAATGGC

AAATACTCAATTACATCCCGCCGTGGGCGCCAGAACCTCACAGTCAAGGATGTAACCAAAGAGGACCAGGGAGAGTACAGCTTTGTTGTTGATGGGAAAA

AGACAACCTGTAAACTGAAGATGAAAC CCCGACCTATTGCTATTCTCCAAGGACTTAGCGATCAAAAGGTCTGCGAGGGTGACATTGTTCAACTTGAAG

TCAAAGTCTCCTTAGAAAATGTAGAAGGTGTCTGGATGAAAGATGGTCAAGAAGTACAACACAGTGACAGAGTTCACATTGTAATAGACAAGCAGTCCCA

CATGCTACTTATTGAAGACATGACCAAAGAAGATGCTGGGAATTACTCCTTCACTATTCCTGCCCTTGGACTCTCCACCAGTGGGAATGTCTCTGTCTAT

A GTGTTGATGTGATAACACCTCTCAAAGATGTCAATGTGATTGAAGGTACCAAGGCTGTACTTGAATGCAAGGTCTCAGTTCCCGATGTAACTTCTGTT

AAATGGTACCTAAATGATGAACAAATCAAGCCTGATGATCGTGTGCAATCCATTGTCAAAGGCACCAAACAGCGACTTGTGATTAACCGAACCCATGCTT

CTGATGAAGGACCTTACAAGCTGATGGTTGGCAGGGTGGAAACCAGCTGTAACCTGTCTGTAGAGA AAATTAAAATTATCAGAGGTCTCCGTGACCTTA

CCTGCACAGAAACACAAAATGTGGTCTTTGAGGTTGAGCTATCCCACTCAGGAATTGATGTTGTATGGAATTTTAAGGGCAAGGAAATTAAGCCCAGTTC

TAAATATAAAATTGAAGCTCATGGGAAAATATACAAACTGACAGTCCTCAATATGATGAAAGATGATGAAGGGGAGTATGCATTCTATGCAGGAGAAAAT

ACAACATCTGGAAAGCTAACTGTGGCAG GAGGAGCCATCTCCACACCACTCACAGACCAGACTGTGGCTGAATCCCAGGAGGCTGTGTTTGAATGTGAA

GTTGCCAACCCTGAGTCTGAGGGGGAATGGCTGAAGGATGGAAAGCACTTGGCTCTGAGTAACAACTTCAGAGGTGAATCCGATGGCCACAAAAGGAGGC

TTGTCATCGCTGCCGCCAAGTTAGATGACGCTGGAGAATATACCTACAAGGTGGCTACCTCCAAAACATCTGCCAAGCTGAAAGTTGAAG CTGTCAAAA

TTAAGAAGACCCTGAGGAACCTCACTGTGACAGAGACACAGGATGCAGTCTTCTCTGTTGAACTCACACACCCAGATGTCAAAGGGGTCCAGTGGATCAA

AAACGGAGTTGTCTTAGATTCCAACGACAAGTATGAGATCTCAGTCAAAGGGACACTTTATTCACTGAAGATTAAAAACTGTGCCATGGCAGATGAATCT

GTCTACGGCTTCAAACTGGGGAGGCTAGGAGCTAGCGCCCGGCTGCACGTTGAGA CTGTCAAGATTATTAAGAAACCAAAGGACGTGACCGCCTTGGAA

AACGCCACTGTTACCTTCGAAGTCAGTGTTTCCCATGACACGGTGCCAGTAAAATGGTTCCATAAGAACGTGGAGATTAAGCCAAGTGACAAGCACAGAC

TGGTCTCAGAGAGAAAAGTCCACAAACTCATGCTTCAGAGCATCTCCCCCTCGGATGCCGGCGAGTACACAGCCATGGTGGGCCAGCTGGAGTGCAAAGC

CAAGCTGTTTGTGGAGA CACTCCATATCACAAAGACTATGAAAAGTATCGAGGTTCCTGAAACCAAAGCTGCCTCTTTCGAGTGTGAGGTGTCCCACTT

CAATGTCCCCTCCATGTGGCTAAAGAACGGAGTGGAAATTGAGATGAGTGAAAAATTCAAGATCGTCGTGCAGGGGAAACTGCACCAGCTGATCATCATG

AACACGAGCACGGAGGACTCAGCGGAATACACATTTGTTTGTGGCAATGACCAAGTCAGTGCTACCCTGACAGTGACCC CAATCATGATTACATCCATG

CTGAAAGACATCAATGCTGAAGAAAAAGATACCATAACTTTTGAGGTGACAGTAAACTATGAAGGCATCTCTTACAAATGGTTAAAGAACGGTGTGGAGA

TCAAGTCGACTGACAGGTGCCAGATGAGAACCAAGAAGCTCACGCACTCGCTGAACATCAGGAATGTTCACTTTGGAGATGCTGCTGATTATACTTTTGT

GGCTGGAAAAGCCACATCGACGGCCACCCTTTATGTGGAAG CTCGTCATATAGAATTTAGGAAACACATTAAGGATATTAAGGTTCTGGAGAAGAAACG

AGCCATGTTTGAATGTGAAGTTTCTGAGCCCGACATAACTGTTCAGTGGATGAAAGATGGCCAAGAGCTTCAGATAGCAGACAG GATAAAGATCCAGAA

GGAGAAATATGTCCACCGCCTTCTGATCCCATCCACACGCATGTCTGATGCCGGGAAATATACAGTGGTGGCAGGAGGCAACATGTCAACTGCTAACCTC

TTTGTCGAAGGCAGGGATGTCCGCATCCGGAGCATTAAGAAGGAGGTCCAG GTCATTGAGAAGCAGCGTGCTGTCGTGGAGTTCGAAGTCAATGAGGAT

GACGTAGACGCCCACTGGTATAAAGATGGCATTGAAATCAACTTCCAAGTTCAAGAGCGACACCAGTATGTGGTGGAGAGAAGAATTCACCGGATGTTTA

TATCAGAAACAAGACACAGTGACGCAGGCGAATACACCTTTGTGGCAGGCAGAAACAGGAGTTCTGTGACTCTTTATGTCAATG CTCCAGAACCACCCC

AAGTCCTGCAGGAACTCCAGCCTGTCACTGTACAGTCCGGCAAGCCGGCTCGCTTCTGCGCCGTGATATCAGGCAGACCGCAGCCCAAAATTTCCTGGTA

CAAGGAGGAGCAGCTGCTTTCCACTGGCTTCAAGTGCAAATTTCTGCACGACGGGCAGGAGTACACACTTCTGCTCATTGAGGCTTTCCCAGAGGATGCG

GCAGTCTACACCTGTGAAGCCAAGAATGACTACGGAGTAGCCACAACGTCGGCTTCTCTGTCCGTGGAAG TTCCAGAAGTTGTATCTCCGGATCAGGAA

ATGCCAGTCTACCCGCCTGCCATAGTCACTCCACTTCAGGACACAGTTACTTCTGAGGGGCGCCCAGCGCGTTTCCAGTGCCAAGTTTCAGGGACAG AT

TTGAAGGTGTCTTGGTACTGCAAAGACAAGAAAATCAAACCATCTCGGTTCTTCAGGATGACCCAGTTTGAAGACACCTACCAGCTGGAGATCGCTGAAG

CCTACCCCGAGGACGAGGGAACGTATGCCTTTGTTGCTAATAATGCTGTGGGCCAAGTGTCCAGCACTGCCACCCTGAGGCTGGAAG CCCCCGAGTCGA

TTCTGCATGAGAGGATCGGCCAGCAAATCGAAATGGAGATGAAAG CTGCCCCTGTGATCAAAAGGAGAATTGAGCCCCTGGAAGTAGCTCTGGGCCACC

TGGCCAAATTCACCTGTGAGATCCAAGGAGCCCCCAACGTCCGGTTCCAGTGGTTCAAAGCTGGCAGAGAGATCTATGAGAGCGACAAGTGTTCCATTCG

ATCTTCGAACTATGTCTCCAGCCTGGAGATCCTGAGAACCCAGGTCGTTGACTGCGGGGAGTACACCTGCAAAGCCTCCAATGAGTATGGCAGTGTCAGC

TGCACAGCCACACTAACTGTGACAG AGGCGTATCCACCAACCTTTCTCTCCAGGCCCAAGGCCCTTACGACTTTCGTGGGTAAGGCAGCCAAGTTTCTC

TGCACAGTGTCAGGGACTCCGGTGATTGAGATCATCTGGCAGAAAGATGGCGCTGCCCTGTCACCGTCACCTGACTGCAGGGTCACAGACGCAGACAACA

AACACAGTTTAGAACTCTCAAATCTTACTGTTCAGGACAGGGGTATTTACTCTTGTAAGGCTTCCAACAAATTTGGAGCAGATATCTGCCAGGCCGAGTT

GACCATCATTGACAAACCCCACTTCATTAAAGAGTTAGAGGCTGTACAGTCAGCCATCAATAAGAAGATCCACCTTGAATGCCAAGTCGATGAGGATAGG

AAAGTCACAATCACATGGAGCAAAGATGGGCAGAAACTTCCTGCTGGGAAAGATTACAAGATCTATTTTGAAGATAAAATAGCATCGCTTGAGATTCCCC

TGGCCAAACTAAAAGATTCTGGAACCTATACATGTACAGCGTCCAACGAGGCTGGGAGCAGTTCTTCGTCTGCTGCGGTCGCTGTCAGAG AACCGCCGT

CCTTTGTGAAGAAGGTGGATCCCTCTTATTTAATGCTCCCGGGTGAATCAGCACGCCTCCATTGCAAGCTGAAAGGCTCACCTGTGATCCAGGTCACTTG

GTTCAAAAATAACAAAGAACTCAGTGAGAGTAACACAGTCCGCATGTCTTTTGTCAATTCTGAGGCTATCCTCGACATCACTGATGTAAAGGTCGATGAC

AGTGGTACTTACTCCTGTGAAGCCACCAATGACGTGGGCAGCGACAGCTGCAGCACTGAAGTGGTGATCAAAG AGCCGCCTTCCTTCATCAAAACTCTT

GAGCCCGCAGACATAGTGCGAGGGGCCAATGCACTGCTCCAGTGTGAGATCGCAGGCACGGGACCCTTTGAAGTTAACTGGTTTAAAGACAAGAAGCAGA

TCCGAAGTAGCAAAAAGTACAGGTTGTTTACTCAGAAGACTTTTGTGTACCTGGAAATCTCATCTTTCAATAGTGCCGACGTTGGCGATTACGAATGTGT

AGTTGCTAACGAAGTCGGAAAGTGTGGCTGTGTCGCGACACACTTATTAAAAG AACCACCAACCTTTGTCAAGAAAGTAGATGATTTTACAGCCCTAGC

AGGACAGACCGTTACCTTACAAGCTGCCGTGAGAGGGTCAGAACCCATTTCTGTCATGTGGATGAAAGGCCAAGAAGTCATTAAAGAAGATGGAAAAATC

AAAATGAGCTTTTCCAATGGAGTTGCCGTCTTGACCATCCCTGATGTTCAGATTAGTTTGGGTGGCAAATATACATGCCTGGCTGAAAACGAAGCTGGGA

GCCAAACATCTGTCGGGGAATTGATAGTTAAAG AACCTGCCAAAATCATTGAGCGAGCAGAACTAATCCAGGTGACCGCAGGAGACCCAGCCACTCTGG

AGTACACAGTCTCAGGCACCCCAGAACTCAAGCCCAAGTGGTACAAAGATGGGAGACCCTTGGTTGCTAGTAAAAAGTACCGAATCAGTTTTAAAAACAA

CATTGCCCAACTGAAATTTTATTCTGCTGAACTGCACGACAGTGGCCAGTACACGTTTGAGATTTCCAACGAAGTGGGCAGCAGCTCCTGTGAGACCACA

TTTACCGTGTTAG ATCGAGACATTGCTCCGCTTTTCACCAAACCCTTACGTAACGTGGACAGTGTCGTTGGCGGTGCCTGCAGGTTAGACTGCAAAATT

GCTGGCTCCCTCCCCATGAGGGTTTCCTGGTTTAAGGATGGCAAAGAGCTCACTGCTTCCGACAGATACCAGATAGCATTTGTGGAAGGCACAGCCTCTT

TGGAGATCAGCAGAGTAGACATGAATGATGCAGGGAATTTCACCTGCCGGGCCACCAATTCCGTGGGAAGCAAAGACAGCAGCGGAGCCCTGATTGTGCA

AG AACCACCCAGTTTTGTAACTAAGCCAGGGTCCAGGGATGTCCTGCCCGGCTCGGCAGTCTGTCTGAAGAGTGCTTTCCAGGGCTCCGCCCCTCTCAC

CATCAAGTGGTTTAAGGGCGACAAAGAGTTGGTTTCCGGTGGAAGCTGCTATATTACCAAAGAAACTTCAGAGAGTTCCCTGGAGCTCTACGCAGTGAAA

ACCTCGGATTCGGGCACTTACACGTGCAAAGTCAGCAACGTAGCCGGGAGTGTGGAATGCAGTGCAGACTTGTTTGTGAAAG AGCCTGCTACCTTTATT

GAAAAGTTAGAGCCATCCCAACTGTTAAAGAAAGGAGATGGCACTCAGCTAGCCTGCAAGGTCACGGGTACCCCTCCAATTAAGATAACATGGTTTGCAA

ATGACCGAGAACTGAGAGAGAGCAGCAAACACAAAATGTCTTTTGCGGAGTCCACCGCAGTTTTAAGGCTTACGGATGTGGCCATTGAAGACAGTGGAGA

ATATATGTGCGAGGCACAAAACGAGGCCGGCAGTGACCACTGTACTGGCATTGTCATAGTCAAAG AGTCACCTTACTTTACCAAGGAATTTAAGTCCAT

TGAAGTATTAAAGGAGTATGACGTCATGCTGCTGGCTGAGGTGGCAGGCACCCCTCCCTTTGAGATCACTTGGTTCAAGGACAACACAACCCTGAGAAGT

GGTAGAAAGTATAAAACCTTCCTTCAGGATCAGCTGGTCAGCCTGCAGGTCCTCAAGTTTGTAGCTGCAGATGCAGGTGAATACCAATGCCGGGTGACCA

ACGAGGTCGGCAGCAGCACCTGCAGTGCCAGGGTGACATTAAGAG AACCCCCGTCCTTCATTAAGAAGATTGAAGCCACCAGCTCCCTCCGTGGGGGCA

CAGCCGCCTTCCAGGCCACTCTGAAAGGCTCCTTGCCAATCACTGTGACCTGGTTGAAAGACAATGATGAGATCACTGAAGATGACAATATAAGAATGAC

TTTTGAGAACAACGTGGCTAGTCTATACCTCAGTGGTATTGAAGTCAAGCATGATGGGAAATATGTCTGTCAAGCCAAAAATGATGCAGGCATACAAAGG

TGTTCTGCATTACTCTCAGTCAAAG AACCTGCAACAATAATGGAGGAGGCTGTGTCCATAGATGTCACTCAAGGAGACCCAGCCACTTTGCAAGTTAAA

TTTTCAGGGACTAAGGAGATTTCAGCTAAATGGTTTAAAGATGGCCAAGAACTTACCCTGGGTCCAAAATACAAAATCAGTGTCACTGACACAGTCTCAA

TACTAAAGATTATTTCCACAGAGAAGAAGGATAGTGGAGAATATACTTTTGAGGTCCAAAACGATGTTGGGAGAAGCAGCTGCAAGGCTAGCATTAATGT

TTTAG ATCTTATTATACCTCCTTCATTCACCAAAAAATTGAGAAAAATGGACAGCATTAAAGGATCTTTTATTGACTTAGAGTGTATAGTGGCTGGATC

CCATCCAATAAGCATCCAATGGTTCAAAGACGACCAAGAAATCTCAGCTAGTGACAAGCACAAATTCTCTTTTCATGACAATACCGCCTTCTTAGAGATC

AGTCAGCTGGAAGGCACAGACAGTGGTACATATACCTGTTCTGCCACCAACAAGGCAGGCCACAGCCAGTGCAGTGGTCACCTGACAGTCAAAG AACCC

CCTTACTTCGTGGAAAAGCCACAGTCACAAGATGTGAATCCCGGTACGAGGGTTCAATTGAAGGCTCTTGTGGGTGGCACTGCACCCATGACAATAAAGT

GGTTTAAAGATAACAAGGAGCTGCACCCTGGGGCAGCTCGCTCGGTTTGGAAGGATGACACCTCCACCATTCTTGAACTCTTCTCAGCCAAGGCTGCCGA

CTCCGGGACCTACATTTGCCAGCTAAGCAATGATGTTGGCACAACAAGCAGCAAGGCCACCATCTTTGTGAAAG AACCTCCTCAATTTATTAAGAAGCC

CAGTCCAGTGTTAGTGCTGAGGAATGGACAGTCAACAACATTTGAATGCCAAGTCACAGGCACCCCTGAAATCAGAGTTTCTTGGTATCTGGATGGGAAT

GAAATAACAGATCTTAGGAAATATGGCATTTCTTTTGTGGATGGTTTAGCCACTTTCCAGATTTCTAATGCCAGGGTTGAAAACAGTGGAACTTACGTCT

GTGAAGCTCGAAATGATGCAGGCACCGCGAGCTGCAGCATTGAACTAAAAGTAAAAG AGCCTCCCATCTTTATCCGGGAGCTGGAGCCTGTGGAAGTGG

TAAAAGACAGTGATGTGGAACTGGAGTGTGAAGTCATGGGGACAACTCCATTTGAAGTCACTTGGCTGAAGAATAACAAGGAAATCAGAAGTGGCAAAAA

ATACACAATGTCTGAGAAAATGTCAGTGTTTTACCTGCATATAACCAAGTGTGACCCTTCAGACGTTGGTGAATATCAGTGCATCATAGCCAACGAAGGA

GGCAGCTGTGCTTGTAGTGCTCGGGTTGCCTTGAAAG AACCACCATCGTTTATCAAGAAGATAGAAAATGTCACCACTGTCTTGAAGAGTTCCGCCACC

TTTCAGAGCACCGTGGCAGGCTCACCGCCCATTTCTATAACCTGGCTAAAAGATGACCAGATTCTTGAGGAAAATGACAATGTCCATATTTCTTTTGAGG

ACAGTGTGGCCACACTTCAAGTCCGGAGTGTGGACAATGGGCACAGTGGGCGATACACATGTCAAGCCAAGAATGAGTCAGGAATTGAGAGGTGTTATGC

TTTCCTCTTAGTACAAG AACCTGCTCAAATCATAGAGAAAGCTAAGTCGGTTGATGTTACTGAGAAAGACCCAGTCACCCTGGAGTGCGTAGTGGCTGG

AACACCAGAACTCAAAGTCAAATGGCTTAAAGATGGGAAACAAATTGTACCCAGTAGATATTTTTCAATGAGTTTTGAAAATAACGTGGCCAGTTTTAGG

ATTCAGTCAGTCATGAAGCAAGACAGTGGACAGTACACGTTCAAGGTGGAAAATGACTTTGGAAGCAGTAGCTGTGATGCCTACCTGAGAGTGCTAG AC

CAAGATATTCCCCCATCGTTCACCAAAAAGTTAACCAAAATGGATAAAGTTCTGGGTTCTTCTATCCACATGGAGTGCAAGGTTTCTGGGTCACTTCCTA

TCAGTGCTCAGTGGTTTAAAGATGGAAAAGAGATATCTACAAGTGCAAAATACAGACTGGTGTGTCACGAAAACACCGTGTCACTGGAAGTTAGTAATCT

GGAATTAGAAGACACTGCAAATTACACCTGCAAGGTGTCCAATGTAGCAGGGGACAACGCCTGTAGTGGCATCTTAACTGTGAAAG AACCACCAAGCTT

CCTAGTGAAACCCGAGAGGCAGCAAGCTATACCGGATTCTACCGTGGAATTTAAGGCTGTGCTGAAAGGAACACCACCGTTCAAAATTAAATGGCTTAAA

GATGATGTGGAACTTGTCTCAGGACCTAAGTGTTTCATTGGCTTGGAAGGGTCAACCAGCTTCTTAAACCTCTACTCAGTGGATTCTTCCAAGACTGGAC

AGTATACTTGCCAAGTTACCAATGACGTTG AACCACCGAAATTTGTAAAGAAATTAGAAGCTTCCAAAATTATAAAAGCAGGTGACTCTGCACGATTGG

AATGCAAGATTACTGGATCTCCAGAAATACAAGTTGTGTGGTATAGAAACGAACACGAGCTCACAGCCAGCGATAAATACCAGATGACTTTCATTGACTC

GGTGGCGGTCATACAGATGAACAGCCTTGGGACAGAAGACAGTGGAGATTTTATCTGTGAGGCTCAGAATCCTGCCGGCAGCACCAGCTGCAGTACCAAG

GTTATAGTAAAAG AACCACCTGTTTTTAGCAGCTTTCCGCCTATAGTAGAAACCCTTAAGAACACTGAAGTTAGCCTTGAATGTGAGCTTTCAGGAACA

CCGCCATTTGAGGTGGTGTGGTACAAAGACAAGCGCCAGCTCCGAAGCAGCAAGAAGTACAAGGTCGCATCTAAGAATTTCCATGCGAGCATTCACATCC

TCAACGTGGAATCTACAGACATTGGCGAATACCACTGCAAAGCACAGAATGAAGTGGGCAGTGACGCTTGCGTTTGCGCTGTAAAGTTAAAAG AACCAC

CAAAATTCATTTCCAAGCTGAACAGCCTTACGGTGGTAGCTGGCGAGCCTGCTGAGCTGCAAGCATCCATAGAAGGTGCCCAGCCCATTTCTGTCCAGTG

GCTTAAAGAGAAAGAAGAAGTGATCAGAGAGAGCGAGAACATTAGAATTTCTTTCGTCAACAACGTTGCAACTCTGCAGTTTGCTAAAGTGGAGCCAGCT

AATGCTGGGAAGTACATTTGCCAAGTCAAGAATGATGGCGGAGTGAGGGAAAACATGGCCACGTTGACCGTCTTAG AGCCTGCGGTCATTATAGAGAAG

GCAGGGTCCATGACGGTGACTGTGGGAGAAACGTGTGCCCTGGAGTGTAAGGTGGCTGGCACTCCGGAGCTCTCTGTTGAATGGTATAAGGACGGAAAGC

TCTTGACCAGCAGCCAAAAACACAAATTTAGCTTCTACAACAAAATCTCTTCCTTAAAAATCCTCTCAGTTGAAAAGGAAGATGCAGGCACCTACACATT

CCAGGTTCAGAACAACGTTGGAAAAAGCAGTTGCACAGCTGTGGTCGATGTGTCAG ACCGAATGGTCCCTCCCTCTTTCACACGAAGACTGAAGGATAC

TGGTGGTGTCCTGGGCACCTCTTGCATCTTAGAATGTAAAGTAGCTGGATCGTCTCCCATCTCTATTGCCTGGTTTCATGAGAAAACTAAGATTGTCAGT

GGAGCAAAGTACCAAACAACATTTTCAGATAATGTCTGCACATTGCAGTTGAATTCTCTGGACTCATCAGATATGGGCAGTTACACATGTGTGGCTGCTA

ACGTGGCTGGGTCGGATGAATGTCGCGCACTGTTGACTGTACAAG AGCCACCCTCTTTTGTGAAAGAACCTGAACCCCTGGAAGTCCTTCCGGGCAAAA

ACATAACCTTCACAAGTGTTATCAGAGGAACCCCTCCATTCAAGGTTGGCTGGTTTAGGGGAGCCAGAGAACTGGTGAAAGGTAACAGATGCAATATCTA

TTTTGAAGACACTGTGGCAGAACTGGAATTATTTAATATCGACATATCCCAGAGTGGGGAATACACCTGCGTGGTTTCTAACAATGCCGGCCAAGCATCC

TGCACTACACGTCTCTTTGTGAAAG AACCAGCCACGTTTGTAAAGAAGTTAAGTGATCACTCTGTAGAACCAGGGAAGTCTATAATTCTAGAGGGCACC

TATACTGGAACACTTCCAATTTCGGTCACCTGGAAAAAAGACGGTGTTAGCATAACTCCATCTGAAAGATGTAACATTGTCACCACGGAGAAAACGTGCA

TCCTGGAGATTCTGAGCAGCACCAAGGGAGATGCAGGGCATTACTCCTGTGAGATTGAAAACGAGGCAGGAAGAGATGCTTGCGACGCTCTTGTATCTAC

ATTAG AACCACCTTATTTTGTTACGGAGTTAGAACCTCTGGAGGCATCTGTTGGAGATTCAGTTTCCTTGCAATGCCAAGTTGCTGGGACACCAGAAAT

TACAGTGTCTTGGTTCAAAGGAGACACCAAATTAAGGTCAACTCCGGAATACAGGACCTACTTTACAAACAACGTGGCCACACTTGTGTTTAATAAAGTG

AGCATCAATGACAGCGGGGAGTACACGTGCATGGCGGAGAATAGCATAGGAACAGCAGCCTCTAAGACCATCTTCAGAATCCAAG AGCGCCAGCTCCCG

CCTTCCTTTGCAAGACAGTTAAAGGACATTGAGCAAACTGTTGGATTACCAGTTACCCTCACTTGTCGACTAAATGGCTCTGCACCCATCCAAGTGTGCT

GGTATAGAGATGGGGTGCTTTTAAGAGATGATGAAAATCTACAGATGTCATTTGTGGATAATGTGGCAACATTAAAAATTTTGCAAACTGACCTGAGTCA

CTCTGGCCAGTATTCTTGCTCAGCTTCCAATCCACTTGGCACAGCATCTTCTACTGCTAGACTAACAGCAAGAG AACCTAAGAAATCACCCTTCTTTGA

TATCAAGCCAGTATCAATAGATGTTATCGCTGGAGAAAGTGCAGATTTTGAGTGTCATGTGACTGGTGCTCAGCCAATGAGAGTCACTTGGTCAAAAGAT

AACAAGGAAATCCGACCTGGAGGAAACTATACTATCACGTGTGTGGGTAACACTCCCCATCTGAGGATTCTTAAAGTGGGCAAAGGAGACTCTGGCCAAT

ACACGTGTCAAGCCACCAATGACGTTGGCAAGGACATGTGCTCTGCTCAGCTCAGTGTGAAAG AACCTCCTAAGTTTATTAAGAAATTAGATGCTTCAA

AAGTTGCGAAGCAGGGAGAATCCATCCAACTGGAATGTAAGATAAGTGGCTCCCCAGAGATCAAAGTTGTGTGGTTCCGGAATGACAGCGAACTTCACGA

AAGCTGGAAATACAACATGTCCTTCGTGAATTCTGTGGCCCTGCTAACCATCAATGAAGCCAGTGCTGAGGACACTGGGGACTACATCTGTGAAGCCCAC

AATGGCGTTGGTGATGCCAGCTGCAGCACAGCCCTGAAAGTTAAAG CACCTCCTGTCTTTACCCAGAAGCCTCCTCCAGTTGGAGCCCTGAAAGGTTCT

GATGTGATCCTGCAGTGTGAAATTTCAGGAACACCCCCCTTTGAGGTGGTGTGGGTTAAAGATCGGAAGCAAGTGCGAAGCAGCAAGAAATTTAAAATCA

CCTCCAAAAATTTTGACACGAGTCTTCATATCTTTAATCTGGAAGCCCCTGACATAGGGGAATATCACTGCAAAGCCACGAATGAGGTGGGAAGTGACAC

GTGCGCTTGCACGGTCAAGTTCAAAG AACCACCACGATTTGTGAAAAAACTCAGTGATGCGTCCACCCTTATTGGGGATCCCGTGGAGTTACAAGCCGT

GGTAGAAGGTTTCCAGCCGATTTCCGTTGTCTGGCTGAAAGATAAAGGTGAAGTCATCAGAGAGAGCGAAAACGTTAGGATTTCCTTTGTTGATAACATC

GCAACTCTCCAACTGGGAAGTCCAGAAGCATCACAGTCTGGAAAATATGTGTGCCAAATCAAAAACGATGCCGGGATGCGAGAGTGTTCAGCAGTCCTGA

CTGTCCTAG AACCAGCCACAATTGTAGAGAAACCAGAACCCATGACTGTCACAACTGGAAACCCCTTCACATTGGAGTGTGTAGTAGCTGGGACTCCAG

AACTTTCAGCCAAGTGGTTCAAAGATGGTAGAGAACTATCTTCAGGCAGCAGACATCACATTACATTTGTCAGAAACCTGGCTTCCCTTAAGATCCCTTC

TGCAGAAATGAATGACAAGGGCTTATATACCTTCGAGGTGGAAAACAGAGTTGGCAAAAGCAGCTGCACTGTGTCTGTCCATGTCTCAG ACCGAGTTGT

TCCACCGTCCTTCGTCCGAAGGCTTAAGGACACAAGTGCCACGCTCGGAGCTTCTGTGGTTTTGGAGTGTCGAGTGTCGGGCTCAGCCCCCATATCAGTC

GGCTGGTTTCTTGATGGAAATGAGATCATTAGCAGTCCCAAATGCCAGTCCAGCTTTGCAGATAACGTCTGCACTCTGACTCTGAGCTCCCTGGAGCCCT

CTGACACTGGCGCATACACCTGTGTGGCTGCCAATGTAGCCGGCCAGGATGAAAGCTCTGCAGTTCTGACTGTCCAAG AACCACCATCTTTTGAACAAA

CCCCTGACTCTGTGGAAGTTTTGCCTGGAATGAGCCTGACATTCACCAGTGTCATTAGAGGCACCCCTCCCTTCAAGGTCAAGTGGTTTAAGGGCAGCAG

GGAGCTGGTGTCCGGGGAGGCTTGTACCATTTCTTTAGAAGACTTTGTCACTGAGTTGGAGCTCCTGGAGGTGGAGCCGGGGCAGAGTGGAGATTATTCT

TGCCTGGTGACCAATGATGCCGGCAGTGCTTCCTGTACCACGCATCTCTTTGTGAAAG AACCAGCCACTTTTGTGAAAAGGTTGGCTGATACCAGTGTG

GAGACAGGTAGCCCCATCGTTCTGGAGGCTACTTACTCTGGCACACCACCTATCTCTGTGAGCTGGATGAAGAACGAATATCCTCTTTCACAGTCTCCCA

ACTGTGGCATCACCACAACAGAAAAATCTAGCATCCTGGAAATTCTTGAGAGCACAATAGAGGATTATGCACAGTACGCTTGCCTGATAGAAAATGAAGC

CGGACAGGATATCTGCGAAGCTCTTGTGTCCGTCTTGG AACCACCTTACTTTATCGAACCCCTGGAACATGTGGAAGCAGCTATTGGAGAGCCCATAAC

TTTACAGTGTAAAGTGGATGGAACCCCTGAGATCAGGATTTCTTGGTATAAGGAACATACAAAGCTACGGTCAGCTCCTGCATATAAGATGCAATTCAAA

AACAACGTGGCCTCCTTAGTCATCAACAAGGTGGACCACAGTGATGTGGGAGAGTACACCTGCAAGGCAGAAAACAGCGTGGGGGCTGTTGCTTCTTCTG

CCGTGCTGGTTATCAAAG AGCGTAAACTTCCACCTTCCTTTGCGAGAAAGCTGAAAGATGTCCACGAGACTCTTGGCTTCCCAGTTGCTTTTGAATGTC

GAATCAATGGCTCAGAACCTCTTCAGGTGTCTTGGTACAAGGATGGTGAACTTTTGAAAGACGATGCTAATTTGCAGATGTCTTTTGTTCATCATGTTGC

CACTCTTCAGATTTTGCAAACTGACCAGAGCCACGTTGGTCAGTATAACTGTTCAGCTTCTAATCCGCTTGGGACTGCTTCGTCCAGTGCTAAGCTCATT

CTCTCAG AACATGAAGTGCCTCCCTTCTTTGACTTAAAGCCTGTGTCAGTAGACCTTGCTCTTGGTGAAAGTGGTTCTTTTAAATGTCATGTCACTGGA

ACAGCACCGATCAAAATCACCTGGGCTAAAGATAACCGTGAGATTCGCCCTGGAGGCAACTACAAGATGACTCTGGTGGAAAATACTGCCACTCTGACGG

TGCTCAAAGTAGCCAAAGGTGATGCTGGACAGTATACCTGCTACGCGAGCAACGTGGCTGGAAAGGACTCTTGTTCTGCTCAACTTGGTGTACAAG AAC

CCCCCAGGTTCATTAAAAAGCTAGACCAATCACGGATCGTGAAGCAGGATGAGTATACAAGATACGAGTGCAAAATAGGCGGGTCTCCAGAAATCAAGGT

TTTGTGGTATAAGGATGAGGTGGAGATTCAAGAAAGCAGTAAATTCCGGATGTCATTCGAGGACTCGGTGGCCATCCTGGAGATGCACAGTCTCAGTGTG

GAAGACAGCGGGGACTACACCTGTGAGGCTCGCAACGCAGCAGGGAGCGCCAGCAGCAGCACCTCCCTGAAGGTTAAAG AACCACCCGTGTTCCGCAAA

AAGCCTTTTCCGGTTGAGACACTTAAAGGAGCCGATGTTCACCTTGAGTGTGAGCTTCAGGGGACACCTCCCTTTCAAGTTTCTTGGCACAAAGACAAGC

GAGAACTTAGGAGTGGGAAGAAGTACAAGATTATGTCTGAGAATTTGCTCACGAGCATCCACATCCTGAACGTAGACACGGCAGACATTGGGGAATACCA

GTGCAAAGCCACAAACGATGTTGGGAGTGATACCTGTGTGGGCTCTGTCACTATGAAAG CACCACCACAATTTGTGAAGAAGCTCACCGACATTTCTAC

CATCATTGGCAAAGAAGTCCAGCTGCAGACAACAATTGAAGGCGCTGAGCCAATTTCAGTGGCGTGGTTCAAAGACAAAGGGGAAATTGTTAGAGAGAGT

GACAACATATGGATTTCTTACTCTGAAAACATCGCCACCCTCCAGTTTTCAAGAGCAGAACCAGCCAATGCTGGGAAATACACCTGCCAGATCAAAAACG

ATGCTGGGATGCAGGAGTGCTACGCCACGCTATCAGTGCTCG AGCCTGCTGCAATTGTGGAAAAGCCAGAATCTATTAAGGTGACCACAGGAGACACCT

GTACCTTGGAGTGCACGGTATCAGGAACACCTGAGCTTAGTACCAAGTGGTTTAAGGACGGAAAGGAGCTCACGAGTGACAACAAATATAAAATAAGCTT

CTTCAACAAGGTGTCTGGCCTCAAGATCATCAATGTGGTGCCTGGCGACAGTGGGGTGTACAGCTTTGAAGTGCAAAACCCTGTCGGCAAAGACAGCTGC

AAAGTCTCCATTCAAGTCTCAG ATCGAATCATCCCTCCCTCGTTCACAAGAAAACTGAAAGAGACGAACGGTCTGTCGGGCTCCTCCGTGGTGATGGAG

TGCAAAGTGTACGGATCACCCCCAATCTCTGTCCTGTGGTTCCATGACGGGAATGAGATCAGCAGTGGCCGGAAGTACCAGACCACACTGACAGACAACA

CGTGTGCCCTGACGGTGAACATGCTGGAGGAAGCTGACGCCGGCGACTATACATGTATAGCTACCAATGTGGCAGGCTCCGACGAGTGTAGTGCCCCTCT

GACTGTACGAG AGCCACCATCTTTTGTTCAGAAACCTGACCCGATGGATGTCTTAACTGGCAGTAATGTCACGTTCACAAGCATTGTCAAAGGCTCACC

TCCTTTCACTGTCAGCTGGTTCAAAGGTAGCACTGAGCTTGTGCCTGGGGCCAGGTGCAACGTGTCTCTGCAGGACTCGGTGGGTGAACTGGAGCTGTTT

GACGTGGATACGTCCCAGAGCGGAGAATACACCTGCATAGTTAGTAACGAGGCTGGCAGGGCTTCCTGCACAACACGTCTCTTCGTAAAAG CCCCAGCC

ATATTTGTGAAGCGACTCAATGACTACAGCATAGAGAAAGGCAAGCCTCTGATCCTTGAAGGGACCTTCTCTGGAACTCCTCCGATCTCTGTTACATGGA

AGAAAAATGGCATAAATGTCATAGCTTCCCAACGGTGTAATATTACCACAACTGAAAAATCAGCCATCCTAGAAATTCTGAGCAGCACTGTCGAAGATTC

AGGGCAGTACAACTGCTACATTGAAAACGCTTCTGGCAAGGACTCCTGCTCGGCCCAGATCCTGATTCTAG AACCACCGTATTTTGTCAAGCAGTTGGA

GCCTGTGAAGGTGACGGTTGGTGACTCTGCCTCTCTACAATGCCAGCTTGCTGGAACTCCCGAGATTGGGGTCTCCTGGTATAAAGGAGACACAAAGCTC

AGGCCCACTGCCACCTGCAAAATGCATTTTAAGAACAACGTTGCGACACTGGTTTTCACCCAGGTTGATAGCAGCGACAGCGGAGAATATATCTGCAGGG

CTGAGAACAGTGTAGGCGAGGTTTCTTCATCAACTTTCCTGACTGTTCAAG AGCAAAAACTTCCACCATCCTTTTCTCGACAACTAAGAGATGTGCAAG

AGACCGTGGGATTGCCAGTGGTTTTTGAATGTGCTGTAAGTGGGTCCGAGCCCATCTCTGTGTCTTGGTACAAAGATGGCAAGCCGTTGAAAGACAGCCC

AAATATACAAACATCATTTTTAGACAACATCGCCACTCTGAACATCTTTAAGACAGACAGGAGTCTCTCGGGCCAGTACTCTTGCACTGCTACAAACCCC

ATTGGCTCTGCTTCTTCAGGCGCCAAACTCATCCTCACAG AGGGGAAGAACCCACCCTTCTTTGATATCCCTCTGGCCCCTATGGATGCTGTTGTGGGA

GAAAGTGCTGACCTGGAATGCCATGTCACGGGAACACAGCCCATTAAGGTAACCTGGGCCAAGGACAACAGAGAGATACGAAGTGGTGGAAACTACCAGA

TCAGCTATCTGGAAAACAGTGCCCACCTGACCATCGTGAAAGTGGACAAAGGTGACTCTGGCCAGTACACCTGCTACGCCGTCAATGAAGTGGGAAAAGA

CTCCTGCACAGCCCAACTCAATATAAAAG AGCGCCTCATCCCACCGAGTTTCACCAAAAAACTATCTGAGACGGTAGAAGAGACAGAAGGGAACTCATT

CAAACTGGAAGGGCGTGTGGCAGGGTCCCAGCCCATCACCGTTGCTTGGTACAAAAATAATGTAGAGATCCACCCGACCTCCAACTGTGAGATCATGTTC

AAGAACAACGCACTGCTGCTGCAGGTGAAGAGGGCCAGCATGGCCGATGCAGGCTTATACACCTGCAAGGCGACAAATGACGCAGGCTCTGCCCTGTGCA

CATCGTCCATTGTCATCAAAG AGCCTAAGAAGCCGCCTGTGTTTGACCAGCACCTTGCCCCGGTCACGGCCAGCGAAGGTGACTCTGTACAGCTCAGCT

GCCACGTGCAGGGCTCCGAGCCCATTCGGATCCAGTGGTTGAAAGCTGGTAGGGAGGTAAAGCCTTCGGACAGGTGCAGCTTCAGCTTTGCTAGCGGAAC

CGCCATGCTGGAACTCAAGGAGACAGCTAAAGCAGATTCAGGAGACTACGTGTGTAAGGCTTCCAACGTGGCTGGAAGTGACACTTCAAAGTGCAAAGTG

ACCATTAAAG AGAAACCAGCCGCAGCCCCAGCAGCCAAGAAAGCAGCCGTGGATGGAAAACTCTTCTTCGTGTCAGAGCCTCAGAGCATCAGAGTAGTG

GAAA AAACCACTGCCACGTTTATTGCAAAAGTTGGAGGTGACCCGATCCCGAATGTCAAATGGACAAAAGGGAAGTGGAGACAGCTGAACCAAGGGGGT

CGCATTCTTATCCATCAAAAGGGCGACGAAGCGAAGCTGGAGATTCGTGACACCACAAAAACCGATTCTGGCTTATACCGTTGCGTTGCCTTTAACAAGC

ACGGTGAAATTGAAAGCAATGTCAACCTACAGGTGGATGAAAGAAAGAAACAAGAGAAGATTGAAGGTGATCTTCGCGCGATGCTGAAAAA GACTCCAG

CCCTCAAGAAAGGATCTGGGGAAGAAGAGGAAATTGATATCATGGAACTTCTCAAAAATGTGGATCCTAAAGAGTATGAGAAGTATGCGCGCATGTACGG

AATCACCGACTTCCGGGGCCTCCTCCAAGCGTTTGAGCTGCTGAAACAGAGCCAGGAAGAAGAGACTCACAGACTG GAAATCGAGGAACTAGAGAAGTC

AGAAAGAGATGAAAAGGAATTCGAAGAACTTGTAGCATTTATTCAGCAAAGGCTGACACAGACAGAG CCTGTCACTTTGATCAAGGATATTGAAAATCA

GACAGTTCTGAAAGATAATGACGCCATCTTTGAAATTGACATTAAGATTAATTATCCAGAAATCAAGCTTTCCTGGTACAAAGGGACTGAAAAGCTGGAG

CCCAGTAACAAATATGAAATAAGCATCGATGGTGACCGGCACACACTCAGAGTCAAAAACTGTCAGCCTAAAGATCAGGGCAATTACCGTCTGGTCTGTG

GTCCCCACATCGCTAGTGCCAAGCTAACTGTGATTG AGCCCGCCTGGGAGCGGCATCTCCAGGACGTTACTCTGAAGGAAGGCCAGACTTGTACCATGA

CGTGTCAGTTTTCTGTACCAAATGTGAAATCTGAGTGGTTCAGAAATGGCAGAGTCCTTAAACCTCAAGGCAGAGTGAAAACGGAAGTGGAACACAAAGT

CCACAAGCTGACCATTGCCGATGTCCGTGCAGAGGACCAGGGTCAGTACACCTGCAAGCACGAAGACCTCGAAACTTCAGCAGAGCTCAGAATCGAAG C

CGAACCCATTCAGTTTACAAAGCGCATACAGAACATCGTGGTGAGCGAGCATCAGTCTGCTACTTTCGAGTGCGAAGTGTCCTTTGACGACGCCATAGTT

ACCTGGTACAAAGGACCAACAGAGCTGACTGAGAGCCAGAAATACAACTTTAGAAACGACGGCCGCTGCCATTACATGACAATCCACAATGTGACCCCAG

ATGACGAAG GTGTCTATTCAGTAATTGCTCGGCTGGAGCCAAGAGGCGAAGCAAGAAGCACAGCGGAACTGTACTTAACAACCAAAG AAATAAAACTT

GAGATGAAGCCTCCTG ATATTCCCGATTCCAGAGTTCCAATCCCAACCATGCCCATCAGAGCTGTCCCACCGGAAG AAATCCCTCCTGCGGTTGCTCC

TTCCATCCCTCTTTTGCTGCCATTACCTGAAGAGAAGAAGCCGCCAGCAAAACGAATTGAAG TGACCAAAAAGGGTGTGAAAAAAGATACCAAAAAAGT

TGTCACAAAGCCCAAAGAAGAGGCCCCACCACCACCAG TCCCAGAAGTTGCCAAGAAGCCTCCACCTCCTACTCCCATGATTCCAGCAAAAG CTTCTG

AGATTATTGACGTGTCCTCTAAGGCTGAAGAGGTAAAAATAACAACCATCACCAGAAAGAAAGAGGTTCACAAAGAGAAAGAGGCTGTGTATGAACGAGA

GGAAGCAGTCTACGAAAAGAAAGTTCACATAGAGCCTTGGGAAGAGCCCTATGAGGAATTGGAAACGGAACCATACACAGAGCCATATGAAGAACCCTAT

TATGAAGAACCAGATGAAGACTATGAAGAGATCAAGGTGGAAGCTAAAAAGCAAGTCCACGAGGAATGGGAGGAGGACTTTGAAGAAGGACAGGAGTACT

ATGAGAGAGAAGAGGGCTACGATGAAGGGGAGGAAGAGTGGGAAGAGATTTACCATGAAAGAGAAATAATTCAGGTTCAGAAGGAGGTTCATGAAG AAT

TACATGAGAAGAAAATCCCAGCCAAAGTGCCTGAAAAGAAAGTACCACCTCCCAAAG TTGTAAAGAAGCCAGTAGTTGAAAAAGTTGAAAAGACTACTC

GGAGAATGGAGGAAGAAAAAGTTCAAGTCATCAAAG TACCTGAAGTTTCTAAGAAGATTGTTCCACAAAAACCTTCCCGGACTCCAGTGCAGGAAGAAA

TAATTGAAGTGAAAG TACCAGCTGTGCACACAAAGAAGATGGTTATCTCTGAAGAAAAGATGTTCTTTGCTTCTCACACAGAGGAAGAGGTGTCTGTCT

CAG TCCCCGAGGTGCAAAAGAAAACTGTCACTGAAGAGAAAATTCACGTTGCAGTTTCCAAAAAGATTGAACCACCACCCAAAG TCCCTGAACCACCT

AAAAAGCCAGTTCCAGAAGAAGTGGTCCCTGTTCCCATTCCTAAGAAGGTGGAACCCCCAGCAGCCAAAG TTCCTGAGGCTCCCAAGAAACCTGTGCCA

GAGGAGAAAAAGCCAGTTCCTATTCCCAAGAAGAAAGAGCCAGCTGCCCCTCCACAAG TCCCAGAGGCTCCAAAGAAACCTGCTCCCGAAGAAAAGATT

CCTGTTCCTGTGACAAAGAAGAAGGAAGCCCCTCCAGCTAAAG TTCCTGAAGTGCAGAAGAAGGTTGTCACAGAAGAAAAAATAGCCATCATTACTCAA

AGAGAGGAGTCCCCTCCACCAGCAG TACCAGAAATACCAAAGAAGAAAGTTCCCGAAGAAAAAAGACCTGTTCCTAGAAAAGAGGAAGTCCCCCCACCA

AAAG TGCCAGTGCCACCTAAGAAAGCTGTTCCTGAGGCGGTTGTTCCAGCTCCCATCCCTAAGAAAGCTCCTCCCCGAG CTGAAGTTTCTAAGAAAAC

TGTTGTAGAAGAGAAAAGATTTGCTGCTGAAGAAAAACTATCGGTGGCAGTTCCTCAGAGAGTGGAACTCATGCGGCACGAAG AGGAGGAATGGACTTA

CTCTGAAGAAGAGGAAAGAGTGTCTGTTTCGGTGTATAGGGAAGAGGAAAGAGATGAGGAGGAAGCAGAAATCACAGAGTATGAAG TGTTGGAAGAGCC

CGAGGAATATGTTGTGGAAGAAAAGATGCACTTTATCTCTAAGAAAGTGGAAGTTGAACCAGCCAAAG TGCCTGAGAAGAAAATTATACCAAAACCAAA

AGTTCCTGCTAAAATTGAGGAGCCTCCACCCACTAAAG TTCCCGAACCACCAAAGAAAATTGTACCAGAGAAGAAAGTTCCTGCACCAGCTCCCAAAAA

GGTGCCGCCAGCCAAAG CCCCTGAAGAATCAAAGAGACCAGTTCCCGAGAAGAGGGCTCCTGCAGAAGAGGTTGGGATAGAAGAACCTCCCCCAACCAA

AG TGGCCGAAAGGCACATGAAAATTACCCAGGAAGAAAAAGTTCTTGTGGCTGTAACTAAAAAGGAGGCGCCTCCGAGAGCGAGAG TGCCAGAGGAAC

CTAAGAAAGTTGCCCCTGAAGAAAGATTTCCCAAGCTCAAACCTCGAAGAGAGGAGGAGCCACCAGCTAAAG TGACCGAAGTTAGAAAAAGAGCTGTTA

AAGAAGAAAAGGTGTCCATTGAAGTTCCAAAGAGAGAACCCCGACCCACTAAAG AAGTGACTGTGACAGAAGAGAAGAAATGGTCTTACACCCGAGAAG

AAGAAACTGTTTCAGAACATCGGGAGGAGGAGTATGAGGATTACGAAGACTATGAGGAGTATAAAGAGTTTGAGGAGTACGAACCCACCGAAGAATATGA

CCAGTATGACGAGTATGCAGAGCGTGAGGTGGAGCACTATGAAGAGCATGAGGAATACGTCACAG AACCCAAGAAGCCTGTCCCAGTGAAACCTGCCCA

AGAACCGGTGCCTGCTAAACCCAAGGCTCCCCCACCAAAAG TGCTAAAGAAAGCTGTCCCTGAAGAAAAAGCACCCCTGCCCATTCAAAAGAAACTCAA

ACCTCTGCCACCCAAAG CTCCCGAAGAACCAAAGAAAGTTGTTGAAGAAAAAATACAGATTTCAATTACCAAACGTGAAAAGCAGCAGGTGACTGAACC

GGTCGCCAAAG TGCCTATGAAGCCCAAGAGAGTTGTCCCAGAGGCAAAAATACCTGCCCCTACAAAGGAAGTGGCAGTGCCTGTTAGAG AAAGCCTAT

CTTTTGTTATATGTGGGTCTGTGCTCTTAAAATGTCTCAACTTTATTGAGGAATTAGAAAATAGCCAACTTAAAGATGATATCTTTAAAGTGCCAGGGGT

ACCCAAAAAACGAGAACTGGAAGAGGTTGTTGTCTTCAAAGAGGAGGTGGAAGCCCATGAAGAATACATTGTAGAGGAAGAAGAGGAATATGTCCATGAA

GAGGAGTATGTCCACAAAGAAGAATATGTCCATGAAGAAGAGTACGTCCATAAAGAGGAATATATCCACGAAGAGGAAGAACACCTTCATGAAGAGGAGG

AGACCATAGCTGAGGAAGAGGTGGTGCCTGTGGCCCCAGTCAAAG TGCCTGTGGTACCCAAGAAACCTGTTCCAGAAGAGAAAAAACCTGTTCCTGTTC

CCAAAAAGAAGGAAGCACCACCAGCCAAAG TGCCTGAGATTCCCAAGAAGCCAGAGGAAAAAGTTCCTGTGCCTATTCCTAAAAAGGAGAAGGCTCCAC

CTGCCAAAG TCCCGGAAGTGCCCAAGAAGCCTGTACCAGAGGAGAAGCCACCAGTACCTGTTCCCAAAAAGGTGGAACCACCACCAGCCAAAG TGCCA

GAAGTGCCGAAGAAACCTGTGCCTGAGAAGAAGGTACCAGCGCCTACTCCTAAGAAAGTAGAGGCTCCTCCTGCAAAAG TGCCAGAGGTGCCCAAGAAA

CCCATTCCAGAAGAAAAGAAACCAACAGCTCTTCTGAAAAAAATGGAAGCCCCACCCCCGAAAG CGCCAAAGAAACGGGAGGTAGTCCCAGTTCCTGTG

GCTCTACCTCGGGAAGAAGAAGAAGAAGAAGTGCCATTTGAGGAAGTTCCTGAAGAGGAAATTCTACCTGAGGAAGAAGTTCCATCTGAGGAGGAAGCTC

CACCTGAAGAAGTTCCACCAGAGGAAGAGGAAGTTCTTCCTGAAGAAGAGGAAGTTCTTCCTGAAGAAGAGGAAGTTCTTCCTGAGGAAGAGGAAGTTCA

ACCTGAGGAAGAAGCTCTTCCAGAGATTAAACCTAAGGTGCCAAAACCTGCACCAG TGCCTGAGATCAAGAAGAAAGTGCCAGAGAAGAAAGTAGTTGT

TCCCAAGAAAGAGGAGGCTCCTCCCACCAAAG TTCCTGAGGTGTCTAAGAAGGTGGAAGAAAGACGGATCATCCCCCCTAAAGAAGAGGAAGTTCCACC

AGCTGAAG TATATGAGGAGGCTGAAGAACCCACTCCAGAAGAGATTCCAGAAGAGCCGCCTAGCATAGAAGAAGAAGAGATAGTGGAGGAAGAGGAGGA

GGAGGAGGAGGTGCTGCCACCTAGAG CACCTGAAGTGGTGAAGAAAGCAGTACCCGAAGCTCCCACTCCTGTCCCTAAGAAAGCGGAGGCACCCCCCGC

AAAAG TGCCAAAGAAAATCCCTGAGGAAAAGGTTCCCGTGCCGGTCCAGAAAAAAGAGGCCCCACCAGCCAAAG TGCCTGAAGTGCCAAAGAAAGTCC

CAGAAAAGAAGAAAATCCCTGAAAAGAAAGTCCCTGTGCCCAAAAAGGAAGCTGTTCCACCGGCTAAAG GGAAAGCTGTTTTTGAAGAAAAAATATCAG

TTGCCTACCAGCAAGAAGAACTAGTCCAAGAAAGAATAGAGCTAGAACTCGTGGAAGCCAAAGTGGAAGAGGCTTTCGAAGAAGAGGAGTTCCACGAGGT

GCAGGAATACTTTGAGGAAGAGGAGTTCCACGAGGTGGAGGAGTTCATCAGGGTGGAAGAGCGCAGGTTCCAAGAAGAGCACAAAGTGGAAGAAGTCCAC

AGGGTCATTGAGTTCCTAGAGGCTGAAGAAGTGGAAGTATACGAAAAGCCCAAAATTCCACCTAAAAAAG GACCTGAGGTATCTGAGAAAGTCATCCCT

CCAAAAAAGCCACCCACTAAAGTCATTCCTCGAAAAGAGCCACCAGCTAAAG TACCTGAGGTGACCAAGAAAACGGTGGTTGAAGAAAAAATCCGTGCT

CCTGAAGAACCGAAGGTGCCGGCACCTAAAG AAGTTGTTCCTGAAAAGAAAGTCTCCGTGGTGCCTCCCAAAAAGCCAGAAGCCCCACCTGCCAAAG T

GCCAGAGGCACCCAAGGAAGCTGCCCCTGAGAAGAAAGTGCCAGTGGCACCTAAGAAAAAGCCAGAAGCCCCACCCGTGAAAG TACCCGAGGTGCCAAA

GACAGCTGTTCCCCAAAAGAAGATCCCTGAGGCCATTCCCCCCAAACCGGAAAGTCCTCCCCTTGAAG TGCCAGAGGCTCCCAAAGAAGTTGTTCCTGA

AAAGAAAGTCTCCGTGGTGCCTCCCAAAAAGCCAGAAGCCCCACCTGCCAAAG TGCCAGAGGCACCCAAGGAAGCTGCCCCTGAGAAGAAAGTGCCAGT

GGCACCTAAGAAAAAGCCAGAAGCCCCACCCGTGAAAG TACCCGAGGTGCCAAAGGCAGCTGTTCCCCAAAAGAAGATCCCTGAGGCCATTCCTCCCAA

ACCAGAGAGTCCTCCCCCTGAAG TGTATGAGGAACCTGAAGAGGAGATTGTCCCAGAAGAGCCTCCAGAGGAGGCTGTGGAAGAACCAGTGCCAGCTCC

CCCTCCAAAAG TGACAGAGCCACCTAAGAAGCCTGTCCCTGAGAAGAAAGCGCCTCCTGCTGTTGTCAAGAAACCTGAACCCCCACCAGCGAAAG TGC

CTGAAGTGCCTAAGGAAGCTCCCCCTGAAAAGAAAGTGCCTCCCAAAAAGCCAGAAGCCCCACCTGCTAAAG TGCCAGAAGTTCCGAAAGAAGTTGTCA

CAGAAAAGAAAGTGGCTGTTCCCAAAAAGCCAGAAGTCCCGCCAGCCAAAG TGCCAGAGGTGCCAAAGAAACCTGTCATTGAAGAGAAGCCAGCCATTC

CTGTTGTTGAGAAAGTGGCGTCCCCTCCTGCTGAAG TATATGAAGAACCGGAAGAAGTCACTGCTGAGGAAGAGGAGCCAGCCCCTGCTGTAGAAGAGG

AGGAATACGAAGCTCCCCCTCCCCCTGCACCAG TGCCTGAAGAGCCTAAGAAGGTTGTCCCAGAGAAGAAATTTCCTGTCATCAAAAAACCAGAGGCTC

CCCCTCCTAAAG AACCTGAGCCAGAGAAGAAGGTTATCGAGAAACCAAAACTCAAACCAAGACCCCCTGCACGTCCTCCTTCTCCACCTAAGGAAGATG

TGAAGGAGAAAATGTTCCAACTTAAAG - UNI36362 - CTGTTTCAAAGAAGAAAGTTCCTGAAAAACCCGAGGTTGTGGAAAAAGTGGAGCCTGCA

CCACTAAAAG - UNI36362 - TGCCTACAGCTGAAAAGAAAGTTCGTAAATTACTTCCTGAACCTAAGCCGCAGCCAAAGGAAGAGGTGGTGCTGAA

AAGCG - UNI36362 - TTCTAAGAAAGAAACCCGAGGAAGAAGAACCTAAAGTAGAACCTAAAAAAGTAGAAAAAGCTAAAAAACCGGAAG AGCCA

CAGCCACCTCCAAAAGCCGTTGAAGTTGAAGCTCCTCCAGAGCCTACACCAAAGGAAAGGAAAGTTCCAGAACCGGCCAAAG - UNI17655 - TTCC

TGAAATTAAGCCAGCGATACCTCTCCCTGGACCTGAACCAAAGCCAAAGCCTGAGCCAG - UNI17655 - AGGTGAAAACCATGAAAGCTCCACCCA

TCGAGCCGGCACCCACTCCCATCGCTGCCCCCGTGACAGCGCCTGTGGTTGGGAAGAAAGCAG AAGCCAAACCTAAGGATGAGGCTGCCAAGCCAAAAG

GTCCCATCAAAG GTGTAGCCAAAAAGACTCCTTCACCAATAGAAGCTGAAAGGAAAAAGCTCAGACCAGGAAGCGGTGGAGAGAAACCTCCAGACGAAG

CTCCGTTCACTTACCAACTCAAGGCCGTGCCACTGAAATTCGTGAAAGAAATCAAAGACATCGTTTTGACAGAGGCAGAGTCTGTGGGCTCTTCTGCCAT

CTTCGAATGTTTGGTCTCCCCATCCACTGCCATTACAACCTGGATGAAGGACGGCAGCAACATCCGTGAGAGCCCAAAGCACAGATTCATTGCAGACGGC

AAAGACAGGAAGCTGCACATTATCGACGTTCAGCTGTCTGATGCTGGTGAATACACCTGTGTGCTACGCTTGGGAAATAAAGAGAAGACGTCCACTGCTA

AGCTCATCGTAGAAG AACTTCCTGTGCGCTTTGTGAAAACACTGGAGGAGGAAGTCACGGTGGTCAAGGGGCAGCCGTTGTACTTGAGCTGTGAGTTGA

ACAAAGAACGCGATGTGGTCTGGAGGAAGGATGGTAAGATTGTGGTGGAGAAACCTGGCAGGATCGTGCCTGGTGTCATTGGCCTGATGCGGGCCCTGAC

CATCAATGATGCTGATGACACTGATGCCGGAACATACACTGTGACTGTGGAAAATGCCAACAACCTGGAATGTTCTTCTTGTGTAAAAGTAGTAG AAAT

CATTAGAGAATGGCTTGTGAAACCTATCCGAGATCAGCATGTGAAGCCCAAGGGAACAGCTGTTTTCACCTGTGACATAGCCAAGGACACGCCAAACATT

AAGTGGTTCAAAGGCTATGACGAGATCCCCTTGGAACCAAACGACAAGACTGAGATACTGAAAGAGGGAAACCACCTCTTTCTCAAGGTTAAGAATGCTA

TGCCAGAAGATATTGATGAGTATGCAGTGGAAATTGAAGGGAAAAGATACCCAGCAAAGCTGACACTTGGAG AGCGCGAAGTTGAGCTACTTAAGCCGA

TAGAAGATGTCACCATTTATGAGAAGGAAAGTGCCAGCTTTGATGCAGAAATCTCAGAGGAAGACATTCCTGGGGAGTGGAAGCTGAAGGGCGAGCTTCT

GCGGCCCTCGCCT ACTTGTGAAATCAAAGCTGAAGGTGGGAAGCGCTTCTTAACTTTGCACAAAGTGAAACTGGACCAAGCTGGCGAAGTCCTCTACCA

GGCTTGCAATGCGATCACAACTGCCATTCTGACAGTCAAAG AAATCGAGCTTGACTTTGCTGTACCCCTGAAGGATGTGACTGTCCCAGAGAAGAGACA

GGCTCGGTTTGAATGTGTCCTCACCAGAGAGGCAAATGTCATATGGTCTAAAGGGCCTGATATAATCAAGGCATCTGACAAATTTGATATTATTGCTGAT

GGAAAGAAACACATTCTTGTTATCAACGACTCTCAGTTTGACGATGAAGGAGTCTATACTGCAGAGGTGGAGGGCAAGAAGACGTCAGCACAATTATTTG

TGACAG GCATAAGACTTAAGTTCATATCACCACTGGAAGATCAAACAGTAAAAGAAGGCCAAACAGCAACTTTTGTCTGTGAGCTCTCTCATGAAAAAA

TGCACGTGGTCTGGTTCAAAAACGATGTCAAGCTACACACAACCAGGACAGTGCTCATGTCTTCTGAGGGAAAGACTTATAAGCTGGAGATAAGGGAGAC

CACACTGGATGATATCTCACAGATCAAAGCTCAAGTGAAGAACCTCAGCTCTACAGCCAACCTGAAGGTCTTGG AGGCCGATCCCTACTTCACCGTGAA

ATTACACGACAAGACTGGCGTGGAGAAGGACGAGATCATTCTTAAGTGTGAAGTGAGCAAAGATGTTCCGGTCAAATGGTTCAAAGACGGGGAAGAGATT

GTGCCTTCGCCCAAACATTCTGTCAAGACCGACGGCCTGCGCCGCATCTTAAAGATCAAGAAGGCAGAGCTCAAAGACAAAGGGGAATATGTGTGCGACT

GCGGTACAGACACCACCAAGGCCAACGTCACTGTTGAGG CTCGACTCATAAAAGTGGAGAAACCCCTGTACGGCGTGGAAGTGTTTGTGGGTGAAACCG

CCCGCTTTGAAATTGAACTGTCTGAACCTGACGTGCATGGCCAGTGGAAGTTAAAGGGAGAGCCTTTGACTGCTTCTCCT GACTGCGAAATCATCGAAG

ATGGGAAGAAACATGTCTTGGTTCTGTATAACTGTCAGCTGGATATGACCGGGGAGATATCCTTCCAGGCCGCCAACGCTAAATCAGCAGCCAACCTGAA

AGTGAAAG AACTGCCGCTCATTTTCATCACCCCTCTGAGTGACGTCAAAGTCTTTGAGAAAGATGAGGCGAAGTTTGAGTGTGAAGTATCCAGGGAGCC

CAAAACATTCCGCTGGCTGAAAGGAACCCAGGAAATCACTGGTGATGACAGATTTGAGCTCATCAAGGATGGCACCAGGCATTCATTGGTGATCAAGTCA

GCAGCTTTTGAAGATGAGGCCAAATACATGTTTGAAGCTGAAGATAAACGCACAAGCGGCAAACTGATCATTGAAG - UNI35827 - GAATCCGTCT

CAAATTCCTGACCCCACTCAAGGATGTGACAGCCAAAGAAAGGGAAAATGCCGTGTTTACTGTGGAGCTGTCCCATGACAACATCCCAGTGAGCTGGTTC

AAGAACGACCAGCGCCTGCACACCAGCAAGCGGGTCTCCATGCATGATGAAGGGAAAACACACTCCATCACGTTCAAAGACCTGTCTATTGACGACACCT

CCCAAATTAGAGTGGAGGCCATGGGGATAAGTTCAGAGGCTAAGCTCACTGTGCTGG - UNI35827 - - UNI35899 - AGGGAGACCCATACTT

CACAGGAAAGCTTCAAGATTACACAGGCGTGGAGAAGGATGAAGTGATTCTTCAGTGTGAAATCAGCAAAGCAGACGCACCCGTGAAATGGTTTAAGGAC

GGGAAGGAAATTAAGCCGTCTAAAAACGTTGTTATCAAGGCTGACGGCAAGAAACGCATGCTGATCCTGAAGAAGGCCTTGAAATCAGATATCGGCCAAT

ATACCTGTGACTGTGGGACAGACCAGACCTCTGGGAAGCTGGACATTGAAG - UNI32138 - - UNI35827 - - UNI35899 - ATCGGGAAA

TTAAACTGGTGCGACCCCTGTACAGCGTGGAGGTGATGGAGACCGAGACGGCCCGCTTTGAAACTGAGATCTCTGAAGATGATATACATGCCAACTGGAA

ACTGAAGGGAGAGGCACTGCTCCAAACACCT - UNI32138 - - UNI33036 - - UNI35899 - GAATGTGAAATTAAAGAAGAAGGCAAGAT

CCACGTCCTTATCTTACACAACTGCCGCCTAGACCAGACTGGAGGTGTAGATTTCCAAGCTGCCAATGTCAAATCTAGTGCCCACCTCCGAGTTAAAC -

 UNI32138 - - UNI32541 - - UNI33036 - CACGGGTAATTGGTCTGCTGAGGCCTCTAAAGGATGTTACAGTGACCGCAGGGGAAACGGCC

ACCTTTGACTGCGAGCTCTCCTATGAGGATATCCCAGTGGAATGGTACCTCAAAGGGAAGAAGCTGGAGCCTAACGATAAG - UNI14991 - - UNI

16643 - - UNI32541 - - UNI33036 - GTGGTGACACGTTCAGAAGGAAGAGTTCACACGCTCACCCTGAGGGATGTGAAGCTAGAAGATGCT

GGCGAAGTCCAACTAACTGCAAAGGATTTCAAAACTCAGGCCAATCTCTTTGTGAAAG - UNI14991 - - UNI16643 - - UNI32541 - AA

CCCCCGGTTGAGTTCACTAAGCCTCTTGAGGACCAGACGGTCGAAGAGGAGGCCACTGCAGTACTGGAGTGTGAAGTATCCAGAGAAAATGCCAAAGTGA

AATGGTTCAAAAATGGGACAGAAATCCTCAAAAGCAAGAAGTATGAAATCGTTGCTGATGGCAGGGTCAGGAAGCTCATTATTCATGGTTGTACCCCAGA

GGATATCAAAACGTACACTTGTGATGCTAAAGATTTTAAGACCTCCTGTAACCTGAATGTTGTTC - UNI14991 - CTCCTCATGTGGAATTCTTAA

GACCACTCACAGACCTCCAAGTCAAAGAAAAAGAAACTGCTCGGTTCGAGTGCGAAATTTCCAAAGAAAATGAGAAG GTTCAGTGGTTTAAAGATGGTG

CTGAAATTAAAAAGGGCAAAAAGTATGACATCATTTCTAAGGGAGCAGTACGAATTCTTGTCATCAACAAATGTCTACTGAATGATGAAGCAGAATATTC

CTGTGAAGTGAGGACAGCAAGAACTTCCGGCATGCTGACAGTCCTAG AAGAAGAAGCTGTCTTCACAAAAAATCTTGCCAACCTTGAAGTTAGTGAAGG

AGACACTATCAAACTGGTGTGTGAAGTCTCCAAGCCTGGGGCAGAAGTGATTTGGTACAAAGGGGATGAGGAGATCATCGAAACAGGGAGATTTGAAATA

CTTACTGATGGAAGGAAGAGAATCTTGATCATTCAGAATGCGCAGCTTGAGGATGCAGGCAGCTACAACTGTCGACTCCCAAGTTCTCGAACGGACAGCA

AAGTCAAAGTACACG AACTTGCTGCTGAGTTCATCTCGAAGCCTCAAAACCTTGAAATTCTTGAAGGAGAAAAGGCTGAGTTTGTCTGCACTATCTCAA

AGGAAAGCTTCGAAGTTCAGTGGAAGAGGGATGATCAGACACTTGAATCTGGAGATAAATATGACATCATTGCTGATGGCAAAAAGAGAGTCCTAGTTGT

AAAGGATGCCACATTACAAGACATGGGCACTTACGTAGTCATGGTTGGGGCTGCCAGAGCCGCAGCTCACCTGACAGTCATTG AAAAACTCAGGATCAT

AGTTCCTCTTAAGGACACCAAGGTGAAGGAACAACAAGAGGTTGTCTTCAACTGCGAAGTCAATACTGAAGGTGCCAAAGCCAAATGGTTCAGAAATGAA

GAAGCCATATTTGATAGTTCAAAATACATCATTCTCCAAAAAGACCTGGTCTACACCCTCAGAATCAGAGATGCACGGTTAGATGACCAAGCCAACTTTA

ATGTGTCTTTGACCAATCACAGAGGTGAAAATGTTAAAAGTGCAGCCAATCTAATAGTGGAAG AGGAAGATCTTAGGATTGTTGAACCTCTTAAAGATA

TTGAAACAATGGAGAAGAAGTCAGTCACATTCTGGTGCAAGGTGAATCGTCTCAATGTGACACTGAAGTGGACCAAAAATGGAGAAGAAGTGGCTTTTGA

CAACCGTATATCATACCGAATTGATAAGTACAAACACTCTCTAATCATCAAGGACTGTGGCTTCCCAGATGAAGGTGAATACGTCGTCACTGCTGGGCAA

GATAAATCCGTGGCAGAGCTGCTCATCATAGAAGCCCCAACAGAATTCGTGGAGCACCTGGAAGACCAGACGGTCACAGAGTTTGATGACGCTGTCTTCT

CCTGCCAGCTCTCCAGAGAGAAAGCGAATGTAAAATGGTACAGAAATGGAAGAGAAATCAAGGAAGGCAAAAA ATACAAGTTTGAGAAGGATGGGAGCA

TCCACAGGCTCATCATAAAAGACTGCAGGCTGGAGGATGAGTGTGAATACGCTTGTGGTGTAGAGGACCGCAAGTCCCGAGCTAGACTTTTTGTAGAAG 

AAATTCCAGTTGAGATTATCAGGCCTCCTCAAGACATTCTTGAAGCCCCTGGTGCAGACGTTATCTTCTTGGCTGAGCTCAACAAAGATAAAGTGGAGGT

CCAATGGCTTAGAAATAACATGATCGTCGTCCAGGGTGACAAGCACCAGATGATGAGTGAAGGAAAGATACACAGGCTACAGATTTGTGATATTAAGCCA

CGTGACCAGGGCGAATACAGATTCATTGCCAAAGATAAAGAAGCCAGGGCTAAACTTGAATTAGCAG CTGCACCTAAAATCAAGACAGCTGATCAAGAT

CTCGTCGTTGATGCTGGCCAGCCTCTGACAATGGTGGTACCCTATGATGCCTACCCCAAAGCAGAAGCTGAATGGTTTAAAGAGAACGAACCTCTATCTA

CAAAAACCGTTGACACTACGGCTGAGCAGACTTCTTTCAGAATCTCAGAAGCCAAGAAGGACGACAAGGGGAGGTATAAAATCGTGCTTCAGAACAAGCA

TGGGAAAGCAGAGGGCTTCATCAATTTACAAGTTATTG ATGTTCCCGGGCCAGTTCGTAACTTAGAAGTGACAGAAACATTTGATGGTGAAGTAAGCCT

CGCCTGGGAGGAACCACTAACGGATGGTGGGAGCAAAATCATAGGCTATGTTGTTGAAAGGCGTGATATCAAGAGAAAGACCTGGGTTCTGGTCACTGAC

CGAGCGGACAGCTGTGAGTTCACTGTCACTGGACTACAGAAAGGAGGAGTGGAGTACCTGTTCCGTGTGAGTGCAAGGAACAGAGTTGGCACTGGAGAAC

CCGTAGAAACTGACAGTCCTGTAGAAGCAAGGAGTAAATATG ATGTTCCAGGCCCTCCTTTGAATGTAACCATCACCGATGTGAATAGATTTGGTGTCT

CACTAACATGGGAGCCACCAGAGTACGATGGAGGTGCTGAAATCACAAACTATGTGATTGAGCTGAGAGACAAGACTTCTATCAGATGGGACACTGCCAT

GACCGTAAGAGCTGAAGACCTGTCAGCAACTGTCACTGATGTGGTTGAAGGACAGGAGTATAGTTTCCGTGTCAGAGCCCAGAACCGAATCGGAGTTGGG

AAACCAAGTGCAGCCACACCCTTTGTCAAAGTTGCTGATCCAATAG AGAGACCAAGTCCTCCTGTGAACCTAAACGCCTCAGAACAGACACAGTCATCA

GTTCAGCTCACCTGGGAGCCTCCTCTGAAAGATGGAGGCAGCCCCATACTGGGCTACATAATTGAAAGACGTGAAGAGGGAAAAGACAATTGGATTCGCT

GCAATATGAAACCTGTCCCTGAACTGACTTACAAG GTCACTGGATTGCAAAAAGGGAACAAATATTTATATAGAGTGTCTGCAGAAAATGCAGCTGGTG

TTTCAGATCCATCTGAGATCCTCGGTCCTCTCACTGCTGATGATGCGTTTG TTGAACCAACGATGGATTTAAGTGCATTCAAAGATGGTTTGGAAGTCA

TAGTTCCCAATCCCATCAAGATCCTGGTCCCAAGCACAGGCTATCCAAGACCAAAAGCAACCTGGACTTTTGGAGATCAAGTACTTGAAGAGGGGGATCG

TGTGAAAATGAAGACCATATCAGCCTATGCCGAGCTTGTCATTTCTCCAAGCGAACGAACAGACAAAGGCATTTACACACTCACGTTAGAAAATCCTGTG

AAGTCAATTTCTGGAGAAATCAATGTCAATGTAATTG CTCCTCCAAGTGCGCCCAAAGAACTGAAATTTAGTGATATAACAAAGGATTCTGTACATTTG

ACTTGGGAACCACCAGATGATGATGGAGGGAGTCCACTAACTGGATATGTTGTTGAAAAGAGAGACATGAGCCGGAAAACATGGACTAAA GTTATGGAC

TTTGTTACTGATCTAGAATTCACAGTTCCTGATCTTGTTCAAGGAAAGGAGTATCTATTCAAAGTCTGTGCCCGAAATAAGTGTGGCCCTGGAGAACCTG

CATATACTGATGAACCTGTAAATATGTCTGCCCCTGCAA CGGTACCTGACCCACCAGAGAATGTTAAATGGAGAGACAGGACAGCCAACAGCATCTTCC

TAACATGGGATCCTCCTAAAAATGATGGTGGCTCTCGTATCAAAGGATATATAGTTGAAAAATGTCCACGTGGTTCTGATAAATGGGTTGCCTGTGGAGA

ACCTGTTCCAGATACAAA AATGGAAGTGACAGGTCTTGAGGAAGGCAAATGGTATGCCTACCGTGTGAAGGCCTTGAACAGGCAAGGTGCTAGCAAGCC

AAGCAAACCCACTGAAGAGATCCAGGCGGTGGACACACAGG AGGCCCCTGAGATCTTCCTGGATGTGAAGCTCCTGGCTGGGATCACTGTGAAAGCTGG

AACGAAGATCGAACTTCCCGCCACGGTGACTGGAAAACCGGAACCGAAAATAACTTGGACCAAGGCTGACACCCTTCTGAAGCCAGACCAGAGAATCACC

ATTGAAAACGTTCCTAAAAAATCCACAGTGACAATCACAGACAGTAAGAGAAGTGACACAGGCACATATATCATAGAAGCCGTGAACGTCTGTGGCCGGG

CCACTGCTGTGGTAGAAGTGAATGTCTTAG ATAAACCTGGACCACCAGCTGCCTTTGACATCACAGATGTAACCAATGAGTCGTGTCTTCTGACCTGGA

ACCCACCAAGAGACGATGGCGGGTCTAAGATCACAAACTATGTGGTGGAGAGAAAAGCAACAGACAGTGATGTGTGGCATAAGCTCTCATCAACCGTTAA

GGACACAAACTTCAAGGCAACCAAATTAACACCCAACAAAGAGTACATCTTCAGAGTTGCTGCAGAAAATATGTATGGTGTTGGTGAGCCGGTTCAAGCT

GCTCCAATAATAGCCAAATACCAGTTTG ATCCACCCGGACCTCCAACTCGCCTAGAACCTTCCGACATCACTAAAGATGCGGTGACGCTCACATGGTGT

GAGCCAGATGATGATGGTGGCAGTCCCATCACTGGATACTGGGTTGAAAGATTAGATCCTGACACTGATAAATGGGTTCGATGCAATAAGATGCCAGTGA

AGGACACAACATACAG GGTAAAAGGTCTCACCAATAAGAAAAAGTACAGATTCCGCGTGCTTGCTGAAAATTTGGCAGGGCCAGGAAAACCAAGTAGAT

CAACTGAACCAATCTTAATAAAGGATCCCATAG ATCCTCCATGGCCCCCTGGAAAACCAACTGTAAAGGATATAGGCAAAACCTCCTTAGTATTGAACT

GGACCAAGCCAGAACACGATGGAGGGGCAAAGATTGAGTCTTACGTCATTGAGATGCTAAAGACCGGAACAGACGAGTGGGTCAGGGTGGCTGAGGGAGT

TCCGACCACTGAGCATTTGCTCACAGGGCTAATGGAAGGCCAGGAATACTCATTCCGAGTGAGAGCCGTGAACAAGGCTGGAGAGAGTGAGCCCAGTGAA

CCCAGCGACCCTGTGCTTTGCCGGGAGAAACTAT ATCCTCCATCACCACCTCGCTGGCTCGAAGTGATTAATATCACAAAAAATACAGCTGACCTAAAA

TGGACAGTTCCAGAGAAAGATGGAGGGTCACCCATCACCAACTACATTGTGGAAAAGAGAGATGTGAGACGGAAAGGCTGGCAAACAGTGGACACCACTG

TCAAGGACACCAAGTGCACGGTCACCCCACTGACAGAGGGGTCTCTGTATGTGTTCCGAGTTGCTGCAGAAAATGCCATAGGACAAAGTGACTACACAGA

AATCGGAGATTCTGTCCTGGCCAAAGACACCTTCA CCACCCCTGGACCACCCTATGCCCTGACAGTGGTTGATGTGACAAAACGACATGTTGACCTAAA

GTGGGAGCCACCTAAAAATGATGGCGGAAGACCAATACAGAG ATACATCATTGAGAAGAAAGAAAAATTAGGTACCCGTTGGGTGAAAGCCGGGAAGAC

CTCAGGCCCTGACTGTAACTTCAGAGTAACTGATGTCATTGAAGGAACAGAAGTCCAGTTTCAAGTTCGGGCAGAAAATGAAGCAGGAGTTGGTCACCCA

AGTGAGCCCACAGAAATTCTGTCAATCGAAGACCCAACAA GTCCTCCTTCACCTCCGCTTGATCTACATGTGACTGATGCTGGGAGAAAACACATTGCC

ATTGCTTGGAAACCACCAGAGAAAAATGGCGGAAGTCCTATCATAGGCTACCATGTTGAAATGTGTCCAGTAGGCACAGAGAAATGGATGCGAGTTAATT

CTCGCCCAATAAAAGATCTGAAGTTCAAGGTTGAAGAGGGTATTGTTCCGGACAAAGAATATGTTCTGAGAGTGAGAGCTGTCAATGCTGTCGGTGTCAG

TGAGCCATCTGAAATCTCCGAAAACGTGGTCGCCAAAGACCCAGACT GCAAACCAACTATTGATCTAGAGACTCACGACATTGTTGTTATCGAAGGAGA

AAAGTTAAACATCCCTGTGCCCTTCAGGGCTGTCCCAGTGCCAACCGTGAGCTGGCATAAAGATGGCAAAGAAGTTAAAGCAAGTGACAGATTGACAATG

AAGAACGACCACATCTCTGCACACCTCGAGGTTCCCAAGAGTGTCCATGCAGATGCTGGAGTGTACACCATCACCCTGGAGAATAAGCTCGGCTCAGCAA

CGGCTTCAATCAATGTCAAAGTCATAG GTCTACCTGGTCCATGCAAAGATATTAAAGCAAGTGACATAACCAAAAGTTCTTGTAAGTTAACATGGGAAC

CTCCAGAGTTTGATGGTGGAAGCCCGATTCTTCATTATGTCCTGGAACGGAGAGAAGCAGGGAGGAGGACATATATCCCAGTCATGTCTGGTGAGAACAA

ACTGTCTTGGACCGTAAAAGATCTCATACCAAATGGTGAATACTTCTTCCGAGTAAAAGCAGTCAACAAGATTGGCGGAGGAGAATACATTGAACTCAAG

AATCCTGTCATTGCTCAAGATCCAAAGC AACCACCTGATCCACCTGTAGATGTTGAGGTTCATAATCCTACAGCTAAGGCAATGACTATCACGTGGAAG

CCACCCTTGTATGATGGAGGAAGCAAGATAATGGGTTACATCATAGAAAAGATCACTAAGGGTGAGGATAGATGGAAGAGATGCAATGAACATCTGGTCC

CTGTCCTGACCTACACAGCGAAAGGACTCGAGGAGGGGAAAGAGTACCAATTCCGTGTGCGAGCGGAGAACGCTGCTGGTATTGGTGAACCTTCCCGGGC

CACTCCCCCAACCAAAGCTGTCGACCCTATTG ATGCCCCAAAAGTCATCCTCAGAACAAGCCTGGAAGTAAAGCGGGGTGATGAAATAGCACTTGATGC

AACCATCTCTGGCTCACCATACCCAACAATCACATGGATAAAAGATGAAAATGTCATTGTTCCAGAGGAAATTAAGAAGCGAGCGGCACCCCCAGTTAGG

AGGAAGAAGGGCGAGGCTGAAGAGGAGGAGCCCTTTTCCCTCCCTCTGACAGAACGTCTGAGCATCAACAATAGCAAACAGGGAGAATCTCAGCTGCGCA

TCCGTGACTCTCTGCGGCCTGACCATGGCCAGTACATGATCAAAGTTGAGAATGATCACGGTGTTGCAAAAGCTCCTTGCTCCGTCAGTGTGTTAG ATA

CACCAGGACCACCAATCAACTTTGTATTTGAGGATATTAGAAAGGACTCTGTCCTGTGTAAGTGGGAACCACCGCTTGACGATGGTGGCAGTGAAATCAT

TAACTATACCTTGGAAAAGAAAGACAAGACCAAGCCCGACTCAGACTGGATTGTTATCACATCAACACTCAGAAACTGCAAATATTCAGTAACAAAACTG

ATTGAAGGAAAAGAGTACCTCTTCCGTGTAAGAGCTGAAAATAGGTTTGGACCTGGGCCACCATGTGTTTCAAAGCCACTTTTAGCCAAAGATCCATTTG

 AACCACCTGATGCACCAGATAAACCCATTGTGGAAGATGTCACCAGCAACAGTATGCTAGTAAAATGGAATGAACCGAAAGATAATGGAAGCCCCATCT

TGGGTTACTGGCTTGAAAAACGTGAGGTCAATAGTACACACTGGTCTCGTGTCAACAAAACCCTTCTCAGTTCTTTGAAAACCAAGGTAGATGGCTTGCT

GGAAGGACTCACCTATGTCTTCCGAGTTTGTGCTGAAAACGCTGCTGGACCTGGAAAGTTCAGCCCACCTTCGGATCCTAAAACAGCTCGCGATCCAATC

T CTCCACCTGGGCCGCCTGTCCCGAGAGTTGCTGATACAAGCTCTACAACCATTGAGCTGGAGTGGGAACCCCCAGCTTTCAATGGTGGTGGGGAAATT

ATGGGCTACTTTGTTGATAAGCAGCTGGTTGGCACAAATGAGTGGTCACGCTGCACAGAGAAGATGATCAAAGTCCGTCAGTTCACTGTCAAAGAAATCC

GAGAGGGTGCCGACTACAAACTTCGAGTGAGTGCTGTCAATGCAGCAGGCGAAGGACCACCTGGAGAAACAGAACCTGTTACTGTGGCTGAGCCACAAG 

AGCCTCCAACTGTGGAACTAGATGTTTCTGTCAAGGGTGGAATACAAATCATGGCTGGGAAGACTCTCAGAATCCCAGCGGAGGTGACTGGCCGTCCTGT

GCCCACAAAAGTATGGACCATCGAAGAAGGGGAGCTAGATAAAGAGCGTGTTATAATAGAGAATGTCGGAACCAAATCTGAACTAATTATCAAGAACGCA

TTGAGAAAAGACCATGGCAGATACGTGATCACGGCAACAAACAGCTGTGGTTCCAAATTTGCCGCAGTCCGGGTTGAAGTGTTCG ATGTCCCTGGCCCA

GTTCTTGACCTCAAACCGGTTGTAACAAACAGAAAGATGTGTCTGCTTAATTGGTCCGATCCAGCAGATGATGGCGGAAGTGACATCACAGGGTTTATAA

TTGAAAGGAAGGATGCTAAGATGCACACTTGGAGACAGCCCATCGAGACTGAGAGATCCAAGTGTGACATCACAGGCCTTATAGAGGGACAAGAATACAA

GTTCCGTGTCATTGCCAAGAACAAGTTTGGCTGTGGGCCTCCTGTTGAAATAGGACCAATTCTTGCAGTTGATCCACTAG GCCCTCCAACATCTCCTGA

AAGGCTCACATACACAGAAAGAACAAAATCCACCATCACACTTGACTGGAAAGAGCCACGCAGCGATGGTGGCAGTCCCATTCAAGGATATATCATTGAA

AAACGCCGCCATGACAAACCCGACTTTGAAAGAGTTAACAAGAGACTCTGCCCAACCACATCATTTCTGGTTGAAAATCTTGATGAACACCAAATGTATG

AGTTCCGTGTCAAAGCCGTCAATGACGTTGGTGAAAGTGAACCATCTCTGCCTCTTAACGTAGTCATACAGGATGATGAAG TCCCTCCCACTATTAAGT

TGCGCCTGGCTGTTCGAGGAGACACTATCAAAGTTAAGGCAGGGGAGCCAGTTAACATCCCTGCAGACGTGACCGGCCTCCCCATGCCTAAGATTGAGTG

GTCCAAGAATGAAAAGGTGATTGATAAACCTACGGATACACTGAATATAACCAAAGAAGAAGTCTCCCGAAGTGAGGCAAAGACTGAGCTTAGCATCCCT

AAAGCAGCCCGAGAGGACAAGGGCACGTACACAATCACAGCTTCCAATCGTCTTGGCTCCGTATTCCGCAACGTTCATGTGGAGGTTTATG ATCGTCCA

TCTCCACCCAGAAACCTCGCTGTTACTGACATCAAAGCTGAGTCTTGCTATTTGACGTGGGATGCCCCTCTAGACAATGGAGGCAGTGAAATTACTCATT

ACATCATTGACAAGCGTGATGCCAGCAGGAAGAAGTCCGAATGGGAAGAAGTCACTAACACTGCTGTTGAGAGAAGATACGGG ATCTGGAAGCTTATCC

CCAATGGTCAGTACGAGTTCCGAGTGAGGGCAGTGAATAAATATGGAATCAGTGATGAATGCAAATCAGACAAGGTCGTCATTCAAGATCCCTACCGCCT

CCCCGGGCCTCCTGGAAAACCGAAAGTCTTAGAACGTACCAAAGGATCTATGCTTGTGAGCTGGACCCCTCCTCTGGACAACGGAGGGTCTCCAATTACT

GGCTACTGGCTAGAGAAGAGAGAGGAAGGTGGTACCTACTGGTCACGTGTTAGCAGAGCACCAATAACCAAAGTAGGACTGAAGGGTGTGGAATTCAATG

TTCCGCGGTTGATTGAAGGCGTCAAATATCAATTTAGAGCCATGGCAATAAATGCTGCAGGAATTGGCCCTCCCAGTGAACCATCAGACCCAGCTGTTGC

AGGAGATCCTATAT ACCCTCCTGGGCCACCTTCTTGCCCAGAGGTCAAAGATAAAACAAAATCAAGCATCTCACTAGCATGGAAACCTCCAGCCAAAGA

CGGTGGCAGCCCAATCAAAGGCTACATTGTAGAGATGCAAGAGGAGGGAACCACGGACTGGAAGCCAGTCAATGAACCCGATAAACTTCTCACTGCCTGT

GAATGTGTGGTGCCTAATCTGAAAGAGCTCAGGAAGTACAGGTTCAGAGTGAAAGCTGTCAATGAAGCTGGAGAGTCTGAACCAAGTGACACGACCGGAG

AGATCCCTGCCACTGATATCCAAG AAGTTCCAGAGGTTTTCATTGACATTGGCGCACAAGACTGCCTGGTTTGCAAAGCTGGCTCACAGGTCAAAATTC

CTGCTGTGATCAAGGGACGCCCCACACCAAAATCATCTTGGGAATTTGATGGAAAAGCAAAGAAGGCAATGAAG GATGGAGTTCATGATATACCTGAAG

ATGCACAG CTGGAGACGGCCGAAAACTCATCGGTCATCATTATCCCAGAGTGTACTCGAGCTCACTCGGGCAAATACAGCATCACAGCCAAGAACAAAG

CAGGACAGAAAACTGCCAACTGCAGAGTTAAAGTCATGG ACGCACCAGGCCCTCCCAAAGATTTGAAGGTCAGTGACATCACAAGGGGTAGTTGCCGCC

TCTCATGGAAGATGCCAGATGATGATGGAGGTGATAGGATCAAAGGCTACGTCATTGAGAAGAAGACCATCGACGGGAAAGCCTGGACGAAAGTCAATCC

AAATTGTGGAAGCACCACATTTGTGGTACCAGATCTTATCTCTGAGCAGCAATACTTCTTCCGTGTTCGAGCAGAAAACCGTTTTGGAATTGGCCCACCT

GCAGAAACCATCCAGAGGACCACTGCCAGAGACCCAATAT ATCCTCCTGATCCCCCTATCAAACTCAAGATTGGTCTCATAACAAAGAACACAGTGCAC

CTGTCGTGGAAACCTCCAAAGAATGATGGTGGCTCTCCTGTCACCCATTATATTGTTGAGTGTTTGGCTTGGGACCCTACCGGGAAAAAGAAAGAAGCCT

GGAGGCAGTGCAATAGGCGTGATGTGGAAGAACTGGAGTTCACCGTGGAAGACCTCATAGAGGGAGGGGAATATGAATTCAGAGTCAAAGCCGTCAACGA

GGCCGGGGTCAGCAAGCCTTCAGCCACTGTTGGTCCTGTGATTGTCAAAGACCAGACAT GCCCACCAGCCATTGAGCTAAAAGAATTCATGGAAGTTGA

AGAAGGAACTGATGTTAACATTGTGGCCAAAATCAAAGGTGTGCCGTTCCCAACTCTCACCTGGTTCAAGGCTCCGCCAAAGAAACCCGACAGCAAAGAG

CCTGTTGTTTATGACACCCATGTCAACAAACAGGTGGTGGATGACACTTGCACTTTAGTCATTCCTCAGTCTCGCCGGAGTGACACTGGCTTATATTCTA

TCACAGCCGTAAACAACCTGGGGACAGCATCAAAGGAGATGAGACTCAATGTCCTTG GTCGTCCTGGCCCCCCTGTGGGACCCATAAAGTTTGAATCTA

TTTCAGCGGATCAGATGACATTATCTTGGCTTCCACCTAAAGATGACGGTGGGTCTAAGATTACAAACTATGTCATTGAGAAAAGAGAAGCCAACAGAAA

GACATGGGTACGTGTCTCCAGTGAACCTAAAGAATGCATGTACACAATTCCCAAATTGCTAGAAGGCCATGAATACGTCTTCCGAATCATGGCCCAGAAT

AAGTACGGCATTGGAGAGCCACTTGACAGTGAACCTGAGACAGCACGGAACCTCTTCT CTGTCCCTGGAGCTCCAGATAAACCAACAGTGAGCAGCGTC

ACTCGCAACTCCATGACTGTCAACTGGGAAGAGCCGGAATATGATGGAGGCTCTCCTGTGACAGGGTACTGGTTAGAAATGAAAGACACCACTTCAAAGA

GATGGAAGAGAGTTAACCGAGATCCCATCAAAGCCATGACTCTAGGTGTTTCTTACAAAGTGACTGGCCTTATTGAAGGATCAGACTATCAGTTCCGGGT

ATATGCAATCAATGCCGCTGGTGTGGGTCCAGCAAGTCTTCCCTCAGATCCAGTGACTGCTAGAGATCCAGTTG CTCCCCCTGGTCCTCCATTCCCCAA

AGTGACAGACTGGACAAAATCATCTGTGGACTTAGAATGGTCTCCTCCACTAAAAGATGGCGGATCCAAAATCACTGGCTACATTGTTGAGTATAAGGAA

GAAGGAAAAGAAGAATGGGAAAAG GGTAAAGATAAAGAAGTGAGGGGGACAAAACTGGTTGTTACTGGATTAAAAGAAGGAGCCTTCTACAAATTCCGT

GTGAGAGCAGTCAATGTTGCTGGTGTTGGGGAACCTGGAGAAGTCACGGACGTTATTGAAATGAAGGACAGAATTG TGTCGCCTGACCTTCAGCTTGAT

GCCAGTGTCAGAGACAGAATAGTGGTCCACGCCGGAGGGGTGATCCGTATCATTGCCTATGTATCTGGGAAGCCACCTCCCACTGTCACCTGGAGTATGA

ATGAAAGAGCCTTGCCTCAAGAGGCCGCCATTGAGACCACAGCAATTAGCTCATCCATGGTCATCAAGAACTGCCAGAGGAGCCACCAAGGCGTCTACTC

TCTTCTTGCCAAAAATGAAGGCGGAGAAAGAAAGAAGACAATTATTGTTGATGTACTAG ATGTCCCAGGACCTGTTGGAATACCATTCCTCTCTGACAA

CCTAACCAATGACTCCTGCAAACTGACATGGTTCTCTCCAGAAGATGATGGTGGCTCTCCAATCACCAATTATGTCATTCAGAAGCGGGAAGCTGACCGC

AGGGCATGGACCCCTGTGACATACACAGTCACTCGACAAAATGCTACTGTTCAGGGCCTTATTCAAGGAAAATCCTACTTTTTCCGAATTGCAGCTGAGA

ATAGCATTGGCATGGGCCCATTTGTTGAGACACCAAATGCACTTGTCATTAGAGACCCAATAA CTGTGCCAGAGAGACCTGAGGACCTGGAAGTCAAAG

AAGTCACTAAAAATACTGTGTCTTTGACTTGGAACCCTCCCAAGTATGATGGCGGGTCAGAAATTATAAACTATGTCCTAGAAAGCCGCCTCATTGGTAC

TGAGAAGTTCCACAAAGTTACAAATGACAACCTGCTTAGCAGGAAATACACTGTGAAAGGCTTAAAAGAAGGCGATACATATGAGTACCGCGTCAGTGCC

GTCAATATCGTTGGACAAGGCAAGCCATCATTTTGCACCAAGCCAATCACTTGCAAGGATGAACTGG CTCCACCTACACTTGACCTCGACTTCAGAGAT

AAGCTTACCGTCCGAGTTGGTGAATCTTTCGCCCTCACTGGCCGATACTCAGGCAAACCAAAGCCTAAGATTGATTGGTTCAAAGATGAAGCTGATGTAC

TGGAAGATGATCGTACTCACATAAAGACCACTCCCACGACACTTGCTCTTGAGAAGACAAAGGCCAAACGCTCAGATTCTGGGAAATACTGTGTAGTTGT

GGAGAACAGTACAGGCTCCAGGAAAGGTTTCTGTCAAGTCAATGTTGTTG ATCGTCCTGGACCACCAGTAGGACCTGTCATTTTTGATGAGGTGACCAA

AGAATACATGGTTATTTCTTGGAAGCCACCTCTAGATGATGGAGGAAGTGAAATTACCAATTATATTATTGAGAAGAAGGAGCTCGGTAAAGACATCTGG

ATGCCTGTGACATCTGCCAGTGCCAAAACTACATGCAAGGTCCCTAAACTGCTTGAAGGAAAAGATTACATCTTCCGGATTCATGCGGAAAATCTATATG

GAATAAGTGACCCTCTGGTGTCTGATTCAATGAAAGCCAAAGATCGATTCA GAGTCCCTGATGCACCTGAGCAGCCAGTTGTCACAGAGGTCACCAAAG

ACTCGGCATTAGTAACCTGGAACAAGCCAAATGACGGAGGAAAGCCCATCACAAACTACATCCTGGAAAAGAGGGAAACTATGTCTAAAAGATGGGTTCG

AGTTACCAAAGAGCCTATTCATCCATACACTAAGTATAGGGTTCCTGATCTTCTAGAAGGATGCCAGTATGAATTCCGTGTTTCTGCAGAGAATGAAATT

GGTATTGGAGATCCAAGTCCACCATCCAAACCAGTCTTTGCTAGAGACCCAATTG CTAAACCAAGTCCACCTATTAATCCTGAGGCAATAGATACAACA

TGTAATTCAGTTGAGCTAACTTGGCAGCCACCACGTCACGACGGTGGTAGCAAGATCCTGGGTTATATCGTGGAGTACCAGAAAGTTGGGGATGAAGAGT

GGAGACGAGCCAATCACACTCCTGAATCATGCCCTGAAACTAAATATAAAGTCACTGGCCTCAGGGATGGTCAGAGCTACAAGTTCCGAGTACTGGCAGT

CAACGAGGCTGGTGAATCGGACCCAGCCCACGTTCCTGAACCAGTTCTAGTAAAGGACCGACTTG AACCTCCTGAGCTTATACTTGATGCTAACATGGC

AAGAGAACAACACATTAGAGTTGGTGACACCCTAAGACTTAGTGCCATCATCAAAGGTGTGCCATTCCCCAAAGTAACCTGGAAAAAAGAAGACAGAGAG

GCTCCAACAAAAGCCCAAATTGATGTTACTCCAGTTGGGAGCAAGCTTGAAATCCGTAATGCTGCCCACGAAGATGGTGGTATTTATTCCCTAACTGTGG

AGAATCCGGCGGGTACAAAGACAGTCTCAGTCAAAGTATTGGTCTTAG ATAAACCTGGGCCACCTAGAGATCTGGAAGTCAGTGAAATTAGGAAAGATT

CTTGTTACCTGACTTGGAAGGAACCACTGGACGACGGTGGTTCTGTTGTAACCAATTATGTGGTTGAGAGGAAAGATGTTGCCACTGCCCAGTGGTCCCC

TCTTTCCACCACGTCAAAGAAGAAGAGCCATATGGCTAAACATCTGACTGAGGGCAATCAGTACCTCTTCCGAGTAGCTGCTGAGAACCAATACGGACGT

GGTCCTTTTGTTGAAACACCTAAGCCCATCAAGGCTCTGGATCCTCTCC ATCCCCCAGGGCCACCCAAGGATCTGCACCACGTAGATGTCGACAAGACT

GAAGTCTCTCTCGTTTGGAATAAGCCAGATCGTGATGGTGGTTCTCCAATCACAGGATACTTAGTGGAATATCAAGAAGAGGGTGACAAGGACTGGATCA

AGTTCAAGACTGTGAAAAATTTAGACTGTGTTGTTACAGGCTTACAACAAGGAAAGACCTATAGATTCCGTGTAAAAGCTGAAAATATCATAGGTCTTGG

TCTTCCTGATACAACTATCCCAATAGAATGTCAAGAGAAACTAG TGCCTCCATCTGTGGAATTAGATGTGAAGTTAATTGAAGGGCTTGTGGTGAAGGC

TGGTACCACAGTTAGATTCCCTGCCATCATAAGAGGTGTACCTGTTCCTACTGCAAAATGGACAACTGATGGGACTGAGATTAAAACAGATGACCACTAC

ACAGTTGAGACTGACAGCTTCTCATCCGTGCTGACCATTAAGAATTGTTTAAGGAAGGATACTGGGGAATACCAACTCACAGTTTCCAATGCAGCGGGTA

CCAAAACAGTAGCTGTCCATCTTACTGTTCTTGATGTACCTGGTCCACCAACAGGTCCTATTAATATCCTGGATGTCACACCTGAATACATGACTATCTC

ATGGCAACCGCCTAAGGATGATGGAGGAAGCCCAGTGATAAATTACATTGTTGAGAAACAAGATACAAGGAAAGGTACATGGGGTGTCGTCTCTGCAGGA

AGCAGTAAGCTGAAGCTGAAGGTCCCACATCTCCAAAAAGGCTGTGAATACGTTTTCAGAGTCAAAGCAGAGAACAAGATGGGTGTCGGTCCTCCCCTTG

ACTCCATACCTACTGTTGCTAAGCACAAGTTCAGTCCTCCATCTCCTCCTGGTAAACCAGTGGTAACTGACATTACTGAGAATGCTGCAACGGTGTCTTG

GACACTGCCAAAATCTGATGGTGGCAGTCCAATAACTGGCTATTATGTAGAGCGCAGAGAAATAACCGGCAAATGGGTGAGGGTCAACAAAACGCCTATT

GCTGACCTGAAGTTCAGGGTGACTGGACTCTATGAGGGAAATACATACGAGTTTAGAGTTTTTGCTGAAAATCTTGCAGGTTTAAGCAATCCATCACCCA

GTTCTGACCCAATCAAAGCTTGCCGGCCCATCAAACCACCAGGGCCACCTATAAATCCTAAGCTGAAAGACAAGAGCAAAGAATCTGCTGACTTGGTGTG

GACAAAGCCCCTCAGTGATGGTGGCAGCCCCATTTTGGGGTATGTAGTAGAGTATCAGAAACCTGGCACAGCGCAGTGGGATAGGATTAATAAAGACGAA

CTCATCAGGCAATGTGCCTTCCGGGTCCCCGGACTGATTGAAGGAAATGAGTACAGATTTCGCATTAGAGCAGCTAACATTGTGGGTGAGGGAGAGCCAA

GGGAGCTTGCAGAATCTGTGATTGCAAAAGACATCCTTCATCCCCCGGAAGTGGAACTTGACGTTACATGCCGTGATGTCATTACCGTCCGGGTGGGTCA

AACTATCCGCATTCTTGCCCGAGTCAAAGGCAGACCTGAGCCAGACATAACTTGGTCCAAGGAAGGAAAAGTACTGGTCAAAGACAAGCGGGTTGACCTA

ATTCATGATCTGCCTCGTGTTGAGCTACAAATTAAAGAAGCTGTCAGAGCTGACCATGGCAAGTATATCATCTCTGCTAAGAACAGCAGTGGGCATGCCC

AAGGGTCAGCCATTGTTAATGTCCTTGACAGACCTGGGCCTTGCCAGAATCTGAAGGTTAGCAACGTAACCAAGGAAAACTGCACCATTTCTTGGGAAAA

CCCACTAGATAATGGTGGCTCAGAAATTACAAATTTCATAGTGGAATATCGTAAACCAAATCAGAAAGGCTGGTCAATCGTTGCCTCAGATGTCACCAAG

AGACTGGTCAAGGCCAACCTGTTAGCCAATAATGAATACTATTTCCGTGTTTGTGCAGAGAATAAAGTAGGTGTTGGGCCAACCATTGAAACAAAGACTC

CAATTTTGGCCATCAATCCTATTGACAGGCCAGGGGAGCCTGAAAACCTTCATATTGCAGATAAAGGAAAGACCTTTGTCTATCTAAAGTGGCGACGGCC

TGATTATGATGGTGGTAGCCCGAATCTATCATATCATGTTGAGAGGAGACTGAAGGGCTCTGCAGACTGGGAAAGAGTGCACAAAGGAAGCATTAAGGAA

ACCCACTACATGGTTGACAAGTGTGTTGAAAACCAGATTTATGAGTTCAGAGTACAAACTAAGAATGAAGGTGGAGAAAGTGATTGGGTGAGGACAGAGG

AAGTTGTTGTGAAGGAAGATTTACAGAAGCCAGTACTTGATCTAAAATTAAGTGGGGTGCTAACTGTCAAAGCAGGGGACACCATTAGACTCGAGGCAGG

TGTGAGAGGCAAACCATTCCCAGAGGTTGCCTGGACCAAAGACAAAGATGCTACAGATTTAACAAGATCACCAAGGGTCAAGATTGATACCAGTGCCGAA

TCATCGAAATTCTCTCTTACCAAAGCCAAGCGAAGCGATGGCGGTAAATACGTAATCACCGCAACTAACCCAGCTGGCAGTTTTGTGGCCTATGCGACTG

TCAATGTTTTAGATAAACCTGGTCCTGTAAGAAACCTGAAAATCACTGATGTGTCCAGTGACAGGTGTACTATCCGCTGGGATCCACCAGAAGATGATGG

CGGCTGTGAAATCCAAAATTATATCCTAGAAAAATGTGAGAGCAAGAGAATGGTATGGTCTACCTATTCTGCTAATGTCTTGACACCCAGTGCTACAGTG

ACTCGTCTCATAGAAGGAAATGAGTATATTTTCAGAGTTCGTGCAGAAAACAAAATAGGCACAGGGCCTCCAACAGAAAGTAAACCAGTCATTGCAAAAA

CCAAGTATGACAGACCTGGCCGCCCTGATCCTCCAGAAGTCACTAAAGTAAGCAAAGAAGAGATGACCGTGGTTTGGAACGCCCCTGAATATGATGGTGG

GAAGTCTATCACAGGATACTATTTAGAGAAAAAAGAAAAGCATGCAGTCCGCTGGGTCCCTGTTAACAAGAGTGCCATCCCTGAGCGACGCTTGAAAGTA

CAGAATCTCCTCCCAGGGCACGAGTACCAGTTCCGTGTCAAAGCAGAAAATGAAGTTGGCATTGGAGAACCAAGCTTACCATCAAGACCAGTGGTGGCAA

AAGATCCCATAG AACCACCTGGGCCACCAACCAATTTCAAAGTGGTTGATACAACCAAAAGTTCCATAACTCTCGCATGGGGAAAACCAGTCTATGATG

GTGGTGCACCGATAATTGGATATGTCGTAGAGATGAGACCCAAAATAGCAGACGCATCACCTGACGAAGGCTGGAAAAGGTGCAACGCTGCAGCTCAACT

TATTCGCATGGAATTCACAGTCACCAGCTTGGATGAGAACCAGGAGTACGAGTTCAGGGTGTGTGCCCAGAATCAAGTTGGCATTGGGCGCCCTGCAGAG

CTAAAGGAAGCCATCAAACCTAAAGAAATCCTAG AGCCTCCAGAGATTGACTTGGATGCCAGCATGAGAAAACTGGTCGTAGTGAGAGCTGGCTGCCCT

ATTCGACTATTCGCAATAGTGAGAGGACGACCTGCCCCCAAAGTCACATGGCGCAAAGTGGGCATTGATAATGTGGTCAGAAAAGGACAAGTCGATCTAG

TTGACACTATGGCCTTCCTTGTCATCCCCAACTCTACCCGTGATGACTCTGGAAAATACTCCCTGACCCTTGTGAACCCAGCAGGAGAAAAGGCTGTTTT

TGTGAATGTCAAAGTACTAG ATACTCCTGGACCTGTGGCTGATTTAAAAGTTTCAGATGTCACTAAAACATCATGTCACGTGTCCTGGGCACCTCCTGA

AAATGATGGTGGAAGCCAAGTGACACATTATATTGTGGAGAAACGTGAGGCAGAAAGAAAAACATGGTCAACAGTTACCCCTGAAGTGAAGAAAACAAGC

TTCAATGTAACCAACCTTGTCCCTGGGAACGAGTATTTCTTCCGAGTAACTGCTGTCAATGAATATGGCCCTGGTGTCCCGACAGACATCCCCAAACCTG

TGCTTGCATCAGATCCTCTCA GTGAGCCAGATCCTCCAAGAAAACTGGAGGTGACCGAAATGACAAAGAACAGTGCTACACTGGCCTGGTTACCTCCGT

TGCGTGATGGAGGCGCTAAAATCGATGGCTATATCATTAGTTACAGAGAAGAAGACCAACCTGCAGATCGCTGGACAGAGTACTCAGTGGTCAAAGACCT

CAGCCTTATTGTTACTGGCCTAAAGGAAGGAAAGAAATATAAATTTAGAGTTGCAGCTAGAAATGCTGTTGGAGTCAGCATGCCAAGAGAGGCCGAAGGC

GTCTACGAAGCAAAAGAACAGCTAT TGCCACCAAAGATCCTCATGCCTGAGCAAATCACTATCAAAGCCGGGAAGAAACTTCGAGTTGAGGCGCATGTG

TATGGAAAGCCTAACCCCATCTGCAAATGGAAGAAAGGAGACGACGAAGTTGTTACATCCAGCCACCTGGCCATCCACAAGGCAGACGGCTCCTCAGTTC

TGATCATAAAAGACGTTACTAGAAAAGACAGTGGTTACTATAGCCTCACGGCAGAGAATAGCTCCGGGTCAGACACTCAGAAAATCAAAGTTACAGTCAT

GG ATGCTCCTGGGCCCCCTCAGCCTCCATTTGACATTTCTGAAATAGATGCTGATGCTTGCTCCCTGTCTTGGCACATCCCTCTGGAGGATGGAGGCAG

CAACATTACCAATTACATAGTAGAGAAATGTGATGTAAGCCGTGGCGATTGGGTCACAGCTCTAGCATCAGTCACCAAGACTTCCTGCAGGGTTGGAAAG

CTGATCCCAGGCCAGGAGTATATCTTCCGGGTCCGAGCTGAAAACAGATTTGGCATTTCAGAGCCTCTCACATCTCCAAAGATGCTTGCTAAGTTCCCAT

TTG ATGTTCCTAGTGAGCCAAAGAATGCACGTGTCACTAAAGTCAACAAAGACTGCATATTTGTCGCGTGGGACAGACCAGACAGTGATGGAGGAAGCC

CCATCACTGGTTACCTGATTGAACGCAAAGAAAGAAACAGTTTGCTCTGGGTGAAAGCTAATGACACTATTGTCCGGTCAACTGAGTATCCTTGTGCTGG

CCTCGTAGAAGGTCTAGAATATTCATTCAGAATCTATGCTCTAAACAAAGCTGGGTCCAGCCCACCTAGCAAACCAACTGAGTATGTGACTGCAAGGATG

CCGGTTG ATCCACCAGGGAAACCTGAAGTTGTTGACGTCACCAAGAACAGCGCATCGCTTATCTGGGCCCGGCCAAAGCATGATGGAGGCAGCAGAATT

ATCGGCTATTTTGTAGAGGCTTGCAAACTTCCTGGTGATAAATGGGTTCGGTGCAATACCACACCTCACCAGATTCCCCAGGAAGAGTACACAGCTACTG

GGTTAGAAGAGAATGCTCAGTATCAGTTCAGAGCGATTGCCAAGACTGCTGTGAACATCAGCCAGCCTTCCGAGCCTTCTGATCCAGTGACCATTCTTGC

AGAAAATG TTCCTCCACGGATAGAACTCAGTGTTGAGATGAAGTCTTTGCTTACCGTGAAGGCTGGGACTAATGTCTGCTTGGATGCTACTGTCTTCGG

GAAACCGATGCCAACGGTTTCTTGGAAGAAAGACACCACACCAATAAAACAAGCCGAAGGCATAAAGATGGCAATGAAGCGGAACTTGTGTACCTTGGAG

CTGTTCAGTGTGAACCGGAAAGACTCAGGAGACTATACCATTACTGCCGAAAATTCCAGTGGTTCCAAATCAGCCACCATTAAGCTGAAAGTACTAG AT

AAGCCAGGTCCTCCAGCATCTGTGAAAATCAACAAGATGTATGCAGACCGTGCAATGCTGTCCTGGGAACCTCCTCTCGAGGATGGAGGCTCAGAAATCA

CCAACTACATCATTGACAAGCGTGAAACAAGCAGGCCCAACTGGGCCCAGGTCTCTGCTACTGTGCCCATCACCAGCTGCACTGTGGAGAAACTTATAGA

GGGCCATGAATACCAGTTCCGTATCTGTGCCGAAAACAAATACGGAGTCGGCGATCCCATCCTCACTGAGCCAGCGATTGCCAAAAACCCATATG ACCC

GCCTGGACGCTGTGACCCTCCTGTCATTAGCAACATCACTAAAGATCACATGACCGTCAGCTGGAAAGCCCCAGCGGATGATGGTGGCTCACCTATCACC

GGATACTTGGTTGAAAAGCGGGAAACTCAGGCAGTCAACTGGACTAAAGTCAACAGAAAACCTGTTATAGAAAGGACATTAAAAGCAACGGGTCTCCAGG

AAGGCACGGAGTATGAATTCCGAGTTACGGCTATCAATAAAGCTGGACCCGGCAAACCCAGTGATGCATCCAAAGCCGTGTATGCTCAAGACCCACTGT 

ATCCTCCTGGCCCGCCAGCTTTCCCTAAAGTCTATGATACCACCCGTAGTTCTGTGAGTCTATCATGGGGCAAGCCGGCCTATGATGGCGGCAGCCCTAT

CATTGGTTATCTTGTGGAAGTAAAGCGAGCTGATTCTGATCACTGGGTGAGGTGCAATTTGCCAGAGAAGCTCCAGAAGACCCGCTTCGAGGTGACTGGC

CTGATGGAAAACACCGAGTATCAGTTCCGAGTGTATGCCGTTAACAAGATTGGGTACAGCGACCCCAGCGATGTGCCAGATAAACACTGCCCCAAGGACA

TCCTAA TTCCACCTGAGGGAGAACTTGATGCTGAACTAAGGAAAACACTTATCTTACGTGCTGGAGTTACAATGAGACTCTACGTGCCAGTAAAAGGAC

GGCCACCTCCAAAGATTACTTGGTCTAAACCGAACGTCAATCTAAGAGAAAGGATTGGCCTGGATATAAAGTCGACAGACTTTGACACCTTCTTGCGCTG

CGAAAATGTGAACAAATATGATGCAGGAAAATATATCTTAACCTTGGAGAACAGCTGCGGCAAGAAGGAGTACACTATTGTGGTGAAAGTGCTGG ACAC

TCCTGGTCCACCTGTCAATGTGACTGTTAAGGAGGTATCCAAGGACTCTGCATATGTTACCTGGGATCCTCCCATTATTGATGGTGGGAGCCCCATCATA

AACTATGTGGTTGAGAAACGGGATGCAGAGAGGAAGTCCTGGTCGACAGTGACAACCGAGTGCTCGAAGACAAGCTTCAGAGTCTCTAACTTGGAGGAGG

GGAAATCCTACTTCTTCAGAGTGTTTGCCGAAAATGAATACGGCATCGGGGATCCGGGGGAGACACGTGATGCTGTCAAAGCTTCTG AAACCCCGGGAC

CTGTGGTCGACCTGAAAGCACTGGCTATAACTAAGTCATCTTGTACCATCGGCTGGAAGAAGCCTCGAAGTGATGGCGGAAGCAGAATTACTGGCTATGT

GGTGGATTTCCTGACAGAAGAAAATAAGTGGCAACGGGTCATGAAATCACTGAGCCTTCAGTACTCCACAAAGGATCTGAAGGAGGGGAAGGAGTACACC

TTCAGAGTGAGTGCAGAGAATGAAAACGGAGAAGGAACCCCAAGTGAAATTGTGGTTGTGGCCAAGGACGATGTTG TGGCTCCCGATCTTGACTTGAAG

GATCTACCTGATCTGTGCTACTTGGCTAAAGAAAACAGCAACTTCCGTCTCAAGATCCCCATAAAAGGCAAACCAGCACCATCGGTGTCTTGGAAGAAGG

GGGAAGATCCCCTAGCAACAGACACAAGAGTCAGTGTCGAATCAACTGCAGTTAACACAACCCTTGTAGTATATGACTGCCAAAAATCCGATGCTGGAAA

ATACACAATCACACTCAAGAATGTTGCTGGCACCAAGGAAGGAACTCTTTCTATAAAGGTTGTTGGCAAGCCTGGCATCCCCACCGGACCAATCAAATTT

GATGAAGTCACAGCAGAAGCCATGACCTTGAAGTGGGGTCCTCCAAAGGATGATGGAGGTTCTGAAATCACCAACTATGTACTAGAGAAGAGAGACTCTG

TGAATAACAAGTGGGTGACATGTGCTTCCGCTGTCCAGAAAACCACCTTTAGAGTAACCAGACTTCACGAGGGCATAGAATACACCTTCAGGGTCAGTGC

TGAAAATAAATATGGTGTAGGAGAAGGCCTAAAGTCAGAGCCAATTGTTGCCAAACATCCATTTG ATGTGCCTGATGCTCCCCCACCTCCCAATATTGT

GGATGTCAGACATGATTCAGTATCTCTAACATGGACTGATCCCAAAAAGACTGGTGGCTCACCAATTACAG GGTATCATATTGAATTCAAGGAAAGAAA

CAGCCTTCTGTGGAAGAGAGCTAACAAGACTCCTATAAGGATGAAAGATTTTAAAGTGACAGGATTAACTGAAGGTCTTGAATATGAATTCAGAGTTATG

GCTATCAATCTAGCTGGAGTGGGCAAGCCAAGCCTGCCATCAGAGCCAGTTGTGGCACTTGATCCAATTG ATCCTCCTGGAAAACCTGAGGTTATCAGC

GTAACAAGGAATTCAGTGACTCTCATCTGGACAGAACCTAAATACGATGGTGGCCATAAATTAACAGGATATATCGTGGAGAAGCGGGATCTACCCTCTA

AGTCTTGGATGAAAGCCAACCATGTTAATGTCCCAGACTGTGCCTTTACTGTAACTGATCTTGTTGAAGGTGGAAAATATGAATTCCGAATCAGAGCAAA

GAATACAGCGGGTGCTATTAGTGCTCCATCAGAGAGCACAGGAACCATTATTTGCAAGGATGAATACG AGGCACCAACCATTGTCCTTGATCCAACAAT

TAAAGATGGGCTAACAGTCAAGGCAGGGGATAGCATTGTTTTAAGTGCCATTAGCATTCTCGGCAAACCCCTTCCAAAGTCAAGCTGGTCCAGGGCAGGA

AAAGATATCAGACCATCAGACATAGCTCAAATAACTTCAACCCCAACATCTTCTATGCTGACAGTTAAGTATGCCACAAGAAAGGATGCTGGCGAGTATA

CCATCACCGCTACCAATCCTTTTGGCACAAAGGAGGAACATGTGAAGGTATCAGTCCTTGATGTACCTGGTCCCCCAGGTCCCATTGAAATCAGTAATGT

TTCAGCTGAAAAAGCAACACTTACTTGGACACCTCCCTTAGAAGATGGGGGCTCACCGATTAAAGCTTATGTTCTTGAGAAGAGAGAAACCAGCCGGCTT

TTGTGGACAGTGGTTTCTGAAGATATTCAGGCATGCAGACATGTGGTAACCAAACTCATCCAAGGAAATGAATACCTCTTCCGTGTGTCAGCAGTAAACC

ATTACGGCAAAGGAGAACCCGTTCAGTCTGAGCCTGTCAAAATGGTGGACAGATTTG GTCCTCCTGGCCCTCCTGGAAAACCCGAGATCTCAAATGTCA

CCAAGAACACTGCCACTGTCAGCTGGAAGAGGCCAACTGATGATGGTGGCAGCGAGATCACAGGATATCATGTAGAAAGGAGAGAAAAGAAAGGCCTGCG

GTGGGTGAGAGCAACCAAAACACCAGTTTCCGATCTCAGGTGCAAAGTAACTGGACTGCAAGAAGGAAATACCTATGAGTTCCGTGTCAGTGCAGAAAAC

AGAGCCGGGATTGGTCCTCCCAGTGACGCCTCGAATCCTGTTCTGATGAAAGATGTTGCAT ATCCCCCAGGACCACCTTCAAATGCACATGTCACTGAT

ACCACCAAGAAATCGGCTTCTTTAGCATGGGGCAAGCCTCATTATGATGGTGGGCTTGAAATCACTGGCTATGTGGTAGAGCATCAAAAAGTAGGAGATG

ATGCCTGGATCAAAGACACAACAGGAACAGCCCTCAGAATCACTCAGTTTGTGGTTCCTGATCTTCAGACTAAGGAAAAATACAATTTTAGAATTAGTGC

CATCAACGATGCAGGTGTGGGGGAACCAGCTGTGATTCCAAATGTTGAAATTGTAGAGAAGGAAGTGGCTCCTGATTTTGAGCTAGATGCTGAGCTGCGA

AGAACACTTGTGGTTAGGGCAGGGCTCAGTATTAGGATTTTTGTGCCAATTAAAGGTCGTCCTGCACCTGAAGTGACATGGACCAAAGATAATATCAACC

TGAAGCACCGAGCCAACATCGAAAACACAGAGTCATTTACTCTTCTCATTATTCCAGAATGTAACAGATATGACACTGGTAAATTTGTGATGACCATCGA

AAACCCAGCTGGGAAGAAAAGCGGCTTCGTTAACGTCAGAGTCCTAGACACACCAGGCCCTGTCCTTAACCTAAGGCCTACAGACATCACAAAGGACAGT

GTCACCCTACACTGGGACCTACCTCTGATAGATGGGGGCTCACGTATAACAAATTATATTGTGGAGAAACGTGAAGCAACCAGGAAATCCTACTCCACAG

TCACTACTAAGTGCCATAAATGTACATATAAAGTGACTGGCTTGACAGAAGGCTGTGAATATTTCTTCAGAGTGATGGCAGAAAATGAATATGGGGTTGG

TGAGCCAACGGAAACCACAGAACCTGTGAGAGCCTCTGAGGCACCGTTACCCCCAGATAGCCTTAACATTATGGACATTACCAAGAACACAGTCAGCCTG

GCGTGGCCTAAGCCAAGGCATGATGGTGGGAGCAAGATCACTGGCTATGTGATTGAAGCCCAGAGAAAAGGGTCTGACCAGTGGACCCACATCTCAACAG

TGAAAGGGTTAGAATGTGTGGTGAGGAACCTAACCGAAGGAGAGGAATATACCTTCCAAGTGATGGCGGTAAACAGTGCAGGCAGGAGTGCCCCTAGAGA

GAGCAGACCTGTCATTGTCAAAGAGCAGACGATGCTCCCAGAGCTGGATCTCCGTGGCATCTATCAGAAGCTAGTCATTGCCAGAGCTGGTGACAACATC

AAAGTTGAAATCCCAGTACTTGGTCGACCCAAGCCCACAGTCACATGGAAAAAGGGAGACCAAATCCTTAAACAGACACAGAGAGTTAATGTTGAAAACA

CAGCAACGTCAACCATCTTAAATATCAATGAGTGTGTCAGAAGTGACAGTGGACCCTATCCATTAACAGCAAAGAACACTGTAGGAGAGGTTGGTGACGT

TATAACCATTCAAGTCCATGATATTCCAGGACCACCTACTGGACCCATTAAATTTGATGAAGTTTCATCTGACTTTGTAACCTTCTCTTGGGAGCCACCA

GAGAATGATGGAGGTGTACCAATAAGCAACTATGTAGTAGAGATGAGACAGACAGACAGTACTACATGGGTGGAGTTAGCAACAACTGTTATACGTACTA

CCTATAAAGCAACTCGTCTGACCACAGGAGTGGAGTATCAATTCCGTGTAAGGGCTCAAAACAGATATGGAGTTGGACCGGGCATCACATCTGCATCTGT

AGTTGCAAACTATCCATTCAAGGTGCCCGGGCCTCCCGGTACCCCTCAGGTTACTGCAGTCACCAAAGACTCCATGACAATCAGCTGGCATGAACCACTT

TCTGATGGTGGAAGCCCCATTTTAGGATATCACATTGAAAGGAAAGAACGGAATGGCATCCTCTGGCAGACTGTGAGCAAAGCATTAGTACCAGGCAACA

TTTTCAAATCAACTGGACTTACCGATGGCATTGCTTATGAATTCCGAGTAATTGCAGAAAACATGGCAGGCAAGAGCAAGCCAAGCAAGCCATCTGAACC

AATGTTTGCTTTGGATCCCATTGACCCACCCGGGAAACCAGTTCCTCTAAACATTACAAGACACACAGTGGCACTGAAGTGGGCTAAGCCTGAATATACC

GGAGGCTTTAAAATTACTAGCTATGTGGTTGAAAAGAGGGACCTTCCTAATGGACGATGGCTGAAGGCCAACTTCAGCAACATTTTAGAGAATGAATTTA

CGGTCAGCGGCCTAACTGAAGATGCTGCATACGAGTTCCGTGTGATTGCCAAAAATGCTGCCGGTGCCATCAGTCCACCGTCTGAGCCATCAGATGCCAT

CACATGCAGGGACGACCTGGAGGCACCAAGAATAATGGTGGATGTTAGATTTAAGGATACCATCACATTAAAAGCTGGCGAAGCATTCAAGTTGGAAGCT

GATGTTTCAGGTCGCCCACCTCCAACAATGGAATGGACTAAAGATGGAAAGGAGCTTGAAGGCACAGGGAAATTAGAAATAAAAATTGCAGACTTCTCCA

CTCATCTGATAAACAAGGATTCCTCAAGAACGGATAGTGGGGCTTACATCCTGACAGCAACCAATCCTGGTGGCTTTGCCAAACACATTTTCAATGTCAA

AGTTCTTGATAGACCGGGACCACCTGAGGGACCTTTGGCTGTGTCTGATGTGACATCAGAGAAGTGTGTGTTGTCATGGTTGCCTCCACTGGACGATGGA

GGTGCCAAAATTGATCATTACATCGTACAGAAACGTGAAACCAGCAGGTTGGCATGGACAAATGTTGCCACAGAAGTCCAAGTAACAAAGCTGAAGGTTA

CTAAGCTCCTGAAAGGGAATGAATACATATTCCGTGTCATGGCAGTAAATAAATACGGGGTTGGAGAGCCACTTGAATCAGAACCTGTGCTTGCAGTGGA

TCCATATGGACCACCTGACCCACCCAAGAACCCGGAAGTTACAACTATCACCAAGGACTCCATGGTCGTCTGCTGGGGGCATCCTGACTCTGATGGTGGA

AGTGAAATTATCAACTACATTGTGGAGCGGCGTGATAAAGCTGGCCAGCGCTGGGTAAAATGCAACAAAAAAGCTCTGACTGACTTAAGATTTAAAGTAT

CTGGGCTGACAGAAGGACATGAATACGAGTTCAGAATTATGGCAGAAAACGCAGCTGGAATCAGTGCTCCGAGTGCTACCAGCCCGTTTTATAAAGCTTG

CGACACTGTGTTTAAACCTGGCCCACCGGGTAACCCACGTGTCCTTGATACAAGCAGGTCGTCCATTTCAATTGCGTGGAATAAACCCATTTATGATGGA

GGTTCAGAAATCACTGGGTATATGGTTGAGATTGCCCTGCCTGAAGAAGATGAATGGCAGGTTGTCACTCCACCAGCTGGGCTCAAGGCAACTTCCTATA

CCATCACCAGCCTCATAGAGAATCAGGAATATAAAATCCGCATTTATGCCATGAATTCTGAGGGACTTGGGGAACCTGCCCTTGTTCCCGGAACTCCAAA

GGCAGAAGAAAGAATGTTGCCTCCAGAGATAGAACTGGATGCTGACTTACGCAAAGTTGTCACTATACGAGCCTGCTGCACCTTGAGGCTCTTTGTTCCC

ATCAAAGGGAGACCAGCACCTGAGGTCAAGTGGGCCCGAGAGCATGGAGAATCTCTGGACAAGGCTAGCATTGAATCCACAAGCTCTTACACCCTGCTTG

TTGTTGGAAATGTTAACAGATTCGACAGTGGCAAGTACATACTAACGGTAGAAAACAGCTCTGGCAGCAAGTCGGCGTTTGTCAATGTTAGAGTGCTAGA

TACGCCAGGCCCTCCACAGAATCTAAAGATAAAGGAGGTCACAAAGACATCTGTCACATTGACGTGGGAGCCTCCTCTCCTGGATGGAGGCTCAAAAATA

AAGAACTATATTGTTGAGAAGCGAGAGTCCACAAGAAAGGCATATTCAACCGTGGCAACGAATTGCCATAAGACGTCCTGGAAGGTAGACCAGCTGCAAG

AAGGCTGCAGTTACTATTTCCGTGTCCTCGCTGAAAACGAATATGGCATTGGACTGCCCGCCGAAACAGCTGAGTCTGTGAAGGCATCGGAGCGACCTCT

TCCTCCAGGGAAGATAACTTTGACGGATGTCACACGAAACAGTGTGTCTCTCTCTTGGGAGAAGCCAGAACATGACGGGGGCAGCCGAATTCTAGGCTAC

ATTGTAGAGATGCAGAGCAAAGGCAGTGACAGATGGGCCACGTGTGCCACAGTGAAAGTCACAGAAGCCACCATCACCGGCCTGATCCAGGGTGAGGAAT

ACTCTTTCCGTGTTTCAGCGCAGAATGAAAAGGGCATCAGTGACCCCAGACAACTGAGTGTGCCAGTAATTGCTAAAGACCTTGTTATCCCACCAGCCTT

CAAACTCCTCTTCAATACATTCACGGTACTGGCAGGTGAAGACCTGAAAATTGATGTACCATTCATTGGACGCCCTCCACCAGCTGTCACCTGGCATAAA

GATGACATACCTCTGAAGCAAACAACTAGAGTGAATGCAGAGAGCACGGAAAACAATTCTCTACTGACAATAAAGGAAGCCTGCCGAGAAGATGTTGGAC

ATTACACGGTTAAACTGACTAACTCGGCAGGTGAAGCCACTGAAACCCTTAATGTTATCGTTCTTGACAAGCCAGGGCCCCCAACAGGACCAGTGAAGAT

GGATGAAGTGACAGCAGACAGTGTCACTCTTTCCTGGGAACCACCAAAGTATGATGGCGGAAGCTCTATCAATAATTACATTGTAGAGAAACGAGACACA

TCCACAACCGCCTGGCAAATCGTGTCAGCTACGGTTGCAAGAACAACCATAAAGGCCTGCAGACTAAAGACTGGCTGTGAGTATCAGTTCAGAATTGCAG

CAGAAAACAGATATGGGAAGAGTACCTACCTCAACTCAGAGCCTGTTGTTGCCCAGTACCCATTCAAAGTGCCAGGGCCACCGGGCACACCATTCGTCAC

GCTTGCCTCCAAAGACAGCATGGAGGTACAATGGCATGAGCCAGTCAGTGATGGTGGGAGCAAAGTCATTGGCTACCATCTAGAGCGCAAGGAAAGAAAT

AGCATCCTCTGGGTCAAGCTGAATAAGACACCTATTCCTCAAACCAAGTTCAAGACAACTGGCCTTGAAGAAGGCATTGAATATGAATTTAGAGTGTCTG

CAGAGAACATCGTAGGCATCGGCAAGCCAAGTAAGCCATCAGAATGTTATGCTGCTCATGACCCATGCGATCCACCAGGTCGGCCAGAGGCAATCATTGT

CACAAGGAACTCTGTGACTCTTCAGTGGAAGAAACCCACCTACGATGGTGGAAGCAAGATCACTGGTTACATTGTTGAGAAGAAAGAATTGCCTGATGGC

CGCTGGATGAAAGCCAGTTTTACAAATATCATTGACACCCAGTTTGAGGTAACTGGCCTACTGGAAGATCATAGATATGAGTTTCGAGTTATAGCTCGAA

ATGCTGCAGGAGTTTTCAGTGAGCCCTCAGAAAGTACAGGGGCAATCACAGCAAGAGATGAGGTTGAGCCACCCAGAATAAGCATGGACCCCAAATACAG

GGACACGGTTGTGGTTCAAGCTGGTGAGTCATTCAAGATCGATGCAGATATATATGGCAAACCAATACCGACCACTCAGTGGGTAAAGGGTGACCAGGAG

CTTTCAAGCACAGCTCGGTTAGAAATTAAGAGCACCGACTTTGCCACCAGTCTCAGTGTCAAAGATGCGGTACGTGTGGATAGTGGCAATTATATCCTAA

AGGCCAAAAACGTTGCAGGGGAGAAATCAGTTACTATCAATGTCAAAGTTCTCGATAGACCAGGGCCACCTGAGGGACCTGTTGCTATATCAGGGGTTAC

AGCAGAAAAATGTACTCTAGCTTGGAAACCCCCACTTCAGGATGGTGGGAGTGACATCACAAATTACATTGTGGAAAGGCGAGAAACCAGCCGCCTCGTC

TGGACTCTGGTTGATGCCAATGTGCAAACGCTCAGCTGTAAAGTCCTGAAGCTTCTTGAGGGCAATGAATATATTTTCCGTATAATGGCTGTGAACAAAT

ACGGTGTTGGTGAACCTCTTGAATCTGAGTCATTGATTGCCAAGAATCCATTTGTAGTCCCAGATGCACCCAAAGCTCCAGAAGTTACAGCTGTGACCAA

AGACTCAATGATTGTTGTATGGGAAAGGCCAGCGTCTGATGGTGGCAGTGAGATTCTAGGATATGTTCTAGAAAAACGGGACAAAGAAGGCATAAGATGG

ACAAGATGCCACAAGCGTCTAATTGGAGAGCTGCGCCTGAGAGTGACTGGACTGTTAGAAAATCACAATTATGAATTCAGAGTCTCCGCTGAAAATGCTG

CTGGACTTAGTGAACCAAGCCCCCCTTCTGCTTACCAGAAGGCATGTGACCCCATTTATAAGCCAGGCCCTCCAAACAACCCCAAAGTCATGGATGTTAC

CAGATCTTCGGTTTTCCTTTCTTGGACCAAACCTATCTATGATGGTGGCTGTGAAATCCAAGGATACATCGTAGAAAAATGTGATGTGAGTGTTGGTGAA

TGGACAATGTGTACGCCACCAACTGGAATCAATAAGACAAATCTAGAAGTCGAGAAGTTGTTGGAAAAGCATGAATACAACTTCCGGATCTGTGCCATTA

ATAAGGCCGGAGTAGGGGAGCATGCTGATGTCCCTGGGCCTGTAATGGTTGAAGAAAAACTTGAAGCACCTGATATAGACCTTGACCTTGAACTAAGGAA

AGTGATTAATATAAGGGCAGGTGGTTCCTTAAGGCTGTTTGTTCCTATAAAAGGCCGTCCTACACCAGAAGTCAAGTGGGGGAAGGTTGATGGTGATATC

CGGGACGCAGCTATAATTGATGTCACTAGCAGCTTCACCTCTCTTGTTCTTGACAATGTCAATCGATATGATAGTGGAAAATACACTCTCACACTAGAAA

ACAGCAGTGGAACAAAATCTGCCTTTGTGACGGTAAGGGTCCTGGACACACCAAGCCCACCTGTCAACTTAAAAGTCACAGAAATCACCAAGGACTCGGT

ATCAATTACATGGGAACCTCCTTTGTTGGACGGAGGATCAAAAATTAAAAATTACATTGTTGAGAAACGAGAAGCCACAAGAAAATCCTATGCTGCAGTT

GTAACAAACTGCCATAAGAATTCGTGGAAAATCGATCAGCTCCAAGAAGGTTGCAGTTACTACTTCAGGGTTACCGCTGAGAACGAATACGGTATTGGCT

TGCCTGCCCGCACTGCAGATCCAATCAAGGTTGCAGAAGTCCCACAACCTCCAGGGAAAATAACTGTGGATGATGTCACCAGAAACAGTGTCTCTCTCAG

TTGGACAAAGCCCGAACATGACGGTGGCAGTAAAATCATCCAGTATATCGTAGAAATGCAAGCTAAAAACACTGATAAGTGGTCAGAGTGTGCTAGGGTG

AAGTCCCTTGACGCAGTTATTACCAACCTAACTCAGGGAGAAGAATACCTTTTCAGAGTCATTGCTGTAAATGAAAAAGGAAGAAGCGACCCCAGGTCCC

TTGCGGTTCCAATCATCGCCAAAGATCTGGTCATCGAGCCAGACGTGAGACCAGCATTCAGCAGTTACAGTGTACAGGTTGGCCAAGACTTGAAAATAGA

AGTGCCAATTTCTGGACGTCCTAAACCAAGCATTTCCTGGACTAAGGATGGGATGCCATTGAAGCAGACCACAAGAATCAATGTTACCGACTCCCTGGAC

CTCACCACACTCAGCATTAAAGAAACTCATAAGGATGATGGTGGACAGTATGGAATCACAGTTTCCAATGTGGTGGGTCAGAAAACAGCAGCTATTGAAA

TCATAACTCTAGATAAACCTGATCCTCCAAAAGGGCCTGTTAAATTTGATGAGATCAGTGCTGAGAGCATCACATTATCCTGGAACCCTCCCTTATATAC

AGGGGGCTGTCAAATTACCAACTACATTGTTCAGAAAAGAGACACAACCACCACAGTATGGGATGTCGTCTCTGCTACTGTTGCCAGAACGACCCTCAAA

GTAACCAAGCTGAAAACGGGTACAGAATACCAATTCAGAATATTTGCTGAAAACCGATACGGACAAAGCTTTGCTCTGGAGTCTGAGCCAGTTGTAGCTC

AATATCCCTACAAAGAACCAGGCCCTCCAGGAACGCCATTTGTCACAGCCATCTCCAAAGAGTCTATGGTGGTACAGTGGCATGAACCGATCAATAATGG

TGGAAGCCCAGTCATAGGTTACCACCTTGAGAGAAAGGAAAGGAATAGTATTTTGTGGACAAAAGTCAACAAAACCATTATTCATGACACCCAGTTTAAA

GCACTGAACCTTGAAGAAGGCATTGAGTATGAATTTAGAGTTTATGCTGAAAATATTGTTGGGGTAGGCAAGGCAAGCAAGAATTCTGAATGCTATGTAG

CCAGAGACCCCTGTGACCCACCAGGTACCCCAGAAGCAATAATAGTTAAGAGAAATGAAATCACTTTACAGTGGACCAAGCCTGTGTACGATGGTGGCAG

TATGATCACAGGTTACATCGTAGAGAAACGTGATTTACCCGAGGGTCGCTGGATGAAAGCCAGTTTCACAAATGTCATTGAAACTCAATTCACCGTGTCA

GGTCTTACTGAAGATCAAAGATATGAATTCAGAGTCATTGCAAAGAATGCAGCTGGGGCAATAAGTAAACCCTCTGACAGTACTGGACCAATAACTGCCA

AGGATGAGGTTGAACTCCCACGAATTTCAATGGATCCAAAATTCAGAGACACAATAGTGGTAAATGCTGGAGAAACATTCAGGCTTGAGGCCGATGTCCA

TGGAAAACCCCTACCCACCATTGAGTGGTTAAGAGGAGACAAGGAAATTGAAGAATCTGCCAGGTGTGAAATAAAGAACACAGATTTCAAAGCTTTACTT

ATTGTAAAAGATGCCATTCGAATTGATGGTGGACAGTATATTTTAAGAGCCTCGAATGTTGCCGGGTCTAAGTCATTTCCAGTAAATGTGAAAGTGCTAG

ACAGACCAGGACCACCAGAAGGGCCAGTTCAGGTTACTGGAGTCACAGCTGAAAAGTGCACTTTGGCATGGTCTCCACCACTTCAAGATGGTGGCAGTGA

CATTTCTCACTACGTGGTAGAAAAGCGAGAAACCAGTCGACTTGCATGGACTGTGGTTGCTTCAGAAGTTGTGACTAATTCTCTGAAAGTTACCAAGCTC

TTAGAAGGGAATAAATATATTTTCCGAATAATGGCTGTCAACAAGTACGGTGTCGGGGAACCTTTGGAATCTGCTCCAGTACTCATGAAAAATCCATTTG

TGCTTCCTGGACCACCAAAGAGCTTAGAAGTCACAAACATTGCCAAAGACTCCATGACAGTCTGCTGGAATCGGCCAGACAGTGATGGTGGCAGTGAGAT

CATTGGTTACATTGTGGAGAAGAGAGACAGAAGTGGCATTCGGTGGATCAAGTGTAACAAACGCCGCATTACAGATTTGCGACTCAGGGTGACAGGATTA

ACAGAAGACCATGAGTATGAATTCAGAGTCTCTGCAGAAAATGCTGCTGGAGTTGGAGAACCAAGTCCTGCTACCGTTTACTATAAGGCATGTGATCCTG

TGTTCAAACCTGGCCCACCCACCAATGCACACGTTGTAGACACCACTAAAAATTCAATTACACTTGCCTGGAGCAAACCTATCTATGATGGCGGCAGTGA

GATCCTGGGCTACGTTGTAGAAATCTGTAAAGCTGATGAAGAAGAATGGCAAATAGTTACTCCACAGACTGGCCTGAGAGTCACTCGATTTGAAATTGCC

AAACTAATCGAACACCAAGAATATAAAATACGAGTTTGCGCCCTCAACAAAGTTGGTTTAGGTGAGGCTGCCTCAGTTCCTGGTACGGTGAAACCGGAAG

ATAAACTCGAGGCACCTGAACTTGACCTTGACTCTGAGTTAAGGAAAGGGATCGTTGTCAGAGCTGGTGGATCTGCCAGAATCCATATTCCATTCAAGGG

TCGTCCAACGCCTGAGATCACTTGGTCAAAAGAGGAAGGTGAATTCACAGATAAGGTCCAAATTGAGAAGGGAATTAACTTCACCCAACTCTCAATAGAT

AACTGTGACAGAAACGACGCCGGGAAATACATCCTCAAGTTGGAGAACAGCAGCGGATCAAAGTCGGCTTTCGTAACCGTGAAAGTACTTGACACACCAG

GACCGCCACAGAATCTGGCTGTCAAGGAAGTGAGAAAAGACTCTGTCCTTCTGGTATGGGAGCCACCTATCATTGACGGTGGGGCAAAGGTCAAGAACTA

TGTCATCGACAAGCGCGAGTCCACTCGAAAAGCATATGCTAACGTGAGTAGTAAATGCAATAAAACGAGCTTCAGAGTCGAGAACCTGACCGAAGGAGCC

ATCTACTACTTTAGAGTCATGGCAGAGAATGAATTTGGGGTTGGTGTTCCCACGGAGACATCTGATGCTGTGAAAGCTTCTGAGCCTCCTTCCCCACCAG

GAAAGGTCACACTCACTGACGTGTCCCAGACCAGTGCATCCCTTATGTGGGAGAAACCCGAGCATGATGGAGGGAGCAGAATTCTGGGCTATGTTGTTGA

AATGCAGCCCAAAGGAACAGAAAAGTGGAGCGTTGTGGCTGAATCCAAAGTCTGTAATGCAGTGGTTAGTGGCCTGAGCTCCGGGCAAGAATATCAGTTC

CGTGTCAAAGCTTACAATGAGAAAGGAAAAAGTGACCCGAGAGTGCTTGGCATTCCTGTCATAGCCAAGGACTTGACCATCCAGCCTAGTTTTAAGCTGC

CATTTAATACATATAGTGTCCAAGCGGGAGAGGATCTGAAAATAGAAATTCCAGTCATAGGCAGACCAAGACCTAAAATTTCTTGGGTCAAAGATGGTGA

GCCTCTTAAACAGACCACCAGAGTAAATGTTGAAGAAACGGCTACTTCGACTATTTTACACATTAAAGAAAGCAGCAAAGATGACTTCGGGAAATACAGT

GTCACAGCAACAAACAGTGCAGGCACAGCAACAGAAAACCTCAGTGTTATTGTTTTAGAAAAGCCTGGTCCTCCCGTTGGACCAGTGAAGTTTGATGAAG

TTAGTGCAGACTTTGTGGTCATATCTTGGGAACCTCCCGCCTATACTGGTGGGTGCCAAATCAGCAACTACATTGTAGAGAAGCGAGATACTACCACTAC

CAACTGGCAGATGGTGTCAGCAACAGTTGCCAGGACAACCATTAAAATAAGCAAACTGAAAACAGGCACCGAATACCAGTTTAGGATTTTTGCTGAGAAC

AGGTATGGGAAAAGCACTCCCCTGGATTCTAAGCCCGTTGTTGTACAATATCCATTTAAAGAGCCTGGACCACCTGGAACCCCTTTTGTAACATCTATCT

CCAAAGATCAAATGCTTGTGCAGTGGCATGAGCCAGTTAATGATGGAGGCAGCAAAGTGACTGGCTACCATCTTGAACAGAAGGAAAAGAATAGCATCCT

GTGGGTCAAGTTGAATAAGATCCCCATCCAAGACACCAAATTCAAAACAACGGGGCTTGATGAAGGGCTTGAATATGAGTTCAGGGTTTCTGCCGAGAAC

ATTGTGGGCATTGGCAAGCCTAGCAAAGTGTCAGAGTGCTATGTTGCGCGTGATCCGTGTGACCCACCTGGTCGACCTGAAGCCATCGTCATTACAAGAA

ACAGCGTCACGCTGAAATGGAAGAAACCTGTTTATGATGGTGGCAGCAAGATAACGGGTTACATCGTAGAAAAGAAAGACCTTCCTGACGGCCGGTGGAT

GAAAGCCAGCTTCACCAATGTTGTGGAAACTGAGTTTACAGTGACTGGGCTTGTAGAAGACCAAAGATATGAATTTAGAGTCATTGCAAGAAATGCGGCT

GACAACTTTAGTGAGCCATCTGAAAGCAGTGGCGCCATCACTGCAAGGGATGAAATCGATGCACCAAATGCCTCGCTGGATCCTAAATACAGAGATGTCA

TCATTGTTCATGCAGGAGAGACCTTTGTTCTCGAAGCTGATATCCGTGGCAAACCCATACCTGACATCATATGGTCAAAAGATGGGAACGAACTCGAAGA

AACAGCAGCTAGGATGGAAATTAAATCTACTCTGCAGAAAACGACTCTCATTGTCAAGGACTGTATACGCACCGATGGGGGACAGTATACCTTGAAACTC

AGCAATGTCGGGGGCACCAAGACTATACCTATTACCGTGAAGGTGCTGGATAGGCCAGGGCCTCCCGAAGGACCTCTGAAAGTTACTGGAGTTACAGCCG

AAAAGTGTTACCTGGCATGGAACCCACCTTTGCAAGATGGTGGTGCTAGTATTTCACATTACATCATTGAAAAGAGAGAGACAAGCAGACTCTCCTGGAC

CCAGGTTTCAAATGAAGTACAGGCCCTCAACTACAAAGTCACGAAGTTGCTTCCTGGGAACGAGTATATTTTCCGGGTTATGGCAGTGAATAAATATGGA

ATTGGAGAGGCCCTGGAGTCTGAACCGGTGATAGCCTGTAACCCATACAAGCGTCCAGGTCCTCCTTCAACACCCGAGGCCTCAGCCATCACCAAAGACT

CTATGGTACTAACATGGACACGTCCAGTGGATGACGGAGGTGCTGAAATTGAGGGGTACATTCTTGAAAAGCGAGATAAGGAAGGCATCAGATGGACCAA

GTGCAACAAGAAAACATTAACAGACCTTCGGTTCAGGGTGACAGGCCTCACAGAAGGCCACTCCTATGAATTCAGAGTTGCTGCTGAGAACGCAGCTGGT

GTCGGGGAACCCAGTGAGCCGTCCGTTTTCTACCGTGCATGTGATGCCTTGTATCCACCAGGTCCACCAAGCAACCCCAAAGTGACAGACACCTCCAGGT

CTTCTGTCTCCCTAGCATGGAATAAGCCAATTTATGATGGTGGTGCACCCGTTAGAGGATATGTGATTGAGCTCAAAAAAGCTGCGGCTGACGAATGGAC

TACCTGTACGCCACCATCGGGATTACAAGGGAAGCAGTTCACAGTGACCAAGCTTAAGGAGAATACAGAGTACAACTTCCGCATCTGTGCTTTCAATACT

GAAGGTGTAGGTGAGCCTGCAACGATACCAGGCTCCGTTGTTGCTCAGGAGAGGATGGAAGCACCAGAAATAGAACTGGATGCTGATCTCAGAAAGGTGG

TCACTCTGCGTGCAAGTGCCACTTTGCGCCTATTTGTCACTATCAAAGGCCGCCCAGAACCTGAAGTTAAGTGGGAAAAGGCTGAAGGCATTCTCACGGA

AAGAGCCCAGATCGAGGTGACGAGTTCTTATACAATGCTGGTGATTGACAACGTGACCAGATTTGACAGTGGTAGATACAACCTCACCCTAGAAAACAAC

AGTGGCTCCAAAACGGCTTTTGTCAATGTCAGAGTTCTTGACTCACCAAGCGCACCCGTGAATCTGACCATAAGAGAAGTGAAGAAAGACTCGGTGACGC

TGTCCTGGGAGCCACCACTTATTGACGGTGGAGCAAAGATTACAAATTATATCGTTGAAAAACGAGAAACTACAAGAAAAGCTTACGCTACCATTACAAA

CAACTGCACTAAGAATACTTTCAAAATCGAAAATCTACAAGAAGGGTGTTCTTATTACTTCCGAGTCCTGGCTTCTAATGAATATGGGATTGGTTTGCCA

GCCGAAACAGCAGAGCCTGTCAAAGTGTCCGAACCACCACTCCCACCTGGAAGGGTAACCCTTGTAGATGTGACCCGTAATACAGCTACGATTAAGTGGG

AGAAGCCAGAGAGCGATGGCGGCAGCAAGATCACTGGTTATGTTGTGGAAATGCAGACAAAGGGCAGTGAAAAGTGGAGCGCATGCACACAAGTGAAGAC

TTTGGAGACAACTATATCTGGCCTAACTGCAGGGGAAGAGTATGTCTTCAGGGTAGCTGCAGTTAATGAAAAAGGAAGAAGCGACCCAAGACAGCTTGGG

GTGCCAGTCATTGCAAAAGACATTGAAATAAAGCCCTCCGTTGAGCTTCCTTTTAATACTTTCAACGTTAAGGCTAATGACCAACTCAAAATTGACATAC

CATTTAAAGGAAGACCTCAAGCTACCGTGGCCTGGAAAAAAGATGGTCAGGTCCTTAGAGAGACAACTAGAGTCAACGTAGCTTCCTCAAAGACCGTAAC

AACCCTATCTATTAAAGAAGCCTCAAGGGAAGATGTTGGAACTTACGAACTATGTGTTTCAAATACTGCTGGATCCATAACAGTTCCTATTACTGTCATT

GTCCTTGACAGGCCAGGACCTCCAGGACCCATACGAATTGATGAAGTTAGTTGTGACAATGTGTCTATTTCTTGGAATCCTCCAGAGTATGATGGTGGCT

GCCAAATTAGCAACTACATTGTTGAAAAGAGAGAAACCACTTCTACAACGTGGCAGGTAGTTTCACAAGCAGTGGCAAGAACATCCATTAAGATAGTCCG

TCTGACAACAGGAAGTGAGTATCAGTTCCGTGTCTGTGCAGAGAATCGGTATGGAAAGAGTTCCTACAGTGAGTCCTCAGCCGTTGTCGCTGAGTATCCA

TTCAGCCCTCCTGGGCCTCCTGGTACTCCTAAAGTTGTGCATGCCACAAAATCTACCATGGTTGTAAGCTGGCAAGTACCAGTTAATGACGGAGGGAGCC

AAGTGATTGGCTATCACCTTGAATACAAAGAAAGAAGCAGCATTCTCTGGTCAAAAGCAAACAAAGTCCTCATTGCAGATACTCAGATGAAGGTCTCTGG

TCTGGATGAGGGGCTGATGTACGAGTATCGTGTATATGCTGAGAATATCGCTGGAATTGGTAAATGCAGTAAAGCCTGTGAACCGGTCCCTGCAAGAGAC

CCTTGTGACCCTCCTGGACAACCTGAAGTCACCAATATCACAAGAAAATCAGTGTCACTTAAGTGGTCTAAACCACGTTATGATGGTGGAGCGAAGATCA

CCGGATACATTGTTGAACGCAGAGAGCTACCGGACGGCAGGTGGCTGAAGTGCAATTTCACCAACGTTCAGGAAACATACTTTGAAGTAACTGAGCTAAC

TGAAGACCAGCGTTATGAATTCCGGGTTTTTGCAAGAAATGCTGCTGATTCAGTCAGTGAGCCATCTGAATCCACTGGACCTATCACGGTGAAAGACGAC

GTTGAGGCGCCAAGAATTATGATGGATGTCAAATTCCGAGATGTCATCATTGTCAAGGCCGGAGAAGTCCTTAAGATAAATGCAGACATTGCAGGGCGAC

CTCTGCCGGTAATTTCCTGGGCCAAAGATGGGGTAGAAATTGAAGAAAGGGCAAAAACAGAAATTGTCTCAACAGACTATACTACCACATTAACAGTTAA

AGACTGTGTAAGAAGAGACACTGGGCAGTATGTCCTTACACTGAAGAATGTGGCAGGAACTCGGACTATGGCAGTTAACTGTAAAGTACTTGATAAGCCT

GGCCCGCCAGCAGGGCCACTTGAAATAAATGGCCTCACTGCTGAGAAGTGCTCCCTTTCCTGGGGACGTCCCCAGGAAGATGGCGGTGCAGATATTGATT

ATTATATCGTAGAAAAACGTGAAACAAGCCGCCTTGCATGGACCATATGTGAAGCAGAGTTAAGGACAACATCTTGTAAAGTGACCAAGCTACTCAAAGG

CAACGAATATATCTTCAGAGTAACTGGTGTTAATAAATATGGTGTTGGTGAGCCCTTGGAGAGCATGGCCGTGAAGGCGCTAGATCCATTCACCACTCCT

AGCCCACCCACATCTTTGGAAATTACATCTGTGACCAAAGATTCCATGACACTTTGCTGGTCAAGACCTGAGACTGATGGAGGCAGTGACATCTCTGGAT

ACATAATCGAAAGGCGTGAGAAAAACAGTCTACGGTGGATGCGTGTGAACAAGAAGCCAGTGTATGATCTGAGAGTGAAGTCCACAGGACTCCGAGAAGG

ATGTGAATATGAGTATCGGGTTTTTGCTGAAAATGCTGCCGGCCTGAGTCTTCCAAGTGAAACTTCTCCCTTGGTTCGAGCAGAAGACCCTGTGTTCTTG

CCATCTCCTCCATCTAAACCCAAAATAGTGGACTCGGGCAAGACAACAATCACCATTGGCTGGGTTAAACCTTTGTTTGACGGTGGGGCTCCAATAACGG

GATATACCGTAGAATACAAAAAGTCTGAGGAAACCGACTGGAAAGTTGCCATTCAGAGCTTCAGAGGCACAGAATACACAATGAGTGGGCTAACAACAGG

AGACGAGTATGTTTTTAGAGTGAGGTCACTCAATAAGATGGGTGCCAGTGACCCCAGTGATAGCTCCGATCCCCAGGTAGCCAAAGAGAGAGAAGAAGAA

CCTGTATTTGACGTTGACAGTGAGATGAGGAAGACCTTGATTGTCAAGGCTGGGTCCTCGTTTACCATGACAGTTCCTTTCAGAGGAAGACCAATCCCCA

ACGTCTCCTGGAGTAAGCCCGACACCGACCTCCGCACGAGAGCGTACATCGACTCCACAGATTCTCGTACATTACTTACTATTGAGAATGCCAACAGAAA

TGATTCTGGAAAATACACGCTGACAATTCAGAATGTGCTGAGCGCTGCTTCCATGACCTTCGTCGTCAAAGTCTTAGATTCCCCGGGGCCTCCAGCCAAT

ATTACTGTACGTGAAGTAACCAAGGAAACTGCTATGCTGTCCTGGGATGTTCCTGAAAATGATGGCGGAGCACCGGTGAAGAATTACCACATAGAAAAAC

GTGAGGCCAGCAAGAAGGCGTGGGTGTCGGTCACTAACAACTGCAACCGCCTCTCTTACAAAGTGACCAACTTACAGGAAGGAGCTATCTACTACTTCCG

AGTCTCTGGGGAGAACGAGTTTGGTGTTGGTGTGCCAGCTGAGACAAAGGAAGGAGTCAAAATAACAG AAAAACCAAGCCCACCAGAAAAGCTTGGTGT

AACAAGTGTATCCAAAGACAGTGTCTCATTGAGCTGGCTGAAGCCAGAACACGACGGTGGTAGCAGAATCATACACTATGTCGTCGAAGCACTTGAAAAA

GGACAGAAAACGTGGGTTAAGTGCGCTGTGGTGAAGACAACCCACCACGTTGTTTCCGGTCTGAGAGAGAGTCATGAGTACTTCTTCCGGGTCTTTGCAG

AAAACCAAGCTGGTCTGAGTGACCCCAGGGAGCTCCTGCTTCCTGTCCTCATCAAGGACCAGCTAG AACCACCCGAAATTGATATGAAGAATTTCCCAA

GTCACACTGTGTATGTAAGAGCTGGTTCCAACCTTAAAGTTGACATTCCAATTTCTGGAAAACCATTACCCAAAGTGACCTTATCAAGAGATGGTGTACC

ACTGAAGGCCACCATGAGATTTAATACTGAGATTACCGCTGAGAACCTGACCATCAATCTCAAAGAAAGTGTTACCACTGACGCTGGAAGATATGAGATC

ACTGCTGCCAACTCCAGTGGAACCACCAAAACTTTCATTAACATCATTGTGCTGGACAGGCCTGGACCCCCTACTGGCCCTGTAGCCATTAGTGATATAA

CTGAAGAAAGTGTGACTCTCAAATGGGAGCCACCAAAGTATGATGGCGGAAGCCACGTCACCAATTACATTGTCCTGAAGAGAGAAACAAGTACTGCAGT

GTGGTCTGAAGTGTCAGCAACAGTAGCAAGAACCATGATTAAAGTCATGAAACTAACCACAGGAGAAGAATACCAATTCCGCATCAAGGCAGAAAATCGC

TTCGGCATCAGTGATCATATAGATTCAGTGTGTGTGGTTGTCAAACTACCATACA CTACACCTGGACCACCATCTACACCCTGGGTATCTAACGTTACT

CGAGAAAGCATCACTGTGGGTTGGCACGAACCAGTGTCCAATGGAGGTAGTGCAGTCACGGGCTACCACCTGGAAATGAAAGACAGAAATAGTATTTTGT

GGCAGAAAGCCAACAAAATGATCATCCGTACAACTCACTTCAAAGTTACAACAATCAGCGCTGGACTTATTTATGAATTCAGGGTGTATGCAGAGAATGC

TGCTGGTATCGGAAAGCCCAGTCACCCATCTGAACCAGTCTTGGCCATTGATGCCTGCG AACCCCCAAGAAATGTGCGGATCACTGATATCTCAAAGAA

CTCTGTCAACCTTTCATGGCAACAACCAGCTTTTGATGGAGGAAGCAAGATTACAGGCTACATTGTTGAGAGGCGCGACCTTCCAGATGGGAGATGGACC

AAGGCTAGCTTCACCAATGTTATTGAGACTCAATTCACTGTCTCTGGATTGACTCAGAATTCCCAGTATGAATTCCGGGTCTTTGCTAGAAATGCTGTTG

GTTCTGTCAGCAACCCATCTGAGGTTGTAGGCCCCATCACATGCATTGACTCTTATG GTGGGCCTGTGATTGACTTGCCTCTAGAATATACAGAAGTTG

TCAAATATAGAGCAGGTACCTCCGTGAAGCTCAGAGCTGGTATTTCCGGCAAACCCGAGCCTACGATTGAGTGGTACAAAGATGATAAAGAATTACAAAC

CAATGCATTGGTGTGTGTGGAAAATAGCACTGACCTTGCATCTATACTCATCAAAGATGCCAACCGCCTTAACAGTGGAAGCTATGAGTTGAAACTGAGG

AATGCCATGGGTTCCGCCTCAGCCACCATCAGAGTACAGATCCTTG ACAAACCAGGACCTCCAGGCGGACCAATTGAATTTAAGACTGTCACTGCAGAA

AAGATAACTCTGCTCTGGAGGCCCCCAGCTGACGACGGTGGCGCAAAGATCACGCACTACATCGTGGAAAAACGGGAGACAAGCCGAGTCGTGTGGTCTA

TGGTGGCTGAAAATCTGGAAGAGTGCATCGTTACAACTACCAAAATTATCAAAGGGAATGAGTACGTCTTCCGAGTCCGAGCTGTGAATAAGTATGGAAT

TGGCGAGCCGCTAGAATCTGAGCCAGTTGTAGCCAAGAATGCCTTTG TTACACCTGGGCCTCCAAGCATCCCAGAGGTGACAAAGATTACCAAGAATTC

AATGACTGTTGTCTGGGACAGGCCAACTGTAGATGGTGGCAGTGAAATAAATGGCTATTTCCTTGAAAGACGAGACAAGAAGAGTCTAGCGTGGCTTAAA

GTATTAAAGGAGACTATTCGTGACACCAGACAAAAGGTGACAGGACTCACGGAAAACAGTGACTATCAGTATCGAGTCTGTGCTGTAAATGCTGCTGGAG

TGGGTCCATTCTCAGAACCATCCGACTTCTACAAGGCTGCTGATCCAATTG ATCCTCCAGGACCACCTGCCAAGATAAGAATTGCAGACTCGACCAAAT

CATCCATCACCCTTGGCTGGAGTAAGCCTGTCTATGATGGTGGCAGTGATGTTACTGGATATGTGGTTGAGATGAAACAAGGAGATGAAGAAGAATGGAC

CATTGTCTCTACCAGGGGAGAGGTCAGAACTACAGAATATGTGGTCTCTAACCTGAAACCCGGAGTCAATTATTATTTCCAAGTATCAGCAGTAAACTGT

GCCGGCCAAGGAGAACCTATAACAATGACTGAACCTGCACAGGCTAAAGATGTCCTTG AGGAACCAGAAATCGACCTAGATGTGGCTCTCAGAACATCT

GTTATAGCTAAAGCTGGTGAAGATGTCCAACTACTGATTCCCTTTAAAGGCAGACCGCCACCTACTGTCACCTGGAGGAAAGATGAGAAGAATCTTGGCA

GCGATACCAGATACAGCATCCAAAACACTGATTCGTCTTCTTTGCTTGTTATTCCTCAAGTCACTCGCAATGATACAGGAAAATACATCCTGACAATAGA

AAACGGAGTAGGCCAACCAAAGTCTTCCACCGTGAGTGTTAAGGTGCTCGACACACCAGCTGCCTGCCAGAAGTTACAGGTGAAACATGTTTCCCTAGGC

ACAGTCACATTGCTCTGGGATCCTCCTCTCATCGATGGAGGGTCTCCCATCATTAACTATGTCATCGAAAAGAGAGATGCCACGAAGAGAACATGGTCTG

TTGTGTCACACAAGTGTTCCGGCACATCCTTTAAAGTAACAGATTTATCAGAGAAGACTCCATTCTTCTTCAGGGTTCTTGCAGAAAATGAAATTGGCAT

TGGTGAGCCTTGCGAGACCACGGAGCCCGTGAAGGCTGCTGAGGTGCCAGCACCTATCCGAGATCTCTCAATGAAAGATTCCACAAAGACATCTGTTGTC

CTGAGCTGGACCAAGCCTGACTTTGATGGTGGGAGCATCATCACAGACTATCTGGTGGAACGGAAAGGCAAAGGTGAACAAGCATGGTCCCATGCTGGCA

TCAGTAAGACATGTGAGATTGAGATTGGACAACTTAAAGAGCAATCAGTCTTGGAATTCCGAGTGTCTGCTAGAAATGAGAAAGGACAGAGCGACCCTGT

CACTATTGGGCCACTTACAGTGAAGGAGCTTGTAATTACACCTGAAGTTGACTTGTCAGAAATCCCTGGGGCACAAATATCTGTGAGAATTGGACATAAC

GTACACCTTGAATTACCTTATAAAGGAAAACCCAAGCCATCCATCAGTTGGCTGAAAGATGGCTTGCCACTGAAGGAAAGTGAATATGTTCGTTTCAGTA

AGACAGAAAACAAAATCACCTTGAGTATTAAGAATTCGAAGAAAGAGCATGGAGGGAAATATACTGTTATTCTTGATAATGCAGTGTGTAGAAACTCATT

CCCCATTACAATCATCACCCTCGGCCCACCGTCAAAGCCCAAAGGACCCATTAGATTTGATGAAATCAAGGCTGACAGCGCCATCATGTCATGGGACATA

CCTGAAGATGACGGAGGAGGAGAAATCACCTGTTACAGCATTGAGAAGCGGGAAGCATCACAAACAAATTGGAAGATGGTGTGTTCAAGTGTTGCCAGAA

CAACTTTCAAAGTTTCCAATCTGGTCAAAGATTCTGAATACCAGTTTAGAGTTAGAGCAGAAAATAGATATGGAGTCAGTGAGCCACTTGCCTCAAATAT

CATCGTGGCAAAACACCAATTCAGGATTCCTGGTCCTCCAGGAAAGCCAGTCATCTACAATGTAACTTCGGATGGCATGTCACTAACTTGGGATGCACCA

GTTTATGATGGTGGTTCAGAAGTTACTGGATTCCATGTTGAAAAGAAAGAAAGAAACAGCATTCTTTGGCAAAGGGTTAACACATCACCAATATCTGGGA

GAGAATACAGAGCTACTGGCTTAATAGAAGGGCTGGACTATCAATTCCGTGTATATGCTGAGAATTCTGCTGGCCTGAGCTCACCTAGTGACCCAAGCAA

GTTTACATTAGCTGTTTCCCCAGTAG ACCCACCCGGCACTCCTGACTACATTGATGTCACCCGGGAAACCATCACACTTAAATGGAACCCACCATTACG

TGATGGGGGCAGTAAGATCGTGGCCTACAGCATTGAGAAGCGGCAAGGAAGTGACCGCTGGGTGAGATGCAACTTCACTGACGTCAGTGAGTGTCAGTAC

ACAGTTACGGGACTCAGTCCTGGAGATCGATATGAGTTCAGAATAATTGCAAGAAATGCTGTTGGCACTATAAGCCCCCCCTCACAGTCTTCTGGCCTCA

TTATGACAAGAGATGAAAACG TTCCACCAACAGTAGAATTTGGCCCTGAGTACTTCGATGGTCTTGTTATTAAGTCTGGAGACAGTCTTAGGATCAAAG

CTTTGGTTCAAGGACGACCGGTCCCACGAGTAACTTGGTTCAAAGATGGAGTTGAAATTGAGAGGAGAATGAACATGGAAATAACTGATGTTCTTGGCTC

TACCAGCCTCTTTGTCAGAGACGCAACTCGAGATCACCGTGGTGTTTACACCGTGGAAGCCAAAAATGTATCTGGTTCCACAAAAGCAGAAGTTACAGTG

AAAGTACAAG ATACACCAGGAAAAGTAGTCGGGCCAATAAGATTTACTAATATTACTGGTGAAAAGATGACCCTGTGGTGGGAGGCACCTCTCAATGAC

GGCTGCGCTCCTGTCACGCACTACATCATTGAAAAGCGTGAAACCAGCAGACTTGCTTGGGCATTGATTGAGGATAATTGCGAAGCCCTAAGTTACACTG

CCATTAAACTAATCACTGGCAATGAGTATCAGTTCCGGATTTCTGCAGTTAACAAGTTTGGTGTTGGCAGGCCACTTGAGTCCGACCCCGTGGTTGCTCA

AATACAATACA CCATTCCAGATGCTCCCGGAGTTCCAGAACCTAGCAATGTCACAGGCAACAGCATTACCCTGACTTGGACGAGGCCAGAATCAGATGG

TGGCAGTGAGATTCAACACTACATCCTTGAAAGGAGAGAAAAGAAAAGCACAAGATGGGTAAAAGTGATCAGCAAACGACCAATCTCTGAGACAAGGTTC

AAAGTCACAGGTCTGGTGGAAGGCAACGAGTATGAGTTCCATGTCATGGCTGAAAACGCTGCGGGCATAGGACCAGCAAGTGGGATCTCAAGACTCATTA

AATGCAGAGAGCCTGTTAACCCACCAAGTGCCCCCTCGGTAGTCAAAGTGACAGACACATCAAAGACAACTGTGAGCTTGGAATGGGCCAGGCCAGTCTT

TGACGGCGGGATGGAGATAATTGGATACATAATAGAAATGTGCAAAGCTGACTTAGGGGACTGGCACAAAGTAAACACAGAGCCATGTGTGAAAACAAGA

TACACGGTCACTGATCTACAGGCTGGTGAAGAATACAAATTCCGGGTCAGTGCGGTCAATGGTGCTGGGAAAGGAGACAGCTGTGAGGTGACCGGCACAA

TAAAAGCAGTCGATCGGTTATCAGCTCCCGAGTTAGACATTGATGCAAACTTCAAGCAGACTCACATTGTTAGAGCGGGAGTTAGCATTCGTCTCTTCAT

TGCCTACCAGGGTAGACCCACTCCTACAGCAGTATGGAGCAAGCCTGACTCTAACCTTAGCATCCGGGCTGATATCCACACAACAGACTCCTTCAGCACC

CTCACCGTGGAAAACTGCAACAGAAATGATGCAGGGAAATACACACTCACGGTAGAAAACAACAGCGGTAAGAAGTCGATAACATTCACTGTAAAGGTGC

TGGACTCTCCAGGACCACCTGGTCCCATTACCTTCAAAGATGTGACCCGGGGATCTGCTACACTGATGTGGGACGCCCCTCTCCTTGATGGTGGTGCCCG

GATCCATCACTATGTGATAGAGAAGCGGGAAGCGAGTCGCCGTAGCTGGCAGGTTGTCAGTGAAAAATGCACTCGCCAGATCCTCAAGGTGAGTGAGCTG

ACAGAAGGTGTTCCGTACTATTTCCGTGTTTCTGCTGAAAATGAGTACGGTGTTGGTGAACCCTATGAAATGCCAGAACCAATTGTAGCCACAGAACAGC

CCGCTCCACCTAGGAGGCTTGATGTCGTTGACACTAGCAAATCCTCTGCGGTCCTAGCCTGGCTTAAACCCGATCATGATGGAGGTAGTCGGATCACTAG

CTACCTGCTTGAAATGCGACAAAAGGGATCTGACTTCTGGGTTGAAGCTGGTCACACCAAACAGCTGACTTTCACAGTGGAGCGCCTCGTTGAGAATACT

GAATATGAATTCCGGGTGAAAGCCAAGAACGACGCTGGCTACAGTGAACCCAGGGAAGCCTTCTCATCTGTCATTATCAAGGAGCCTCAAATTGAGCCCA

CTGCTGATCTCACTGGAATCACCAATCAGCTCATCACTTGCAAAGCAGGAAGCACATTTACCATTGACGTGCCAATCAGTGGTCGTCCTGCCCCCAAAGT

AACATGGAAGCTAGAAGAAATGAGACTCAAGGAGACAGATCGAATGAGTATCGCAACAACAAAAGACAGGACCACCCTGACTGTAAAGGACAGTATGAGA

GGTGACTCTGGCAGATACTTCCTGACCCTAGAAAACACAGCCGGTGTTAAAACATTTACTATCACAGTTGTGGTCATTGGAAGACCAGGGCCAGTAACTG

GTCCCATTGAGGTCTCATCTGTCTCGGCTGAATCATGTGTCCTATCATGGACTGAACCAAAAGACGATGGAGGCACTGAAATTACAAATTATATAGTTGA

AAAGCGCGAGTCGGGTACCACCGCCTGGCAGCTTATCAATTCTAGTGTGAAGCGCACGCAGATTAAAGTCACACACCTCACAAAATACAAAGAATACTGT

TTCCGGGTCAGCTCAGAGAATAGATTCGGGGTCAGCAAGCCTCTGGAATCAGTGCCAATAGTTGCTGAACATCCATTTG TTCCACCAAGTGCTCCTACC

AGGCCTGAGGTCTACTATGTGTCTGCCAATGCTATGTCAATTCGTTGGGAAGAACCCTACCATGATGGCGGTAGTAAAATCGTTGGCTACTGGGTTGAGA

AGAAAGAACGTAACACCATTCTTTGGGTGAAAGAAAACAAAGTGCCGTGCTTAGAGTGTAACTACAAAGTGACAGGCTTGGTAGAAGGACTGGAGTATCA

GTTCCGAACATATGCACTCAATGCTGCGGGCGTCAGCAAGGCCAGTGAAGCTTCAAGACCTATCATGGCTCAAAATCCAGTTG ATCCACCTGGTAGGCC

AGAAGTGACAGATGTCACAAGATCAACAGTGTCACTAATTTGGTCTGCCCCAGTGTATGACGGAGGCAGCAAAGTTGTGGGCTACATCATAGAACGGAAG

CCAGTCAGTGAAGTTGGAGATGGTCGCTGGCTGAAGTGCAACTATACCATTGTCTCTGATAATTTCTTCACTGTGACCGCTCTCAGCGAAGGGGACACTT

ATGAATTCCGTGTGTTGGCCAAGAACGCAGCAGGCGTAATTAGCAAAGGCTCTGAATCTACAGGCCCTGTAACTTGCCGAGATGAATATG CTCCACCAA

AAGCTGAATTGGATGCCAGGTTACAAGGCGATCTGGTGACCATCAGAGCAGGTTCAGATCTTGTTCTTGATGCTGCTGTTGGTGGCAAACCTGAACCCAA

AATCATCTGGACCAAAGGAGACAAGGAACTGGATCTCTGTGAAAAAATTTCTCTACAGTACACTGGCAAGCGAGCCACTGCTGTGATCAAATACTGTGAC

CGGAGTGACAGTGGGAAATACACACTGACAGTGAAGAACGCTAGTGGGACCAAGTCCGTATCTGTCATGGTCAAAGTTCTTG ATTCTCCTGGCCCATGT

GGAAAACTCACTGTCAGCAGAGTGACCGAGGAGAAGTGCACCTTAGCCTGGAGCCTTCCACAGGAAGATGGAGGAGCAGAGATAACTCACTATATTGTAG

AGAGACGGGAGACTAGCAGGCTCAATTGGGTGATCGTGGAAGGGGAATGCCTGACCGCATCCTACGTGGTTACCAGACTCATCAAGAACAATGAATACAC

ATTCCGCGTGAGGGCAGTGAACAAGTACGGCCTCGGCGTGCCAGTTGAGTCAGAGCCTATTGTGGCCAGAAACTCTTTCA CGATTCCATCACAACCTGG

CATACCAGAAGAAGTTGGGGCTGGCAAAGAGCACATCATTATTCAGTGGACGAAACCTGAATCTGATGGTGGCAATGAAATCAGCAACTACCTCGTCGAC

AAACGGGAGAAGAAAAGCTTGCGCTGGACCCGTGTCAACAAAGACTACGTGGTGTACGACACCAGGCTGAAGGTGACCAGCCTCATGGAAGGCTGTGATT

ATCAGTTCCGAGTGACTGCCGTGAACGCTGCTGGCAACAGTGAGCCCAGTGAAGCTTCAAACTTCATCTCATGCAGAGAGCCATCAT ACACCCCTGGGC

CACCTTCTGCTCCAAGAGTTGTGGATACCACCAAGCGCAGCATTAGTTTGGCATGGACCAAGCCCATGTACGACGGTGGTACTGACATCATAGGATACGT

CCTTGAAATGCAAGAGAAGGACACAGATCAATGGTGCCGAGTACATACAAACGCCACGATAAGAAACAACGAATTCACTGTGCCTGACCTTAAGATGGGC

CAGAAGTACTCCTTCAGGGTTGCTGCTGTGAACGCCAAGGGTATGAGTGACTACAGTGAGACGACTGCTGAAATTGAGCCCGTGGAAAGACTAG AAATA

CCAGATCTTGAGCTTGCAGATGATCTGAAGAAGACCGTGATTGTCAGGGCTGGAGCCTCCTTGCGCCTGATGGTGTCTGTCTCTGGAAGACCTTCTCCTG

TCATCACGTGGAGCAAAAAAGGCATTGACCTTGCAAATCGGGCAATTATTGACAACACAGAGAGCTACTCTTTACTCATTGTAGACAAAGTTAATCGGTA

TGATGCTGGAAAATACACAATTGAAGCTGAAAATCAGTCTGGCAAGAAATCAGCAACGGTCCTAGTTAAAGTCTATG ATACTCCTGGTCCCTGCCCTTC

AGTGAGCGTTAAAGAAGTTTCGAGAGATTCTGTGACCATCACTTGGGAAATCCCCACAATTGATGGTGGTGCTCCGGTCAACAATTACATTATTGAGAAG

CGAGAAGCCGCCATGAGGGCATTCAAGACAGTAACCACCAAATGCAGCAAGACTCTTTACCGCATATCTGGACTCGTCGAGGGAACCATGTACTACTTTA

GAGTGCTTCCAGAAAACATCTATGGCATCGGAGAGCCTTGCGAAACATCAGACGCAGTTCTAGTCTCAGAAGTACCTTTGGTGCCCACAAAACTAGAAGT

GGTTGATGTCACCAAATCCACTGTGACCCTTGCTTGGGAGAAACCACTCTATGACGGTGGAAGCCGACTCACCGGATATGTTCTTGAGGCCTGCAAAGCC

GGCACCGAGAGATGGATGAAAGTTGTCACTTTGAAACCCACAGTCTTAGAGCACACTGTTATTTCCCTGAATGAAGGCGAGCAGTACTTGTTTAGAGTGA

GGGCTCAAAATGAGAAAGGTGTGTCAGAACCGAGAGAGATCGTCACACCAGTGACAGTACAAGACCTCAGAG TGTTGCCAACGATTGACCTTTCCACAA

TGCCCCAAAAGACCATCCATGTCCCAGCTGGCAGACCAATTGAGCTGGTGATACCGATCACTGGTCGGCCGCCACCTACTGCTTCCTGGTTCTTTGCTGG

TTCTAAACTGAGAGAATCAGAGCGTGTCACAGTTGAAACCCACACTAAAGTCACCAAGCTAACCATCCGTGAAACTACTATAAGAGATACGGGAGAATAT

ACGCTTGAACTAAAGAATGTTACTGGAACCACCTCAGAGACAATAAAAGTTATTATTCTTG ACAAGCCTGGTCCACCAACTGGGCCCATCAAGATTGAT

GAAATTGATGCCACGTCAGTTACGATATCCTGGGAACCTCCCGAATTGGATGGTGGTGCTCCACTGAGTGGCTATGTGGTAGAGCAGCGTGATGCTCATC

GTCCAGGATGGCTGCCAGTTTCTGAGTCTGTAACAAGACCAACGTTTAAGTTTACCAGACTCACCGAAGGAAATGAATACGTGTTCCGCGTGGCTGCAAC

AAACCGCTTCGGGATTGGCTCGTACTTGCAGTCTGAGGTCATAGAATGCCGAAGCAGCATCA GTATTCCTGGACCTCCAGAAACATTACAGATATTTGA

TGTCTCCCGTGATGGCATGACACTTACATGGTATCCACCTGAAGATGATGGTGGCTCCCAAGTGACTGGATATATCGTGGAACGTAAAGAAGTAAGAGCT

GATCGGTGGGTCCGTGTAAATAAAGTACCAGTGACTATGACCCGGTACCGCTCCACCGGCCTTATTGAAGGCTTAGAATATGAACATCGGGTCACAGCCA

TTAATGCAAGAGGAACTGGAAAACCAAGTCGTCCTTCCAAACCCACCGTTGCCATGGATCCAATTG CTCCACCAGGAAAACCACAAAATCCAAGAGTTA

CAGATACAACAAGGACTTCAGTCTCCCTGGCCTGGAGTGTTCCGGAAGATGAAGGTGGATCTAAAGTCACAGGGTACTTGATCGAAATGCAAAAAGTAGA

TCAACGTGAATGGACCAAATGTAACACCACCCCAACCAAGATTCGGGAGTATACCCTAACACACCTACCTCAGGGCGCTGAATACAGATTCCGTGTCCTA

GCCTGTAATGCTGGTGGACCTGGAGAACCTGCTGAGGTACCAGGAACCGTCAAAGTCACAGAGATGCTGG AATACCCTGACTATGAACTTGATGAGAGA

TACCAGGAAGGTGTCTTTGTTCGACAAGGTGGGGTCATCAGGCTTACCATCCCAATCAAAGGAAAACCATTCCCAGTATGTAAATGGACCAAGGAAGGCC

AAGACATTAGTAAGCGTGCCATGATTGCAACATCGGAAACACATACTGAGCTTGTGATCAAAGAAGCAGACAGAAACGATTCTGGAACTTACGACTTGGT

TCTGGAAAACAAATGTGGCAAGAAGACCGTTTACATTAAGGTCAAGGTGATAGGAAGTCCCAACACTCCAGAAGGGCCACTGGAATACGATGACATACAA

GCCCGCTCTGTAAGGGTCAGCTGGAGACCTCCTGCTGACGATGGTGGTGCTGACATCCTGGGCTACATCCTTGAGAGAAGAGAGGTACCTAAGGCTGCCT

GGTATACCATTGACTCCAGAGTCCGAGGCACATCTCTGGTGGTGAAAGGCCTCAAAGAAAACGTGGAATACCATTTCCGTGTCTCAGCAGAAAACCAGTT

TGGCATAAGCAAACCCTTGAAATCTGAGGAGCCAGTCATACCAAAGACACCACTGA ATCCACCAGAACCACCAAGCAATCCTCCTGAAGTACTTGATGT

GACCAAAAGTTCCGTTAGCTTGTCATGGTCTCGACCTAAAGATGACGGCGGCTCTCGAGTGACGGGCTACTACATTGAGCGCAAGGAGACATCCACTGAC

AAGTGGGTCAGACACAACAAAACCCAGATAACCACCACGATGTACACTGTCACCGGCCTCGTTCCCGATGCTGAGTACCAGTTCCGCATCATCGCACAGA

ATGACGTTGGCCTTAGTGAGACCAGCCCTGCTTCTGAACCTGTTGTTTGCAAAGATCCCTTTG ATAAGCCAAGCCAACCAGGAGAACTTGAGATTCTCT

CGATATCCAAAGACAGTGTCACCCTCCAGTGGGAGAAACCCGAATGTGATGGTGGCAAAGAAATCCTTGGATACTGGGTTGAATACAGACAGTCTGGAGA

CAGTGCTTGGAAGAAGAGCAATAAGGAACGGATCAAGGACAGACAGTTCACCATCGGCGGTTTGCTAGAAGCTACTGAATATGAGTTCCGAGTATTTGCT

GAGAACGAGACTGGGCTCAGCCGACCACGTAGAACAGCTATGTCTGTCAAGACTAAACTAACAT CTGGAGAAGCCCCAGGAGTGCGCAAAGAAATGGCT

GATGTGACCACCAAATTAGGTGAAGCTGCACAACTCTCATGCCAGATAGTTGGAAGGCCCCTTCCTGACATTAAATGGTACCGGTTTGGTAAAGAGCTCA

TACAAAGCCGGAAGTACAAAATGTCCTCAGATGGGCGCACGCATACTCTGACAGTAATGACAGATGAACAAGAAGATGAAGGTGTTTATACATGTGTAGC

CACAAATGAAGTAGGAGAAGTAGAAAGCAGCAGCAAGCTTCTTCTGCAAGCGGCACCACAGTTCCATCCTGGTTACCCACTGAAAGAGAAGTATTACGGG

GCCGTGGGGTCTACGCTTCGGCTCCACGTTATGTATATTGGCCGCCCAGTACCTGCCATGACTTGGTTCCATGGCCAGAAACTTTTGCAAAACTCAGAAA

AAATCACCATTGAAAACACTGAGCACTATACTCACCTTGTCATGAAGAATGTCCAACGAAAGACTCATGCTGGGAAATACAAGGTTCAGCTCAGCAATGC

CTTTGGGACAGTGGATGCCACCCTAGATGTGGAAATACAAG ATAAACCAGACAAGCCTACTGGACCCATTGTGATTGAAGCACTACTCAAGAACTCGGT

GGTGATCAGCTGGAAACCACCTGCTGATGATGGCGGCTCCTGGATCACCAATTACGTGGTAGAGAAATGTGAGGCCAAAGAAGGTGCTGAATGGCAATTG

GTGTCTTCAGCCATCTCGGTGACAACCTGCAGAATTGTGAACCTCACAGAGAATGCCGGCTACTATTTCCGGGTCTCAGCTCAGAACACCTTTGGCATCA

GTGAGCCACTAGAGGTCGCCTCCATTGTGATCATCAAGAGTCCATTCG AAAAGCCAGGTGTTCCTGGTAAACCAACCATCACTGCTGTCACAAAGGATT

CTTGTGTTGTGGCTTGGAAGCCACCTGCAAGCGATGGCGGTGCAAAGATCAGAAATTACTACCTTGAGAGGCGCGAGAAGAAGCAAAACAAGTGGATTGC

TGTGACGACAGAGGAAATTCGAGAAACCGTCTTCTCAGTGCAAAACCTTATTGAAGGTCTTGAATATGAGTTCCGTGTGAAATGTGAAAACCTGGGTGGA

GAGAGTGAATGGAGTGAAATATCAGAACCCGTCACTCCAAAATCCGACGTCCCGATTCAGGCTCCACACTTCAAGGAGGAGCTGAGAAACCTGAATGTAA

GGTATCAGAGCAACGCCACTCTGGTCTGCAAGGTGACCGGTCACCCAAAGCCTATTGTGAAATGGTACAGACAAGGCAAAGAAATTATCGCCGATGGACT

CAAGTACAGGATTCAAGAATTTAAGGGCGGTTACCACCAGCTCATCATTGCAAGCGTCACAGATGATGATGCCACGGTGTACCAAGTCAGAGCCACCAAC

CAAGGGGGCTCCGTGTCTGGCACTGCTTCCTTGGAAGTGGAAG TTCCAGCTAAGATACACTTGCCCAAGACTCTCGAAGGCATGGGAGCGGTCCATGCT

CTCCGAGGGGAAGTGGTTAGCATCAAGATCCCCTTCAGTGGTAAGCCAGACCCCGTGATCACCTGGCAGAAAGGACAAGATCTCATCGACAATAATGGCC

ACTACCAAGTGATTGTCACAAGATCCTTCACGTCACTTGTCTTCTCCAATGGAGTGGAGAGAAAAGATGCTGGCTTCTATGTCGTCTGTGCTAAAAACAG

ATTTGGAATTGATCAAAAGACAGTCGAACTGGATGTGGCTGATGTCCCCGACCCACCCAGGGGTGTCAAAGTTAGTGACGTCTCACGCGATTCTGTCAAC

TTAACATGGACAGAGCCAGCTTCTGATGGTGGTAGCAAGGTCACCAACTACATCGTGGAAAAGTGTGCAACTACTGCAGAAAGATGGCTCCGAGTGGGAC

AGGCCCGAGAAACCCGTTACACTGTGATCAACTTGTTTGGAAAAACAAGTTACCAGTTCCGAGTAATAGCTGAAAATAAATTTGGCCTGAGCAAGCCATC

AGAGCCCTCAGAACCAACCGTTACCAAAGAAGATAAGACCAGAGCTATGAATTATGATGATGAGGTGGATGAAACCAGAGAGGTCACCACGACTAAAGCA

TCACACTCCAAAACTAAAGAACTCTACGAGAAATACATGATAGCTGAAGATCTGGGGCGTGGTGAGTTTGGAATTGTCCACCGTTGCGTTGAAACATCCT

CAAAGAGGACATTCATGGCCAAATTTGTTAAAGTCAAAGGAACCGATCAGGTTTTAGTCAAGAAAGAGATTTCCATTCTAAACATTGCTAGGCACAGGAA

CATCTTATACCTCCATGAATCATTTGAAAGCATGGAAGAGTTAGTTATGATCTTTGAATTTATATCAGGACTCGACATATTTGAACGCATCAACACGAGC

GCCTTTGAGCTTAATGAAAGAGAAATTGTAAGCTATGTCCGCCAAGTCTGCGAAGCACTGGAGTTCTTACATAGCCAGAATATTGGCCACTTTGACATTC

GACCAGAAAATATCATTTACCAGACAAGAAAGAACTCCACTATTAAAATAATAGAGTTTGGTCAAGCCCGTCAGCTGAAGCCAGGAGACAACTTTAGGCT

GCTGTTCACTGCCCCTGAATACTATGCCCCTGAAGTCCACCAGCATGATGTTGTCAGCACTGCCACAGACATGTGGTCGCTTGGTACATTGGTGTATGTG

CTACTGAGTGGAATCAACCCATTTTTGGCTGAAACTAACCAACAGATGATTGAGAACATCATGAACGCTGAATATACTTTTGATGAAGAAGCCTTCAAAG

AAATTAGCCTTGAAGCGATGGATTTTGTCGACCGGCTATTGGTGAAAGAGCGAAAATCTCGCATGACAGCATCAGAGGCCCTGCAGCACCCATGGCTGAA

GCAAAGGATCGACAGAGTCAGTACTAAAGTCATCAGAACACTGAAACACCGGCGGTACTACCACACCCTGATAAAGAAAGACCTCAATATGGTTGTATCA

GCAGCCCGGATCTCCTGTGGTGGTGCAATACGATCTCAGAGGGGAGTGAGCGTGGCTAAAGTTAAAGTTGCATCCATTGAAATTGGTCCGGTCTCTGGGC

AAATAATGCACGCCATTGGCGAAGAAGGCGGGTATGTCAAATATGTTTGCAAGATCGAAAATTATGATCAGTCTACCCAGGTGACCTGGTACTTTGGCGT

GAGACAGCTGGAAAACAGTGAGAAATATGAAATCACCTATGAAGATGGAGTGGCCACCATGTATGTCAAAGACATCACCAAATTTGATGATGGGACCTAC

AGATGCAAAGTCGTCAATGACTACGGTGAAGATAGCTCTTACGCAGAGCTGTTCGTTAAAGGAGTGAGGGAAGTTTATGACTACTATTGCCGCCGAACCA

AGAAAGTCAAGCGCAGAACAGATGCGATGCGGCTCCTTGAAAGGCCACCAGAATTTACCCTGCCTCTCTATAACAAGACGGCATACGTGGGTGAAAATGT

CCGTTTTGGAGTAACTATTACCGTCCACCCAGAACCTCGTGTGACGTGGTATAAATCAGGTCAGAAAATCAAGCCAGGTGATGATGAAAAGAAATACACA

TTCGAGTCTGACAAGGGTCTTTATCAATTAACAATCAACAGCGTGACCACAGACGATGATGCTGAATACACCGTTGTGGCAAGGAACAAACATGGTGAAG

ACAGCTGTAAAGCAAAGCTGACGGTGACTTTACATCCACCCCCGACGGAAACCACGCTCAGACCCATGTTCAAGCGGCTGCTGGCAAATGCCGAATGCCA

TGAAGGCCAAAGTGTCTGCTTTGAGATCAGAGTTTCTGGCATCCCTGCACCAACATTAAAATGGGAGAAGGATGGCCAGCCGCTGTCCCTCGGGCCCCAC

ATTGAAATTGTCCATGAAGGCTTAGATTATTATGCACTGCATATCAGGGACACTTTGCCGGAAGACACAGGTTATTACAGAGTCACGGCCACAAACACGG

CCGGATCCACCAGCTGCCAGGCTCACTTACAGGTAGAGCGGTTGCGCTACGTAAAGCAGGAATTCCAGAGTAAAGAGGAACGTGAGCGCCATGTCCAAAA

ACAGATTGACAAGACACTGAGGATGGCTGAAATCCTTTCTGGAACTGAAACTGTGCCATTGACTCCCGTAGCCCAAGAGGCTCTGCGAGAAGCTGCCATT

CTTTACAAACCAGCAGTGAGCACCAAGACTGTCAAAGGAGAATACCGACTTCAGACGGAGGAAAAGAAAGAGGAGAGAAAACTCCGCATGCCTTACGAAG

TCCCAGAGCCCCGCAGGTTCAAACAAGCCACAGTAGAAGAAGACCAGCGCATCAAGCAGTTCGTGCCTATGTCTGACATGAAGTGGTATAAGAAGATCCG

GGATCAATATGAAATGCCTGGGAAACTTGACAGAGTTGTCCAGAAAAGGCCCAAGCGCATCCGCCTTTCAAGATGGGAACAGTTCTATGTGATGCCTCTT

CCTCGCATTACTGACCAATACCGACCTAAATGGCGGATCCCCAAACTGACCCAAGACGATCTGGAAATGGTGAGGCCGGCCCGACGGCGTACCCCTTCCC

CAGATTATGATCTTTACTATTATAGAAGGAGGAGACGCTCTCTGGGTGACATGTCAGATGAGGAACTGCTCCTCCCCATTGATGACTACCTGGCGATGAA

GAGAACCGAGGAAGAGAGGCTGCGTCTGGAGGAGGAGCTTGAACTGGGCTTCTCGGCTTCACCTCCCAGCCGAAGCCCCCCGAGGTTTGAGCTGTCTAGC

CTGCGCTATTCTTCACCGCCAGCTCATGTCAAGGTGGAAGACAGAAGAAGAGACTTCAGGTACTCGACCTATCACGTCCCCACAAAGGAGGAAACCAGCA

CGAGTTATGCAGAGCTGCGGGAACGGCATGCCCAGGCCTCATACAGGCAGCCGAAGCTACGGCAGAGAATCATGGCCGAGAAGGAGGAAGAGGAGCTACT

GCGGCCAGTGACAACCACCCAGCGTCTCTCAGAATACAAGAGTGAGCTGGACTACATGTCAAAAGAAGAAAAGTCTAAAAAGAAATCAAAACGACAGAGA

CAAGTGACAGAAATAACGGAAATCGAAGAGGAATACGAAATCTCAAGACGGGCTCAAAGGGAATCATCCTCCTCCGTGTCCAGACTACTGAGACGCCGTC

GCTCCTTGTCTCCAACTTATATTGAGTTAATGAGACCAGTGTCTGAGCTGATTCGGTCCCATCCACGACCTGCTGAGGAATATGAAGATGATGCAGAAAG

AAGGTCTCCTACTCCAGAGAGAACTCGCCCACGTTCTCCCAGCCCTGTGTCTAGCGAGCGATCCCTCTCAAGATTTGAGAGGTCTGCAAGATTTGACATC

TTCTCCAGGTACGAGTCCATGAAAGCTGCCTTAAAAACTCAGAAGACATCGGAAAGGAAGTATGAGGTTTTGAGTCAGCAGCCTTTCACACTGGACCATG

CCCCTCGAATCACACTGCGGATGCGCTCCCACAGGGTTCCCTGTGGCCAAAACACACGCTTCATCCTAAACGTCCAGTCGAAGCCGACTGCCGAAGTTAA

ATGGTACCACAATGGTGTAGAACTCCAAGAGAGCAGTAAGATTCATTACACCAACACAAGTGGGGTCCTGACCTTGGAGATTCTGGACTGCCAGACTGAG

GACGGTGGAACCTACCGTGCCGTGTGCACCAACTACAAAGGAGAGGCATCAGACTACGCAACCCTGGATGTAACTGGCGGAGCTTATACCACCTATGCAT

CCCAGCGCAGAGATGAGGAGGTCCCCAAGTCAGTCTTCCCTGAACTGACAAAAACAGAGGCATATGCAGTCTCGTCGTTCAAGAGAACATCTGAGCTGGA

AGCTGCTTCTTCAGTCAGGGAAGTGAAGTCACAAATGACAGAGACGAGGGAAAGTCTCTCAACCTATGAGCATTACGCCTCTGCGGAAATGAAAAGCGCC

ACATCAGAGGAAAAGTCACTGGAAGAAAAAGCCACGGTGAGAAAGATTAAGACAACACTGGCAGCAAGAATTTTAACCAAGCCACGCTCCATAACTGTCC

ATGAAGGTGAGTCTGCGAGGTTTTCCTGCGACACTGATGGGGAGCCGGTACCAACAGTGACCTGGCTGCGTGAAGGACAAGTGGTGAGTACTTCTGCTCG

CCACCAAGTGACCACCACCAAGTACAAGTCGACCTTTGAGATTTCTTCAGTTCAGGCCTCTGATGAGGGCAACTACAGCGTGGTAGTTGAAAACAGCGAT

GGGAAGCAAGAAGCACAGTTCACCCTGACCGTGCAAAAGGCCAGGGTTATTGAAAAGGCTGTGACGTCACCACCCAGAGTCAAGTCCCCAGAGCCTCGGG

TGAAGTCCCCAGAAACAGTGAAGTCTCCCAAAAGAGTGAAATCTCCAGAACCAGTAACTTCTCATCCAAAAGCCGTGTCACCCACAGAGACAAAGCCAAC

AGAGAAGGGTCAACATCTCCCAGTCTCTGCCCCACCAAAGATAACTCAGTCCCTGAAAGCAGAAGCTTCTAAAGACATTGCAAAGCTGACCTGTGCGGTT

GAAAGTAGTGCACTGTGTGCAAAAGAGGTCGCCTGGTATAAAGATGGCAAGAAACTCAAGGAAAATGGGCATTTTCAATTTCATTACTCAGCAGATGGGA

CCTACGAACTCAAAATTCACAACCTTAGCGAATCTGATTGCGGAGAGTATGTTTGTGAGGTCTCTGGTGAAGGAGGAACTTCCAAAACCAGCTTCCAGTT

TACTGGACAATCCTTCAAGAGTATCCATGAGCAGGTGTCAAGCATATCAGAAACTACAAAATCGGTTCAGAAAACTGCTGAGTCAGCAGAAGCCAAGAAA

TCC GAACCAATAGCTCCTGAATCAATTTCCTCAAAGCCAGTAATTGTTACTGGGCTGCGGGATACAACAGTTTCTTCAGACAGTGTTGCTAAATTTACA

ATTAAAGTTACTGGAGAGCCCCAGCCAACTATCACCTGGACAAAGGATGGAAAG GCTATTGCACAAGGCAGTAAATACAAACTCTCTAGCAACAAAGAA

GAATTCATCTTAGAAATCCTCAAGACCGAGACATCTGATGGCGGACTTTACGCCTGTACAGTAACAAATTCTGCTGGATCTGTGTCCTCGAGCTGCAAGC

TGACAATAAAAG CTGTAAAAGACACCGAGGCACAGAAAGTATCTACCCAGAAGACCTCCGAAGTCACATCTCAGAAGAAAGCGAGTGCCCAAGAGGAAA

TTTCTCAAAAAGCCCTAACTTCTGAAGAAATCAAAATGTCAGAAGTAAAATCTCATGAAACGCTGGCCATCAAGGAGGAAGCGTCCAAAGTTCTGATTGC

TGAGGAGGTCAAGAGGTCAGCAGCAGCCTCCCTGGAGAAATCCATCGTCCATGAAGAAGTCACCAAAACCTCACAGGCATCCGAAGAAGTCAAAACTCAC

GCGGAGATCAAAACACTGTCTACCCAGATGAACATAACCAAGGGCCAGCGAGCGACCCTGAAAGCCAACATTGCTGGGGCCACAGATGTGAAATGGGTCC

TGAACGGCACTGAGCTTCCGAACTCAGAGGAATACAGATACGGGGTATCTGGCAGTGACCAAACTCTCACCATCAAACAAGCCAGTCACAGAGAGGAAGG

GATCCTCAGCTGCATAGGCAAAACCAGCCAGGGAGTTGTCAAGTGTCAGTTTGACTTGACCCTGAGTGAAGAACTCTCGGATGCTCCAAGCTTCATCACA

CAGCCCAGATCTCAAAACATTAACGAGGGACAAAATGTTCTCTTTTCTTGTGAGGTCAGCGGGGAGCCGTCCCCTGAAATTGAGTGGTTTAAAAATAACC

TTCCA ATTTCCATTTCTTCAAATATCAGTGTGAGTCGCTCCAGAAACGTGTACACTCTTGAAATCCGAAATGCGGCTGTAAGTGACAGCGGAAAGTACA

CAATTAAGGCTAAGAATTTCCACGGCCAGTGCTCTGCAACAGCGTCCCTCACAGTGCTCC CTCTGGTGGAAGAACCACCGAGAGAGGTGGTATTGAAAA

CGAGCAGTGACGTGAGCTTGCACGGAAGCGTCTCGTCTCAGTCAGTCCAAATGTCTGCCTCTAAGCAGGAGGCATCCTTCAGCAGCTTCAGCAGCAGCAG

CGCTAGCAGCATGACTGAAATGAAGTTTGCGAGCATGTCTGCCCAAAGCATGTCTTCCATGCAAGAGTCCTTTGTAGAAATGAGTTCCAGCAGTTTTATG

GGAAAATCTAGCATGACACAACTGGAAAGCTCAACCAGTAGAATGCTCAAAGCAGGCGGAAGAG GAATTCCACCTAAAATTGAAGCTCTTCCCTCTGAT

ATCAGCATCGACGAAGGCAAAGTCCTAACAGTAGCCTGTGCCTTTACTGGGGAGCCTACTCCAGAAATAACATGGTCCTGTGGTGGAAGGAAAATCCAAA

ACCAAGAACAACAAGGAAGATTCCACATTGAAAACACAGATGACCTGACCACCCTGATCATCATGGACGTACAGAAACAAGATGGCGGACTTTATACCCT

AAGCTTAGGGAATGAATTTGGATCTGACTCTGCCACTGTGAATATTAATATCCGTTCTATGTAAGAGGGCCAGGGCCAAGAGCGGGGGCCCTTTACACTC

GATGCTCATTCATAATCTCTCTCAAATGATTCACATGAACTAATCTTTCTGACCTGTAAATATTTTTAAGTAGTTTTATATCCATCTGAATGAGTCACAG

TTCCAAAACTATGCATTTCAATCCTTTCATACTTGACCTGAGAATATTTGCTAATGACACACATGTACATACTGTATATAGCCGGGTTCACGGTTATAAA

GTTTTGTACCATTTTATTTTATGACATTTTACACTGTAACTTTTGAAACTAACTGTTGGTGGGAGAAAGTTTCTTATAGATTATAGAACGAATACCCTGC

CAATACTTAATCAATCTTTGTGCCTCAACATACTGTTGATGTCTAAGTATGCCTCAGTGGGTTGAGAAATTCCCCACTGAAGATGTCCTATCCACCTAAA

AAAAAAAGGATGCTTCTGTACATGTCCCTGACATGTGCACTGACACCTATTGAATCAGAAATGTAAGGCATTGGTGATGTTTGCATCTACCCTCCTGTAA

GCAACACTTTAACGTCTTACGTTTTCTCTGATGATGTCACACTGAAAATTATCATGACAAATATAACCAGAGCAAAGTGTAACGGCCATACACTTTGTTC

GCCCACTTCACACTGTCTCTGGCATACAGAGTGCATGGATAGCTTGGGAAATGTACCATCTCCTGGCCATCCCCTCGTCTAACCAAGCTATGCAAGTATT

CCTATGCCAGAGCGGTGTCGACTCCTGGAGGTCCCAGGTGCAGCTCCTGCCTTGTGTGGTAGTTCTAAATTCAAATTTCACCGGGAACTGGGCAACTAAG

CAATGAGCCACAGCAAAATAATAATAATAATAATTTAAAAAAATGTAACAAGTGAAGCTGTCGTTAAAACAACAATACTACCAACTGCCCATAAAAAAAA

AAATTACTAATTTGATGTAGTCCTTTTCATGCCAGTATATGTTCAATTGGTAGTTATAAATGTTGGACCTCCTTGAGATTAAAAAAAAATAAAGCAAGCT

ATCTGCACCTC
Translation
 MTTQAPMFTQPLQSVVVLEGSTATFEAHVSG GSPVPEVSWFRDGQVISTSTLPGVQISFSDGRARLMIPAVTKANSGRYSLRATNGSGQATSTAELLV

TA AETAPPNFSQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELVVQG

 GEEVVPAKKTKTIVSTAQISETRQTRIEK KIEAHFDARSIATVEMVIDGATGQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPV

RHVRAPTPSPVR RSVSPAGRISTSPIRSVKSPLLIRKTQTTTMATGPEVPPPWKQEGYVASSTEAEMRETTMTSSTQIRREERWEGRYGVQEQVTISGA

AAAAASASVSSSFTAGAITTGTKE VKQETDKSAAVATVVAAVDMARVREPAISAVEQTAQRTTTTAVHIQPAQEQ ARKEAEKTAVTKVVVAADKAKEQ

ELKSRTREVMVTTQEQTHISHEQ IRKETEKAFVPKVVISATKAKEQETRITGEITTKQEQKRITQET IRQETEEIAASMVVVATAKSTKLEAAVGVQE

ETAIQQDQMHLTHEQ MMKETRKTVVPKVIVATPKIKEQDLVSRSREAITTKRDQVQITQEK KRKEVETTALSTIAVATAKAKEQETVLRSREAMATRQ

EHIQVTHGQ VGVGKKAEAVATVVAAVDQARVREPREPTHVEESHSQQTTLEYGYKEHISTTKVPEQPRRPASEPHVVPQAVKPAVIQAPSETHIKTTDQ

MGMHISSQ VKKTTDISTERLVHVDKRPRTASPHFTVSKISVPKTEHGYE ASIAGSAIATLQKELSATSSTQKITKSVKAPTVKPGETRVRAEPTPSPQ

FPFADMPPPDTYKSQAGIEVKKEVGVSISGSTVREEHFEVLRGREAK VTETARVPAPAEVPVTPPTLVS GLKNVTVIEGESVTLECHISGYPSPKVTW

YREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQV VSEEFDKETTLTEKFATEEKR RFVESRDVVMTDTSITEEQ

AGPGEPAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSGVPLTTGYR RYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASL

LEEA ADYEALVKTQQEMLYQTQMSTFIQEPKVGEIAPGFAYSEYEKEYEKEQALIRKKMAKDTVMVRTFVEDQ EFHISSFEERLIKEIEYRIIKTTLE

ELLEEDGEEKMAVDISESEAIESGFDIRIKNYRILEGMGVTFHCKMSGYPLPK IAWYKDGKRIRHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFAS

NIKGNAICSGKLYVEPAAPFSAPTYMPTPEAVSRIR RSVSPRSLSRSPIRMSPAMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVL

KPASFKCLEGQTARFDLKVVGRPMPETFWFHNG GQQIVNDYTHKVVIKEDGTQSLIIVPASPSDSGEWTVVAQNRAGKSTISVTLTVEA AVEHQIKPA

FVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRIR RIEGTRGEAALKIDSIISQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPE

PERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMIN

EFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSATLIVKDEKSLVEESQLPDGKKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEPVRVLEG

ETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGVTEHKVKLEIQQREDFRSVLRRAPEPKPEFHVHEPG

KLQFEVQKVDRPVDTSETKEVVKLKRAERITHEKVSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLKKTKDELLHWTKELTEEEKKALAE

EGKITIPTFKPERIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAIN

IAGETSSHAFLLVQA AKQLITFTQELQDVVAKEKDTMATFECETSEPFIKVKWYKDGIEVHAGDKYRMHSDRKVHFLSVLTIDTSDAEDYSCVLVEDEN

IKTTAKLIVEG GAVVEFVKELQDIEVPESYSGELECIISPENIEGKWYHNDVELKSNGKYSITSRRGRQNLTVKDVTKEDQGEYSFVVDGKKTTCKLKM

KP PRPIAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWMKDGQEVQHSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGNVSVYS SVDV

ITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQSIVKGTKQRLVINRTHASDEGPYKLMVGRVETSCNLSVEK KIKIIRGLRDLTCT

ETQNVVFEVELSHSGIDVVWNFKGKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGEYAFYAGENTTSGKLTVAG GGAISTPLTDQTVAESQEAVFECEV

ANPESEGEWLKDGKHLALSNNFRGESDGHKRRLVIAAAKLDDAGEYTYKVATSKTSAKLKVEA AVKIKKTLRNLTVTETQDAVFSVELTHPDVKGVQWI

KNGVVLDSNDKYEISVKGTLYSLKIKNCAMADESVYGFKLGRLGASARLHVET TVKIIKKPKDVTALENATVTFEVSVSHDTVPVKWFHKNVEIKPSDK

HRLVSERKVHKLMLQSISPSDAGEYTAMVGQLECKAKLFVET TLHITKTMKSIEVPETKAASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQ

LIIMNTSTEDSAEYTFVCGNDQVSATLTVTP PIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDRCQMRTKKLTHSLNIRNVHFGDA

ADYTFVAGKATSTATLYVEA ARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDGQELQIADR RIKIQKEKYVHRLLIPSTRMSDAGKYTVVA

GGNMSTANLFVEGRDVRIRSIKKEVQ VIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSVT

LYVNA APEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV

EV VPEVVSPDQEMPVYPPAIVTPLQDTVTSEGRPARFQCQVSGTD DLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYAFVANNAVGQ

VSSTATLRLEA APESILHERIGQQIEMEMKA AAPVIKRRIEPLEVALGHLAKFTCEIQGAPNVRFQWFKAGREIYESDKCSIRSSNYVSSLEILRTQV

VDCGEYTCKASNEYGSVSCTATLTVTE EAYPPTFLSRPKALTTFVGKAAKFLCTVSGTPVIEIIWQKDGAALSPSPDCRVTDADNKHSLELSNLTVQDR

GIYSCKASNKFGADICQAELTIIDKPHFIKELEAVQSAINKKIHLECQVDEDRKVTITWSKDGQKLPAGKDYKIYFEDKIASLEIPLAKLKDSGTYTCTA

SNEAGSSSSSAAVAVRE EPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMSFVNSEAILDITDVKVDDSGTYSCEATNDV

GSDSCSTEVVIKE EPPSFIKTLEPADIVRGANALLQCEIAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGC

VATHLLKE EPPTFVKKVDDFTALAGQTVTLQAAVRGSEPISVMWMKGQEVIKEDGKIKMSFSNGVAVLTIPDVQISLGGKYTCLAENEAGSQTSVGELI

VKE EPAKIIERAELIQVTAGDPATLEYTVSGTPELKPKWYKDGRPLVASKKYRISFKNNIAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLD D

RDIAPLFTKPLRNVDSVVGGACRLDCKIAGSLPMRVSWFKDGKELTASDRYQIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSKDSSGALIVQE EPP

SFVTKPGSRDVLPGSAVCLKSAFQGSAPLTIKWFKGDKELVSGGSCYITKETSESSLELYAVKTSDSGTYTCKVSNVAGSVECSADLFVKE EPATFIEK

LEPSQLLKKGDGTQLACKVTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCTGIVIVKE ESPYFTKEFKSI

EVLKEYDVMLLAEVAGTPPFEITWFKDNTTLRSGRKYKTFLQDQLVSLQVLKFVAADAGEYQCRVTNEVGSSTCSARVTLRE EPPSFIKKIEATSSLRG

GTAAFQATLKGSLPITVTWLKDNDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKE EPATIMEEAVSIDVTQGDPATL

QVKFSGTKEISAKWFKDGQELTLGPKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKASINVLD DLIIPPSFTKKLRKMDSIKGSFIDLEC

IVAGSHPISIQWFKDDQEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHSQCSGHLTVKE EPPYFVEKPQSQDVNPGTRVQLKALVGGT

APMTIKWFKDNKELHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKATIFVKE EPPQFIKKPSPVLVLRNGQSTTFECQVTGTPEIR

VSWYLDGNEITDLRKYGISFVDGLATFQISNARVENSGTYVCEARNDAGTASCSIELKVKE EPPIFIRELEPVEVVKDSDVELECEVMGTTPFEVTWLK

NNKEIRSGKKYTMSEKMSVFYLHITKCDPSDVGEYQCIIANEGGSCACSARVALKE EPPSFIKKIENVTTVLKSSATFQSTVAGSPPISITWLKDDQIL

EENDNVHISFEDSVATLQVRSVDNGHSGRYTCQAKNESGIERCYAFLLVQE EPAQIIEKAKSVDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRY

FSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLD DQDIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYR

LVCHENTVSLEVSNLELEDTANYTCKVSNVAGDNACSGILTVKE EPPSFLVKPERQQAIPDSTVEFKAVLKGTPPFKIKWLKDDVELVSGPKCFIGLEG

STSFLNLYSVDSSKTGQYTCQVTNDVE EPPKFVKKLEASKIIKAGDSARLECKITGSPEIQVVWYRNEHELTASDKYQMTFIDSVAVIQMNSLGTEDSG

DFICEAQNPAGSTSCSTKVIVKE EPPVFSSFPPIVETLKNTEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVESTDIGEYHCK

AQNEVGSDACVCAVKLKE EPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKND

GGVRENMATLTVLE EPAVIIEKAGSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLKILSVEKEDAGTYTFQVQNNVGKSS

CTAVVDVSD DRMVPPSFTRRLKDTGGVLGTSCILECKVAGSSPISIAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGSYTCVAANVAGSDECR

ALLTVQE EPPSFVKEPEPLEVLPGKNITFTSVIRGTPPFKVGWFRGARELVKGNRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFV

KE EPATFVKKLSDHSVEPGKSIILEGTYTGTLPISVTWKKDGVSITPSERCNIVTTEKTCILEILSSTKGDAGHYSCEIENEAGRDACDALVSTLE EP

PYFVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTIFRIQE ERQLPPS

FARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSTARLTARE EPKKSPFFD

IKPVSIDVIAGESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKE EPPKFIKKLDA

SKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVGDASCSTALKVKA APPVFTQKPPPVGAL

KGSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKE EPPRFVKKLSDASTLIGDPV

ELQAVVEGFQPISVVWLKDKGEVIRESENVRISFVDNIATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTVLE EPATIVEKPEPMTVTTGNPFTLEC

VVAGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSVHVSD DRVVPPSFVRRLKDTSATLGASVVLECRV

SGSAPISVGWFLDGNEIISSPKCQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAVLTVQE EPPSFEQTPDSVEVLPGMSLTFTSVIRGTPP

FKVKWFKGSRELVSGEACTISLEDFVTELELLEVEPGQSGDYSCLVTNDAGSASCTTHLFVKE EPATFVKRLADTSVETGSPIVLEATYSGTPPISVSW

MKNEYPLSQSPNCGITTTEKSSILEILESTIEDYAQYACLIENEAGQDICEALVSVLE EPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIRISWYKEHT

KLRSAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSAVLVIKE ERKLPPSFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGELL

KDDANLQMSFVHHVATLQILQTDQSHVGQYNCSASNPLGTASSSAKLILSE EHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPIKITWAKDNREIRP

GGNYKMTLVENTATLTVLKVAKGDAGQYTCYASNVAGKDSCSAQLGVQE EPPRFIKKLDQSRIVKQDEYTRYECKIGGSPEIKVLWYKDEVEIQESSKF

RMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSSTSLKVKE EPPVFRKKPFPVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSE

NLLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKA APPQFVKKLTDISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISYSENIA

TLQFSRAEPANAGKYTCQIKNDAGMQECYATLSVLE EPAAIVEKPESIKVTTGDTCTLECTVSGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKII

NVVPGDSGVYSFEVQNPVGKDSCKVSIQVSD DRIIPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVLWFHDGNEISSGRKYQTTLTDNTCALTVNML

EEADAGDYTCIATNVAGSDECSAPLTVRE EPPSFVQKPDPMDVLTGSNVTFTSIVKGSPPFTVSWFKGSTELVPGARCNVSLQDSVGELELFDVDTSQS

GEYTCIVSNEAGRASCTTRLFVKA APAIFVKRLNDYSIEKGKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNC

YIENASGKDSCSAQILILE EPPYFVKQLEPVKVTVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENS

VGEVSSSTFLTVQE EQKLPPSFSRQLRDVQETVGLPVVFECAVSGSEPISVSWYKDGKPLKDSPNIQTSFLDNIATLNIFKTDRSLSGQYSCTATNPIG

SASSGAKLILTE EGKNPPFFDIPLAPMDAVVGESADLECHVTGTQPIKVTWAKDNREIRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCYAVNEVGKD

SCTAQLNIKE ERLIPPSFTKKLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNVEIHPTSNCEIMFKNNALLLQVKRASMADAGLYTCKATNDAGSAL

CTSSIVIKE EPKKPPVFDQHLAPVTASEGDSVQLSCHVQGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAGSDTSK

CKVTIKE EKPAAAPAAKKAAVDGKLFFVSEPQSIRVVEK KTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYR

CVAFNKHGEIESNVNLQVDERKKQEKIEGDLRAMLKK KTPALKKGSGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRL

 EIEELEKSERDEKEFEELVAFIQQRLTQTE PVTLIKDIENQTVLKDNDAIFEIDIKINYPEIKLSWYKGTEKLEPSNKYEISIDGDRHTLRVKNCQPK

DQGNYRLVCGPHIASAKLTVIE EPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHED

LETSAELRIEA AEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEG GVYSVIARLEPRGEAR

STAELYLTTKE EIKLEMKPPD DIPDSRVPIPTMPIRAVPPEE EIPPAVAPSIPLLLPLPEEKKPPAKRIEV VTKKGVKKDTKKVVTKPKEEAPPPP

V VPEVAKKPPPPTPMIPAKA ASEIIDVSSKAEEVKITTITRKKEVHKEKEAVYEREEAVYEKKVHIEPWEEPYEELETEPYTEPYEEPYYEEPDEDYE

EIKVEAKKQVHEEWEEDFEEGQEYYEREEGYDEGEEEWEEIYHEREIIQVQKEVHEE ELHEKKIPAKVPEKKVPPPKV VVKKPVVEKVEKTTRRMEEE

KVQVIKV VPEVSKKIVPQKPSRTPVQEEIIEVKV VPAVHTKKMVISEEKMFFASHTEEEVSVSV VPEVQKKTVTEEKIHVAVSKKIEPPPKV VPEP

PKKPVPEEVVPVPIPKKVEPPAAKV VPEAPKKPVPEEKKPVPIPKKKEPAAPPQV VPEAPKKPAPEEKIPVPVTKKKEAPPAKV VPEVQKKVVTEEK

IAIITQREESPPPAV VPEIPKKKVPEEKRPVPRKEEVPPPKV VPVPPKKAVPEAVVPAPIPKKAPPRA AEVSKKTVVEEKRFAAEEKLSVAVPQRVE

LMRHEE EEEWTYSEEEERVSVSVYREEERDEEEAEITEYEV VLEEPEEYVVEEKMHFISKKVEVEPAKV VPEKKIIPKPKVPAKIEEPPPTKV VPE

PPKKIVPEKKVPAPAPKKVPPAKA APEESKRPVPEKRAPAEEVGIEEPPPTKV VAERHMKITQEEKVLVAVTKKEAPPRARV VPEEPKKVAPEERFP

KLKPRREEEPPAKV VTEVRKRAVKEEKVSIEVPKREPRPTKE EVTVTEEKKWSYTREEETVSEHREEEYEDYEDYEEYKEFEEYEPTEEYDQYDEYAE

REVEHYEEHEEYVTE EPKKPVPVKPAQEPVPAKPKAPPPKV VLKKAVPEEKAPLPIQKKLKPLPPKA APEEPKKVVEEKIQISITKREKQQVTEPVA

KV VPMKPKRVVPEAKIPAPTKEVAVPVRE ESLSFVICGSVLLKCLNFIEELENSQLKDDIFKVPGVPKKRELEEVVVFKEEVEAHEEYIVEEEEEYVH

EEEYVHKEEYVHEEEYVHKEEYIHEEEEHLHEEEETIAEEEVVPVAPVKV VPVVPKKPVPEEKKPVPVPKKKEAPPAKV VPEIPKKPEEKVPVPIPKK

EKAPPAKV VPEVPKKPVPEEKPPVPVPKKVEPPPAKV VPEVPKKPVPEKKVPAPTPKKVEAPPAKV VPEVPKKPIPEEKKPTALLKKMEAPPPKA A

PKKREVVPVPVALPREEEEEEVPFEEVPEEEILPEEEVPSEEEAPPEEVPPEEEEVLPEEEEVLPEEEEVLPEEEEVQPEEEALPEIKPKVPKPAPV VP

EIKKKVPEKKVVVPKKEEAPPTKV VPEVSKKVEERRIIPPKEEEVPPAEV VYEEAEEPTPEEIPEEPPSIEEEEIVEEEEEEEEVLPPRA APEVVKK

AVPEAPTPVPKKAEAPPAKV VPKKIPEEKVPVPVQKKEAPPAKV VPEVPKKVPEKKKIPEKKVPVPKKEAVPPAKG GKAVFEEKISVAYQQEELVQE

RIELELVEAKVEEAFEEEEFHEVQEYFEEEEFHEVEEFIRVEERRFQEEHKVEEVHRVIEFLEAEEVEVYEKPKIPPKKG GPEVSEKVIPPKKPPTKVI

PRKEPPAKV VPEVTKKTVVEEKIRAPEEPKVPAPKE EVVPEKKVSVVPPKKPEAPPAKV VPEAPKEAAPEKKVPVAPKKKPEAPPVKV VPEVPKTA

VPQKKIPEAIPPKPESPPLEV VPEAPKEVVPEKKVSVVPPKKPEAPPAKV VPEAPKEAAPEKKVPVAPKKKPEAPPVKV VPEVPKAAVPQKKIPEAI

PPKPESPPPEV VYEEPEEEIVPEEPPEEAVEEPVPAPPPKV VTEPPKKPVPEKKAPPAVVKKPEPPPAKV VPEVPKEAPPEKKVPPKKPEAPPAKV 

VPEVPKEVVTEKKVAVPKKPEVPPAKV VPEVPKKPVIEEKPAIPVVEKVASPPAEV VYEEPEEVTAEEEEPAPAVEEEEYEAPPPPAPV VPEEPKKV

VPEKKFPVIKKPEAPPPKE EPEPEKKVIEKPKLKPRPPARPPSPPKEDVKEKMFQLKA - UNI36362 - AVSKKKVPEKPEVVEKVEPAPLKV - 

UNI36362 - VPTAEKKVRKLLPEPKPQPKEEVVLKSV - UNI36362 - VLRKKPEEEEPKVEPKKVEKAKKPEE EPQPPPKAVEVEAPPEPTPK

ERKVPEPAKV - UNI17655 - VPEIKPAIPLPGPEPKPKPEPE - UNI17655 - EVKTMKAPPIEPAPTPIAAPVTAPVVGKKAE EAKPKDEA

AKPKGPIKG GVAKKTPSPIEAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTEAESVGSSAIFECLVSPSTAITTWMKDGSNIRESPKH

RFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLIVEE ELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKIVVEKPGRIVPGV

IGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVE EIIREWLVKPIRDQHVKPKGTAVFTCDIAKDTPNIKWFKGYDEIPLEPNDKTEILKEGN

HLFLKVKNAMPEDIDEYAVEIEGKRYPAKLTLGE EREVELLKPIEDVTIYEKESASFDAEISEEDIPGEWKLKGELLRPSP TCEIKAEGGKRFLTLHK

VKLDQAGEVLYQACNAITTAILTVKE EIELDFAVPLKDVTVPEKRQARFECVLTREANVIWSKGPDIIKASDKFDIIADGKKHILVINDSQFDDEGVYT

AEVEGKKTSAQLFVTG GIRLKFISPLEDQTVKEGQTATFVCELSHEKMHVVWFKNDVKLHTTRTVLMSSEGKTYKLEIRETTLDDISQIKAQVKNLSST

ANLKVLE EADPYFTVKLHDKTGVEKDEIILKCEVSKDVPVKWFKDGEEIVPSPKHSVKTDGLRRILKIKKAELKDKGEYVCDCGTDTTKANVTVEA AR

LIKVEKPLYGVEVFVGETARFEIELSEPDVHGQWKLKGEPLTASP DCEIIEDGKKHVLVLYNCQLDMTGEISFQAANAKSAANLKVKE ELPLIFITPL

SDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTRHSLVIKSAAFEDEAKYMFEAEDKRTSGKLIIEG - UNI35827 - GIRLKF

LTPLKDVTAKERENAVFTVELSHDNIPVSWFKNDQRLHTSKRVSMHDEGKTHSITFKDLSIDDTSQIRVEAMGISSEAKLTVLE - UNI35827 - - 

UNI35899 - EGDPYFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNVVIKADGKKRMLILKKALKSDIGQYTCDCGTDQTSGKLDIE

D - UNI32138 - - UNI35827 - - UNI35899 - DREIKLVRPLYSVEVMETETARFETEISEDDIHANWKLKGEALLQTP - UNI32138 

- - UNI33036 - - UNI35899 - ECEIKEEGKIHVLILHNCRLDQTGGVDFQAANVKSSAHLRVKP - UNI32138 - - UNI32541 - - 

UNI33036 - PRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPNDK - UNI14991 - - UNI16643 - - UNI32541 - -

 UNI33036 - VVTRSEGRVHTLTLRDVKLEDAGEVQLTAKDFKTQANLFVKE - UNI14991 - - UNI16643 - - UNI32541 - EPPVEF

TKPLEDQTVEEEATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVP - UNI14991 - PP

HVEFLRPLTDLQVKEKETARFECEISKENEK VQWFKDGAEIKKGKKYDIISKGAVRILVINKCLLNDEAEYSCEVRTARTSGMLTVLE EEEAVFTKNL

ANLEVSEGDTIKLVCEVSKPGAEVIWYKGDEEIIETGRFEILTDGRKRILIIQNAQLEDAGSYNCRLPSSRTDSKVKVHE ELAAEFISKPQNLEILEGE

KAEFVCTISKESFEVQWKRDDQTLESGDKYDIIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIE EKLRIIVPLKDTKVKEQQEVVFNCEVNT

EGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDARLDDQANFNVSLTNHRGENVKSAANLIVEE EEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVT

LKWTKNGEEVAFDNRISYRIDKYKHSLIIKDCGFPDEGEYVVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIK

EGKK KYKFEKDGSIHRLIIKDCRLEDECEYACGVEDRKSRARLFVEE EIPVEIIRPPQDILEAPGADVIFLAELNKDKVEVQWLRNNMIVVQGDKHQM

MSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAA AAPKIKTADQDLVVDAGQPLTMVVPYDAYPKAEAEWFKENEPLSTKTVDTTAEQTSFRIS

EAKKDDKGRYKIVLQNKHGKAEGFINLQVID DVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLVTDRADSCEFTVTGLQK

GGVEYLFRVSARNRVGTGEPVETDSPVEARSKYD DVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVT

DVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIE ERPSPPVNLNASEQTQSSVQLTWEPPLKDGGSPILGYIIERREEGKDNWIRCNMKPVPELTY

K VTGLQKGNKYLYRVSAENAAGVSDPSEILGPLTADDAFV VEPTMDLSAFKDGLEVIVPNPIKILVPSTGYPRPKATWTFGDQVLEEGDRVKMKTISA

YAELVISPSERTDKGIYTLTLENPVKSISGEINVNVIA APPSAPKELKFSDITKDSVHLTWEPPDDDGGSPLTGYVVEKRDMSRKTWTK VMDFVTDLE

FTVPDLVQGKEYLFKVCARNKCGPGEPAYTDEPVNMSAPAT TVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVEKCPRGSDKWVACGEPVPD

TK KMEVTGLEEGKWYAYRVKALNRQGASKPSKPTEEIQAVDTQE EAPEIFLDVKLLAGITVKAGTKIELPATVTGKPEPKITWTKADTLLKPDQRITI

ENVPKKSTVTITDSKRSDTGTYIIEAVNVCGRATAVVEVNVLD DKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERKATDSDVWHKLSSTV

KDTNFKATKLTPNKEYIFRVAAENMYGVGEPVQAAPIIAKYQFD DPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKM

PVKDTTYR RVKGLTNKKKYRFRVLAENLAGPGKPSRSTEPILIKDPID DPPWPPGKPTVKDIGKTSLVLNWTKPEHDGGAKIESYVIEMLKTGTDEWV

RVAEGVPTTEHLLTGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLY YPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKG

WQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIGDSVLAKDTFT TTPGPPYALTVVDVTKRHVDLKWEPPKNDGGRPIQR RYIIEKKEK

LGTRWVKAGKTSGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTS SPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEM

CPVGTEKWMRVNSRPIKDLKFKVEEGIVPDKEYVLRVRAVNAVGVSEPSEISENVVAKDPDC CKPTIDLETHDIVVIEGEKLNIPVPFRAVPVPTVSWH

KDGKEVKASDRLTMKNDHISAHLEVPKSVHADAGVYTITLENKLGSATASINVKVIG GLPGPCKDIKASDITKSSCKLTWEPPEFDGGSPILHYVLERR

EAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQ QPPDPPVDVEVHNPTAKAMTITWKPPLYDGGSKIMGYIIE

KITKGEDRWKRCNEHLVPVLTYTAKGLEEGKEYQFRVRAENAAGIGEPSRATPPTKAVDPID DAPKVILRTSLEVKRGDEIALDATISGSPYPTITWIK

DENVIVPEEIKKRAAPPVRRKKGEAEEEEPFSLPLTERLSINNSKQGESQLRIRDSLRPDHGQYMIKVENDHGVAKAPCSVSVLD DTPGPPINFVFEDI

RKDSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSDWIVITSTLRNCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLLAKDPFE EPPDAPDKPIV

EDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKTLLSSLKTKVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTARDPIS SPPGPPVPR

VADTSSTTIELEWEPPAFNGGGEIMGYFVDKQLVGTNEWSRCTEKMIKVRQFTVKEIREGADYKLRVSAVNAAGEGPPGETEPVTVAEPQE EPPTVELD

VSVKGGIQIMAGKTLRIPAEVTGRPVPTKVWTIEEGELDKERVIIENVGTKSELIIKNALRKDHGRYVITATNSCGSKFAAVRVEVFD DVPGPVLDLKP

VVTNRKMCLLNWSDPADDGGSDITGFIIERKDAKMHTWRQPIETERSKCDITGLIEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLG GPPTSPERLTY

TERTKSTITLDWKEPRSDGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNDVGESEPSLPLNVVIQDDEV VPPTIKLRL

AVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKNEKVIDKPTDTLNITKEEVSRSEAKTELSIPKAAREDKGTYTITASNRLGSVFRNVHVEVYD DRPS

PPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYIIDKRDASRKKSEWEEVTNTAVERRYG IWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRL

PGPPGKPKVLERTKGSMLVSWTPPLDNGGSPITGYWLEKREEGGTYWSRVSRAPITKVGLKGVEFNVPRLIEGVKYQFRAMAINAAGIGPPSEPSDPAVA

GDPIY YPPGPPSCPEVKDKTKSSISLAWKPPAKDGGSPIKGYIVEMQEEGTTDWKPVNEPDKLLTACECVVPNLKELRKYRFRVKAVNEAGESEPSDTT

GEIPATDIQE EVPEVFIDIGAQDCLVCKAGSQVKIPAVIKGRPTPKSSWEFDGKAKKAMK DGVHDIPEDAQ LETAENSSVIIIPECTRAHSGKYSIT

AKNKAGQKTANCRVKVMD DAPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNCGSTTFVVPDLISEQQYFFRVRAENR

FGIGPPAETIQRTTARDPIY YPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGKKKEAWRQCNRRDVEELEFTVEDLIEGGEYE

FRVKAVNEAGVSKPSATVGPVIVKDQTC CPPAIELKEFMEVEEGTDVNIVAKIKGVPFPTLTWFKAPPKKPDSKEPVVYDTHVNKQVVDDTCTLVIPQS

RRSDTGLYSITAVNNLGTASKEMRLNVLG GRPGPPVGPIKFESISADQMTLSWLPPKDDGGSKITNYVIEKREANRKTWVRVSSEPKECMYTIPKLLEG

HEYVFRIMAQNKYGIGEPLDSEPETARNLFS SVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKV

TGLIEGSDYQFRVYAINAAGVGPASLPSDPVTARDPVA APPGPPFPKVTDWTKSSVDLEWSPPLKDGGSKITGYIVEYKEEGKEEWEK GKDKEVRGTK

LVVTGLKEGAFYKFRVRAVNVAGVGEPGEVTDVIEMKDRIV VSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWSMNERALPQEAAIETTAIS

SSMVIKNCQRSHQGVYSLLAKNEGGERKKTIIVDVLD DVPGPVGIPFLSDNLTNDSCKLTWFSPEDDGGSPITNYVIQKREADRRAWTPVTYTVTRQNA

TVQGLIQGKSYFFRIAAENSIGMGPFVETPNALVIRDPIT TVPERPEDLEVKEVTKNTVSLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLS

RKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELA APPTLDLDFRDKLTVRVGESFALTGRYSGKPKPKIDWFKDEADVLEDDRTHIKTTP

TTLALEKTKAKRSDSGKYCVVVENSTGSRKGFCQVNVVD DRPGPPVGPVIFDEVTKEYMVISWKPPLDDGGSEITNYIIEKKELGKDIWMPVTSASAKT

TCKVPKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDRFR RVPDAPEQPVVTEVTKDSALVTWNKPNDGGKPITNYILEKRETMSKRWVRVTKEPIHP

YTKYRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFARDPIA AKPSPPINPEAIDTTCNSVELTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHT

PESCPETKYKVTGLRDGQSYKFRVLAVNEAGESDPAHVPEPVLVKDRLE EPPELILDANMAREQHIRVGDTLRLSAIIKGVPFPKVTWKKEDREAPTKA

QIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGTKTVSVKVLVLD DKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVVTNYVVERKDVATAQWSPLST

TSKKKSHMAKHLTEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLH HPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGDKDWIKF

KTVKNLDCVVTGLQQGKTYRFRVKAENIIGLGLPDTTIPIECQEKLV VPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGTEIKTDDHY

TVETDSFSSVLTIKNCLRKDTGEYQLTVSNAAGTKTVAVHLTVLDVPGPPTGPINILDVTPEYMTISWQPPKDDGGSPVINYIVEKQDTRKGTWGVVSAG

SSKLKLKVPHLQKGCEYVFRVKAENKMGVGPPLDSIPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYVERREITGKWVRVNKTPI

ADLKFRVTGLYEGNTYEFRVFAENLAGLSNPSPSSDPIKACRPIKPPGPPINPKLKDKSKESADLVWTKPLSDGGSPILGYVVEYQKPGTAQWDRINKDE

LIRQCAFRVPGLIEGNEYRFRIRAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWSKEGKVLVKDKRVDL

IHDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVSNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTK

RLVKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSADWERVHKGSIKE

THYMVDKCVENQIYEFRVQTKNEGGESDWVRTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTSAE

SSKFSLTKAKRSDGGKYVITATNPAGSFVAYATVNVLDKPGPVRNLKITDVSSDRCTIRWDPPEDDGGCEIQNYILEKCESKRMVWSTYSANVLTPSATV

TRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDRPGRPDPPEVTKVSKEEMTVVWNAPEYDGGKSITGYYLEKKEKHAVRWVPVNKSAIPERRLKV

QNLLPGHEYQFRVKAENEVGIGEPSLPSRPVVAKDPIE EPPGPPTNFKVVDTTKSSITLAWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAA

QLIRMEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILE EPPEIDLDASMRKLVVVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQ

VDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVKVLD DTPGPVADLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREAERKTWSTVTPE

VKKTSFNVTNLVPGNEYFFRVTAVNEYGPGVPTDIPKPVLASDPLS SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYIISYREEDQPADRWTE

YSVVKDLSLIVTGLKEGKKYKFRVAARNAVGVSMPREAEGVYEAKEQLL LPPKILMPEQITIKAGKKLRVEAHVYGKPNPICKWKKGDDEVVTSSHLAI

HKADGSSVLIIKDVTRKDSGYYSLTAENSSGSDTQKIKVTVMD DAPGPPQPPFDISEIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALAS

VTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMLAKFPFD DVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKERNSLLWVKAND

TIVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVD DPPGKPEVVDVTKNSASLIWARPKHDGGSRIIGYFVEACKLPGDKWVRCNT

TPHQIPQEEYTATGLEENAQYQFRAIAKTAVNISQPSEPSDPVTILAENV VPPRIELSVEMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDTTPIKQA

EGIKMAMKRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLD DKPGPPASVKINKMYADRAMLSWEPPLEDGGSEITNYIIDKRETSRPNWAQ

VSATVPITSCTVEKLIEGHEYQFRICAENKYGVGDPILTEPAIAKNPYD DPPGRCDPPVISNITKDHMTVSWKAPADDGGSPITGYLVEKRETQAVNWT

KVNRKPVIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAVYAQDPLY YPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSD

HWVRCNLPEKLQKTRFEVTGLMENTEYQFRVYAVNKIGYSDPSDVPDKHCPKDILI IPPEGELDAELRKTLILRAGVTMRLYVPVKGRPPPKITWSKPN

VNLRERIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLD DTPGPPVNVTVKEVSKDSAYVTWDPPIIDGGSPIINYVVEKRDAE

RKSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASE ETPGPVVDLKALAITKSSCTIGWKKPRSDGGSRITGYVVDFLTEEN

KWQRVMKSLSLQYSTKDLKEGKEYTFRVSAENENGEGTPSEIVVVAKDDVV VAPDLDLKDLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLAT

DTRVSVESTAVNTTLVVYDCQKSDAGKYTITLKNVAGTKEGTLSIKVVGKPGIPTGPIKFDEVTAEAMTLKWGPPKDDGGSEITNYVLEKRDSVNNKWVT

CASAVQKTTFRVTRLHEGIEYTFRVSAENKYGVGEGLKSEPIVAKHPFD DVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITG GYHIEFKERNSLL

WKRANKTPIRMKDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPID DPPGKPEVISVTRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKS

WMKANHVNVPDCAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTGTIICKDEYE EAPTIVLDPTIKDGLTVKAGDSIVLSAISILGKPLPKSSWSRAG

KDIRPSDIAQITSTPTSSMLTVKYATRKDAGEYTITATNPFGTKEEHVKVSVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKAYVLEKRETSRL

LWTVVSEDIQACRHVVTKLIQGNEYLFRVSAVNHYGKGEPVQSEPVKMVDRFG GPPGPPGKPEISNVTKNTATVSWKRPTDDGGSEITGYHVERREKKG

LRWVRATKTPVSDLRCKVTGLQEGNTYEFRVSAENRAGIGPPSDASNPVLMKDVAY YPPGPPSNAHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQK

VGDDAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPNVEIVEKEVAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKD

NINLKHRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKS

YSTVTTKCHKCTYKVTGLTEGCEYFFRVMAENEYGVGEPTETTEPVRASEAPLPPDSLNIMDITKNTVSLAWPKPRHDGGSKITGYVIEAQRKGSDQWTH

ISTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIARAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVN

VENTATSTILNINECVRSDSGPYPLTAKNTVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWEPPENDGGVPISNYVVEMRQTDSTTWVELATTV

IRTTYKATRLTTGVEYQFRVRAQNRYGVGPGITSASVVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQTVSKALV

PGNIFKSTGLTDGIAYEFRVIAENMAGKSKPSKPSEPMFALDPIDPPGKPVPLNITRHTVALKWAKPEYTGGFKITSYVVEKRDLPNGRWLKANFSNILE

NEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDLEAPRIMVDVRFKDTITLKAGEAFKLEADVSGRPPPTMEWTKDGKELEGTGKLEIKIA

DFSTHLINKDSSRTDSGAYILTATNPGGFAKHIFNVKVLDRPGPPEGPLAVSDVTSEKCVLSWLPPLDDGGAKIDHYIVQKRETSRLAWTNVATEVQVTK

LKVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVDPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNKKALTDLR

FKVSGLTEGHEYEFRIMAENAAGISAPSATSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQVVTPPAGLKA

TSYTITSLIENQEYKIRIYAMNSEGLGEPALVPGTPKAEERMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWAREHGESLDKASIESTSSY

TLLVVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQNLKIKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVD

QLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLTDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDRWATCATVKVTEATITGLIQ

GEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKIDVPFIGRPPPAVTWHKDDIPLKQTTRVNAESTENNSLLTIKEACRE

DVGHYTVKLTNSAGEATETLNVIVLDKPGPPTGPVKMDEVTADSVTLSWEPPKYDGGSSINNYIVEKRDTSTTAWQIVSATVARTTIKACRLKTGCEYQF

RIAAENRYGKSTYLNSEPVVAQYPFKVPGPPGTPFVTLASKDSMEVQWHEPVSDGGSKVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGIEYEF

RVSAENIVGIGKPSKPSECYAAHDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPDGRWMKASFTNIIDTQFEVTGLLEDHRYEFRV

IARNAAGVFSEPSESTGAITARDEVEPPRISMDPKYRDTVVVQAGESFKIDADIYGKPIPTTQWVKGDQELSSTARLEIKSTDFATSLSVKDAVRVDSGN

YILKAKNVAGEKSVTINVKVLDRPGPPEGPVAISGVTAEKCTLAWKPPLQDGGSDITNYIVERRETSRLVWTLVDANVQTLSCKVLKLLEGNEYIFRIMA

VNKYGVGEPLESESLIAKNPFVVPDAPKAPEVTAVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLLENHNYEFRVSA

ENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVMDVTRSSVFLSWTKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNLEVEKLLEKHEYNFRI

CAINKAGVGEHADVPGPVMVEEKLEAPDIDLDLELRKVINIRAGGSLRLFVPIKGRPTPEVKWGKVDGDIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTL

TLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEY

GIGLPARTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKNTDKWSECARVKSLDAVITNLTQGEEYLFRVIAVNEKGRSD

PRSLAVPIIAKDLVIEPDVRPAFSSYSVQVGQDLKIEVPISGRPKPSISWTKDGMPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVSNVVGQKTA

AIEIITLDKPDPPKGPVKFDEISAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESEP

VVAQYPYKEPGPPGTPFVTAISKESMVVQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKALNLEEGIEYEFRVYAENIVGVGKASKNSE

CYVARDPCDPPGTPEAIIVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGP

ITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNV

KVLDRPGPPEGPVQVTGVTAEKCTLAWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNKYIFRIMAVNKYGVGEPLESAPVLMK

NPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKA

CDPVFKPGPPTNAHVVDTTKNSITLAWSKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEIAKLIEHQEYKIRVCALNKVGLGEAASVPGTV

KPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSKEEGEFTDKVQIEKGINFTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVL

DTPGPPQNLAVKEVRKDSVLLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCNKTSFRVENLTEGAIYYFRVMAENEFGVGVPTETSDAVKASEPP

SPPGKVTLTDVSQTSASLMWEKPEHDGGSRILGYVVEMQPKGTEKWSVVAESKVCNAVVSGLSSGQEYQFRVKAYNEKGKSDPRVLGIPVIAKDLTIQPS

FKLPFNTYSVQAGEDLKIEIPVIGRPRPKISWVKDGEPLKQTTRVNVEETATSTILHIKESSKDDFGKYSVTATNSAGTATENLSVIVLEKPGPPVGPVK

FDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTNWQMVSATVARTTIKISKLKTGTEYQFRIFAENRYGKSTPLDSKPVVVQYPFKEPGPPGTPFV

TSISKDQMLVQWHEPVNDGGSKVTGYHLEQKEKNSILWVKLNKIPIQDTKFKTTGLDEGLEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIV

ITRNSVTLKWKKPVYDGGSKITGYIVEKKDLPDGRWMKASFTNVVETEFTVTGLVEDQRYEFRVIARNAADNFSEPSESSGAITARDEIDAPNASLDPKY

RDVIIVHAGETFVLEADIRGKPIPDIIWSKDGNELEETAARMEIKSTLQKTTLIVKDCIRTDGGQYTLKLSNVGGTKTIPITVKVLDRPGPPEGPLKVTG

VTAEKCYLAWNPPLQDGGASISHYIIEKRETSRLSWTQVSNEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEALESEPVIACNPYKRPGPPSTPEASAI

TKDSMVLTWTRPVDDGGAEIEGYILEKRDKEGIRWTKCNKKTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTD

TSRSSVSLAWNKPIYDGGAPVRGYVIELKKAAADEWTTCTPPSGLQGKQFTVTKLKENTEYNFRICAFNTEGVGEPATIPGSVVAQERMEAPEIELDADL

RKVVTLRASATLRLFVTIKGRPEPEVKWEKAEGILTERAQIEVTSSYTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKD

SVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKNTFKIENLQEGCSYYFRVLASNEYGIGLPAETAEPVKVSEPPLPPGRVTLVDVTRNTAT

IKWEKPESDGGSKITGYVVEMQTKGSEKWSACTQVKTLETTISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIAKDIEIKPSVELPFNTFNVKANDQLK

IDIPFKGRPQATVAWKKDGQVLRETTRVNVASSKTVTTLSIKEASREDVGTYELCVSNTAGSITVPITVIVLDRPGPPGPIRIDEVSCDNVSISWNPPEY

DGGCQISNYIVEKRETTSTTWQVVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMVVSWQVPVND

GGSQVIGYHLEYKERSSILWSKANKVLIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKACEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPRYDGG

AKITGYIVERRELPDGRWLKCNFTNVQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIIVKAGEVLKINADI

AGRPLPVISWAKDGVEIEERAKTEIVSTDYTTTLTVKDCVRRDTGQYVLTLKNVAGTRTMAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGA

DIDYYIVEKRETSRLAWTICEAELRTTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESMAVKALDPFTTPSPPTSLEITSVTKDSMTLCWSRPETDGGSD

ISGYIIERREKNSLRWMRVNKKPVYDLRVKSTGLREGCEYEYRVFAENAAGLSLPSETSPLVRAEDPVFLPSPPSKPKIVDSGKTTITIGWVKPLFDGGA

PITGYTVEYKKSEETDWKVAIQSFRGTEYTMSGLTTGDEYVFRVRSLNKMGASDPSDSSDPQVAKEREEEPVFDVDSEMRKTLIVKAGSSFTMTVPFRGR

PIPNVSWSKPDTDLRTRAYIDSTDSRTLLTIENANRNDSGKYTLTIQNVLSAASMTFVVKVLDSPGPPANITVREVTKETAMLSWDVPENDGGAPVKNYH

IEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGVPAETKEGVKITE EKPSPPEKLGVTSVSKDSVSLSWLKPEHDGGSRIIHYVV

EALEKGQKTWVKCAVVKTTHHVVSGLRESHEYFFRVFAENQAGLSDPRELLLPVLIKDQLE EPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVT

LSRDGVPLKATMRFNTEITAENLTINLKESVTTDAGRYEITAANSSGTTKTFINIIVLDRPGPPTGPVAISDITEESVTLKWEPPKYDGGSHVTNYIVLK

RETSTAVWSEVSATVARTMIKVMKLTTGEEYQFRIKAENRFGISDHIDSVCVVVKLPYT TTPGPPSTPWVSNVTRESITVGWHEPVSNGGSAVTGYHLE

MKDRNSILWQKANKMIIRTTHFKVTTISAGLIYEFRVYAENAAGIGKPSHPSEPVLAIDACE EPPRNVRITDISKNSVNLSWQQPAFDGGSKITGYIVE

RRDLPDGRWTKASFTNVIETQFTVSGLTQNSQYEFRVFARNAVGSVSNPSEVVGPITCIDSYG GGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPT

IEWYKDDKELQTNALVCVENSTDLASILIKDANRLNSGSYELKLRNAMGSASATIRVQILD DKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHY

IVEKRETSRVVWSMVAENLEECIVTTTKIIKGNEYVFRVRAVNKYGIGEPLESEPVVAKNAFV VTPGPPSIPEVTKITKNSMTVVWDRPTVDGGSEING

YFLERRDKKSLAWLKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGVGPFSEPSDFYKAADPID DPPGPPAKIRIADSTKSSITLGWSKPVYDGGSD

VTGYVVEMKQGDEEEWTIVSTRGEVRTTEYVVSNLKPGVNYYFQVSAVNCAGQGEPITMTEPAQAKDVLE EEPEIDLDVALRTSVIAKAGEDVQLLIPF

KGRPPPTVTWRKDEKNLGSDTRYSIQNTDSSSLLVIPQVTRNDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQKLQVKHVSLGTVTLLWDPPLIDGGS

PIINYVIEKRDATKRTWSVVSHKCSGTSFKVTDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVVLSWTKPDFDGGSIIT

DYLVERKGKGEQAWSHAGISKTCEIEIGQLKEQSVLEFRVSARNEKGQSDPVTIGPLTVKELVITPEVDLSEIPGAQISVRIGHNVHLELPYKGKPKPSI

SWLKDGLPLKESEYVRFSKTENKITLSIKNSKKEHGGKYTVILDNAVCRNSFPITIITLGPPSKPKGPIRFDEIKADSAIMSWDIPEDDGGGEITCYSIE

KREASQTNWKMVCSSVARTTFKVSNLVKDSEYQFRVRAENRYGVSEPLASNIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEK

KERNSILWQRVNTSPISGREYRATGLIEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVD DPPGTPDYIDVTRETITLKWNPPLRDGGSKIVAYSIEK

RQGSDRWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGLIMTRDENV VPPTVEFGPEYFDGLVIKSGDSLRIKALVQGRPVPRVT

WFKDGVEIERRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNVSGSTKAEVTVKVQD DTPGKVVGPIRFTNITGEKMTLWWEAPLNDGCAPVTHYII

EKRETSRLAWALIEDNCEALSYTAIKLITGNEYQFRISAVNKFGVGRPLESDPVVAQIQYT TIPDAPGVPEPSNVTGNSITLTWTRPESDGGSEIQHYI

LERREKKSTRWVKVISKRPISETRFKVTGLVEGNEYEFHVMAENAAGIGPASGISRLIKCREPVNPPSAPSVVKVTDTSKTTVSLEWARPVFDGGMEIIG

YIIEMCKADLGDWHKVNTEPCVKTRYTVTDLQAGEEYKFRVSAVNGAGKGDSCEVTGTIKAVDRLSAPELDIDANFKQTHIVRAGVSIRLFIAYQGRPTP

TAVWSKPDSNLSIRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGKKSITFTVKVLDSPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVIEK

REASRRSWQVVSEKCTRQILKVSELTEGVPYYFRVSAENEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITSYLLEMRQK

GSDFWVEAGHTKQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPISGRPAPKVTWKLEEMR

LKETDRMSIATTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSVSAESCVLSWTEPKDDGGTEITNYIVEKRESGTTA

WQLINSSVKRTQIKVTHLTKYKEYCFRVSSENRFGVSKPLESVPIVAEHPFV VPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKIVGYWVEKKERNTI

LWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVD DPPGRPEVTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEV

GDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYA APPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIW

TKGDKELDLCEKISLQYTGKRATAVIKYCDRSDSGKYTLTVKNASGTKSVSVMVKVLD DSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYIVER

RETSRLNWVIVEGECLTASYVVTRLIKNNEYTFRVRAVNKYGLGVPVESEPIVARNSFT TIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEISNYLVD

KREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSY YTPGPPSAPRVVDTTKRSISLAWTKPMYDGGTDIIG

YVLEMQEKDTDQWCRVHTNATIRNNEFTVPDLKMGQKYSFRVAAVNAKGMSDYSETTAEIEPVERLE EIPDLELADDLKKTVIVRAGASLRLMVSVSGR

PSPVITWSKKGIDLANRAIIDNTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYD DTPGPCPSVSVKEVSRDSVTITWEIPTIDGGAPVNN

YIIEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVL

EACKAGTERWMKVVTLKPTVLEHTVISLNEGEQYLFRVRAQNEKGVSEPREIVTPVTVQDLRV VLPTIDLSTMPQKTIHVPAGRPIELVIPITGRPPPT

ASWFFAGSKLRESERVTVETHTKVTKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILD DKPGPPTGPIKIDEIDATSVTISWEPPELDGGAPLSGY

VVEQRDAHRPGWLPVSESVTRPTFKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSIS SIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTG

YIVERKEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAINARGTGKPSRPSKPTVAMDPIA APPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSK

VTGYLIEMQKVDQREWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLE EYPDYELDERYQEGVFVRQGGVIRLTIPIK

GKPFPVCKWTKEGQDISKRAMIATSETHTELVIKEADRNDSGTYDLVLENKCGKKTVYIKVKVIGSPNTPEGPLEYDDIQARSVRVSWRPPADDGGADIL

GYILERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLN NPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGS

RVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFD DKPSQPGELEILSISKDSVTLQWEKPECD

GGKEILGYWVEYRQSGDSAWKKSNKERIKDRQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSVKTKLTS SGEAPGVRKEMADVTTKLGEAAQLSCQ

IVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTDEQEDEGVYTCVATNEVGEVESSSKLLLQAAPQFHPGYPLKEKYYGAVGSTLRLHVMYIGR

PVPAMTWFHGQKLLQNSEKITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNAFGTVDATLDVEIQD DKPDKPTGPIVIEALLKNSVVISWKPPADDGGS

WITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISEPLEVASIVIIKSPFE EKPGVPGKPTITAVTKDSCVVAWKPPASD

GGAKIRNYYLERREKKQNKWIAVTTEEIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEPVTPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKV

TGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEV VPAKIHLPKTLEGMGAVHALRGEVVSIKI

PFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFSNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDG

GSKVTNYIVEKCATTAERWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTVTKEDKTRAMNYDDEVDETREVTTTKASHSKTKELYE

KYMIAEDLGRGEFGIVHRCVETSSKRTFMAKFVKVKGTDQVLVKKEISILNIARHRNILYLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIV

SYVRQVCEALEFLHSQNIGHFDIRPENIIYQTRKNSTIKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLA

ETNQQMIENIMNAEYTFDEEAFKEISLEAMDFVDRLLVKERKSRMTASEALQHPWLKQRIDRVSTKVIRTLKHRRYYHTLIKKDLNMVVSAARISCGGAI

RSQRGVSVAKVKVASIEIGPVSGQIMHAIGEEGGYVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVATMYVKDITKFDDGTYRCKVVNDYGE

DSSYAELFVKGVREVYDYYCRRTKKVKRRTDAMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDEKKYTFESDKGLYQL

TINSVTTDDDAEYTVVARNKHGEDSCKAKLTVTLHPPPTETTLRPMFKRLLANAECHEGQSVCFEIRVSGIPAPTLKWEKDGQPLSLGPHIEIVHEGLDY

YALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYVKQEFQSKEERERHVQKQIDKTLRMAEILSGTETVPLTPVAQEALREAAILYKPAVSTKT

VKGEYRLQTEEKKEERKLRMPYEVPEPRRFKQATVEEDQRIKQFVPMSDMKWYKKIRDQYEMPGKLDRVVQKRPKRIRLSRWEQFYVMPLPRITDQYRPK

WRIPKLTQDDLEMVRPARRRTPSPDYDLYYYRRRRRSLGDMSDEELLLPIDDYLAMKRTEEERLRLEEELELGFSASPPSRSPPRFELSSLRYSSPPAHV

KVEDRRRDFRYSTYHVPTKEETSTSYAELRERHAQASYRQPKLRQRIMAEKEEEELLRPVTTTQRLSEYKSELDYMSKEEKSKKKSKRQRQVTEITEIEE

EYEISRRAQRESSSSVSRLLRRRRSLSPTYIELMRPVSELIRSHPRPAEEYEDDAERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAA

LKTQKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCQTEDGGTYRAVCT

NYKGEASDYATLDVTGGAYTTYASQRRDEEVPKSVFPELTKTEAYAVSSFKRTSELEAASSVREVKSQMTETRESLSTYEHYASAEMKSATSEEKSLEEK

ATVRKIKTTLAARILTKPRSITVHEGESARFSCDTDGEPVPTVTWLREGQVVSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSDGKQEAQFTLT

VQKARVIEKAVTSPPRVKSPEPRVKSPETVKSPKRVKSPEPVTSHPKAVSPTETKPTEKGQHLPVSAPPKITQSLKAEASKDIAKLTCAVESSALCAKEV

AWYKDGKKLKENGHFQFHYSADGTYELKIHNLSESDCGEYVCEVSGEGGTSKTSFQFTGQSFKSIHEQVSSISETTKSVQKTAESAEAKKS EPIAPESI

SSKPVIVTGLRDTTVSSDSVAKFTIKVTGEPQPTITWTKDGK AIAQGSKYKLSSNKEEFILEILKTETSDGGLYACTVTNSAGSVSSSCKLTIKA AVK

DTEAQKVSTQKTSEVTSQKKASAQEEISQKALTSEEIKMSEVKSHETLAIKEEASKVLIAEEVKRSAAASLEKSIVHEEVTKTSQASEEVKTHAEIKTLS

TQMNITKGQRATLKANIAGATDVKWVLNGTELPNSEEYRYGVSGSDQTLTIKQASHREEGILSCIGKTSQGVVKCQFDLTLSEELSDAPSFITQPRSQNI

NEGQNVLFSCEVSGEPSPEIEWFKNNLP ISISSNISVSRSRNVYTLEIRNAAVSDSGKYTIKAKNFHGQCSATASLTVLP PLVEEPPREVVLKTSSDV

SLHGSVSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGKSSMTQLESSTSRMLKAGGRG GIPPKIEALPSDISI

DEGKVLTVACAFTGEPTPEITWSCGGRKIQNQEQQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNINIRSM
Transcript ENSMUST00000011934
Sequence
TTAGAGGCTCACCGATTCATGTCGGAGATGGTTGGAAAAACCAACTCTACGTAGGACGTCGTTTCAGAAGCAAACTTGGGCTTGGTCCCACCCTTTTTGG

GCACTCCTGAGAAATCAG AGTGCCTGAAAAGATGACTACTCAAGCACCGATGTTTACGCAGCCGTTACAAAGCGTTGTGGTACTGGAGGGTAGTACCGC

AACCTTTGAGGCTCACGTTAGTG GTTCCCCAGTTCCTGAGGTGAGCTGGTTTCGGGATGGCCAGGTGATTTCAACTTCCACTCTGCCCGGCGTGCAGAT

CTCCTTTAGCGATGGCCGCGCTAGATTGATGATCCCCGCCGTGACTAAAGCCAACAGTGGACGATACTCCCTGAGAGCCACCAATGGATCTGGACAAGCG

ACTAGTACTGCTGAGCTTCTTGTGACAG CCGAGACAGCACCACCCAACTTCAGTCAGCGGCTGCAGAGCATGACTGTGAGACAAGGAAGCCAAGTGAGA

CTCCAAGTGAGAGTGACTGGAATCCCTACACCTGTGGTGAAGTTCTACCGGGATGGAGCCGAAATCCAGAGCTCCCTTGATTTCCAAATTTCTCAAGAAG

GAGACCTCTACAGCTTACTGATTGCCGAAGCATACCCTGAAGACTCCGGGACCTATTCTGTAAATGCCACCAACAGCGTTGGAAGAGCTACTTCCACTGC

AGAATTGGTGGTTCAAG GTGAAGAAGTAGTACCTGCTAAAAAGACAAAGACGATCGTGTCGACTGCTCAGATTTCAGAAACAAGACAAACCCGGATTGA

AAAA AAGATTGAAGCCCACTTTGATGCCAGATCAATCGCAACAGTTGAGATGGTCATAGATGGTGCCACTGGACAGCTGCCACATAAAACACCTCCCAG

GATACCTCCTAAGCCCAAGTCCAGGTCTCCGACACCACCTTCCATTGCTGCCAAAGCACAGCTGGCCAGACAACAGTCCCCATCACCAATAAGACACTCT

CCCTCCCCAGTCAGACACGTGCGGGCACCAACCCCATCTCCAGTCAG GTCCGTGTCTCCAGCGGGGAGGATCTCCACTTCCCCGATCAGATCCGTGAAG

TCGCCACTGCTCATTCGCAAGACTCAGACCACCACCATGGCCACAGGCCCCGAGGTGCCTCCCCCTTGGAAGCAAGAGGGCTACGTGGCCTCCTCGACTG

AGGCTGAGATGAGAGAGACGACAATGACAAGCTCTACCCAGATCAGAAGAGAAGAGAGGTGGGAAGGGAGATACGGGGTCCAGGAGCAAGTGACCATCAG

TGGAGCCGCGGCTGCTGCGGCCAGTGCGTCGGTCAGCTCGTCATTCACGGCAGGAGCCATCACCACTGGGACTAAGGAG GTGAAACAAGAGACAGACAA

GAGTGCAGCTGTTGCGACTGTCGTTGCTGCTGTTGATATGGCCAGAGTGAGAGAACCAGCCATCAGTGCTGTAGAGCAAACTGCTCAGAGGACAACCACG

ACTGCTGTGCATATACAACCTGCTCAAGAACAG GCGAGAAAAGAGGCGGAGAAGACCGCAGTAACCAAGGTTGTAGTTGCTGCCGATAAAGCCAAGGAA

CAGGAACTAAAATCACGAACCAGAGAAGTGATGGTGACAACGCAAGAGCAGACTCACATATCTCATGAGCAG ATAAGAAAAGAAACTGAAAAAGCATTT

GTACCAAAGGTAGTGATCTCCGCAACCAAAGCCAAAGAGCAAGAAACTAGAATCACGGGAGAAATTACTACAAAACAAGAGCAAAAGCGAATAACTCAAG

AAACA ATGATGAAGGAAACTAGGAAAACAGTGGTACCCAAAGTCATAGTTGCCACGCCCAAGATTAAAGAGCAAGATTTAGTATCAAGAAGTAGAGAAG

CCATCACTACCAAAAGAGATCAAGTTCAAATAACTCAGGAAAAG AAGAGAAAGGAAGTGGAAACAACTGCCTTGTCTACAATAGCAGTTGCTACTGCTA

AAGCCAAAGAGCAAGAAACAGTTCTGAGGTCTAGAGAAGCCATGGCCACTAGACAAGAACACATCCAAGTTACCCATGGACAG GTGGGCGTTGGGAAGA

AGGCAGAAGCCGTGGCAACAGTTGTAGCTGCTGTGGACCAGGCCCGAGTGAGGGAACCCAGAGAGCCTACGCATGTGGAGGAATCGCATTCTCAGCAGAC

TACGTTAGAGTATGGCTACAAAGAACACATTTCCACCACAAAGGTCCCAGAGCAGCCCCGGCGCCCAGCCTCAGAGCCCCACGTTGTCCCTCAAGCAGTC

AAGCCTGCTGTGATTCAGGCTCCTTCTGAGACTCATATCAAAACTACTGACCAAATGGGAATGCATATATCGTCACAG GTCAAGAAAACTACAGATATC

TCAACAGAAAGATTAGTTCATGTGGATAAACGCCCCCGCACAGCGAGCCCTCACTTTACTGTTTCAAAAATTTCTGTACCTAAGACAGAACATGGATATG

AG GCATCGATAGCTGGTAGCGCTATCGCCACACTACAAAAAGAATTGTCAGCCACATCTTCAACTCAGAAGATCACCAAATCCGTGAAGGCACCCACCG

TGAAGCCTGGGGAGACGAGAGTAAGGGCGGAGCCCACCCCTTCCCCACAGTTCCCCTTTGCTGACATGCCGCCGCCAGACACTTACAAGAGTCAGGCTGG

CATTGAGGTGAAGAAGGAAGTCGGGGTGAGCATCAGTGGCAGCACCGTTCGTGAGGAGCACTTCGAAGTACTGCGCGGACGTGAAGCCAAG GTAACAGA

GACAGCACGAGTGCCTGCTCCTGCTGAAGTGCCTGTTACTCCGCCTACCTTGGTCTCG GGCTTAAAAAACGTGACTGTCATAGAAGGCGAATCTGTCAC

CTTGGAGTGCCACATCTCTGGATACCCATCCCCCAAGGTGACATGGTACAGAGAAGACTACCAAATCGAAAGTTCCATTGATTTCCAGATAACCTTCCAG

GGTGGAATTGCTCGTCTCATGATCCGCGAAGCCTTTGCGGAAGACAGCGGACGGTTTACCTGCAGCGCCGTGAATGAGGCCGGGACCGTCAGCACTTCCT

GCTATCTTGCTGTGCAAG TGTCAGAAGAGTTTGACAAGGAAACAACTCTGACTGAGAAATTTGCCACCGAAGAGAAACG CTTCGTGGAGTCAAGAGAT

GTAGTCATGACCGACACCAGCATCACAGAGGAGCAGGCAGGGCCTGGAGAGCCTGCTGCGCCTTTCTTCATTTCAAAGCCGGTGGTCCAGAAACTGGTGG

AGGGTGGGAGTGTTGTGTTTGAATGCCAGATCGGCGGCAACCCAAAGCCCCACGTCTACTGGAAAAAATCTGGCGTTCCTCTCACCACTGGATACAG AT

ACAAAGTGAGTTATAACAAGCAGACTGGGGAATGCAGACTGGTGATTTCTATGACGTTCGCTGATGATGCTGGAGAATACACTATTGTCATCCGAAACAA

GCACGGGGAGACGTCTGCATCTGCCTCCTTGCTGGAGGAAG CTGATTACGAGGCATTGGTGAAGACTCAGCAAGAAATGCTTTACCAGACACAAATGAG

CACATTTATTCAAGAACCCAAAGTGGGGGAAATAGCACCTGGATTTGCATATTCTGAATATGAGAAGGAATATGAAAAGGAACAGGCCTTAATTAGGAAG

AAAATGGCCAAAGATACTGTGATGGTCAGGACTTTTGTAGAAGACCAA GAATTCCACATCTCTTCTTTTGAAGAGAGGCTCATTAAAGAGATTGAATAC

AGAATAATAAAGACTACGCTGGAAGAACTTCTTGAGGAGGATGGAGAAGAGAAGATGGCAGTCGACATTTCTGAATCTGAAGCTATCGAGTCAGGATTTG

ATATAAGGATAAAAAATTATAGAATTCTTGAGGGGATGGGTGTCACTTTTCATTGCAAGATGTCTGGATATCCGTTACCCAAG ATTGCGTGGTATAAGG

ATGGCAAGCGCATCAGACATGGGGAAAGATATCAAATGGACTTTCTACAAGATGGCAGAGCCAGCCTGCGTATACCTGTTGTCCTTCCAGAGGACGAGGG

CATCTATACTGCATTTGCCAGCAATATCAAAGGAAATGCGATTTGCTCTGGGAAGCTGTACGTGGAGCCTGCTGCACCATTTAGCGCTCCAACTTACATG

CCCACACCAGAAGCAGTGAGCAGAATCAG GTCTGTCTCTCCACGTTCACTGAGCAGGTCACCTATACGTATGTCTCCTGCGATGTCCCCTGCACGAATG

TCCCCCGCACGGATGTCCCCTGCACGGATGTCCCCCGCACGGATGTCTCCTGGACGCAGGCTGGAGGAGACAGATGAATCACAGCTGGAGAGACTGTATA

AGCCAGTCTTTGTATTAAAACCTGCTTCTTTCAAATGTTTAGAAGGACAGACTGCCAGATTTGACTTGAAGGTTGTGGGCAGACCCATGCCAGAGACATT

CTGGTTTCACAATG GACAGCAAATTGTCAATGATTATACGCACAAAGTCGTCATTAAAGAAGATGGAACTCAGTCACTGATCATTGTCCCTGCGTCACC

CAGCGATTCAGGAGAATGGACAGTGGTGGCCCAAAACAGAGCAGGAAAATCCACAATATCTGTGACTTTAACTGTAGAAG CTGTGGAACACCAGATCAA

GCCAGCATTTGTGGAAAAACTGAAAAATGTCAACATAAAGGAAGGTTCCAGGCTCGAAATGAAAGTCAGAGCTACAGGCAACCCCAACCCTGACATTGTG

TGGCTGAAAAACAGTGACATCATTGTTCCTCATAAATACCCAAGGATCAG GATTGAAGGAACCAGAGGAGAAGCCGCCCTTAAGATTGATTCCATTATC

AGCCAAGATTCAGCCTGGTATACAGCCACGGCTATTAACAAGGCAGGCCGAGACACCACAAGGTGCAAAGTCAATGTTGAGGTTGAGTTTGCAGAACCTG

AACCGGAAAGAAAGCTGATTATTCCACGAGGAACGTACAGAGCAAAGGAGATTGCTGCCCCAGAACTGGAGCCTCTCCATTTGAGATACGGTCAAGAACA

GTGGGAGGAGGGTGACCTCTATGACAAGGAGAAACAACAGAAACCGTTTTTCAAGAAAAAACTCACTTCCCTCAGACTGAAGCGCTTTGGACCTGCCCAC

TTTGAGTGCAGACTCACACCAATTGGTGACCCAACCATGGTGGTGGAGTGGCTTCACGATGGGAAGCCCCTGGAGGCGGCCAACAGGCTTCGGATGATTA

ATGAATTCGGCTACTGCAGCCTTGATTATGGAGCAGCGTATTCCAGAGACAGTGGTGTCATCACCTGCAGAGCTACTAACAAATATGGGACAGATCACAC

CTCTGCTACTCTTATTGTCAAAGATGAGAAAAGCCTAGTGGAAGAATCTCAACTGCCTGATGGGAAAAAAGGCTTACAGAGGATAGAAGAACTAGAGAGA

ATGGCTCACGAAGGTGCGCTGACAGGTGTGACAACAGATCAAAAAGAAAAACAAAAGCCAGACATTGTCTTGTTCCCAGAGCCAGTGAGAGTGCTGGAAG

GGGAGACAGCCAGATTCCGCTGCCGAGTGACAGGCTACCCTCAGCCCAAGGTCAACTGGTACCTCAATGGACAGCTCATCCGGAAAAGCAAAAGGTTCAG

AGTTCGCTATGATGGCATTCACTATCTGGATATTGTGGACTGCAAATCCTATGACACAGGTGAAGTCAAGGTCACTGCGGAAAATCCTGAAGGTGTGACG

GAACACAAAGTAAAACTTGAAATCCAACAGAGGGAGGATTTCAGATCTGTCCTTAGGCGTGCTCCCGAGCCAAAGCCCGAGTTTCATGTACACGAACCGG

GGAAACTTCAGTTCGAAGTGCAGAAGGTAGACAGACCCGTGGACACCAGCGAAACCAAAGAAGTGGTGAAGCTGAAAAGGGCTGAAAGGATTACCCATGA

GAAGGTGTCCGAGGAGTCTGAAGAACTGCGCAGTAAATTTAAGCGCCGGACGGAAGAGGGATACTATGAAGCCATCACAGCCGTGGAGCTGAAGTCTCGC

AAGAAGGATGAGTCTTACGAAGAGCTCCTCAAGAAAACTAAAGATGAGCTTCTGCACTGGACCAAAGAGTTAACTGAAGAGGAGAAGAAAGCCTTGGCTG

AAGAAGGCAAAATCACGATTCCAACCTTTAAACCTGAGCGAATCGAACTTAGCCCTAGTATGGAGGCACCCAAAATCTTTGAACGAATCCAGAGCCAGAC

CGTTGGCCAAGGATCTGATGCTCACTTTAGAGTCAGGGTTGTGGGAAAACCAGACCCTGAGTGTGAATGGTATAAAAATGGTGTAAAAATTGAGCGATCT

GACCGAATCTACTGGTACTGGCCAGAAGACAATGTTTGTGAACTGGTCATAAGAGATGTAACTGCAGAGGACTCTGCCAGCATCATGGTAAAGGCCATCA

ACATAGCTGGGGAAACCTCAAGCCACGCATTCCTGCTCGTCCAAG CCAAGCAACTGATCACTTTTACACAAGAATTGCAAGATGTTGTTGCTAAGGAAA

AGGACACCATGGCAACATTTGAATGTGAAACTTCAGAACCATTTATCAAAGTAAAATGGTATAAAGATGGTATCGAAGTTCATGCAGGGGATAAGTATAG

GATGCACTCTGACCGAAAAGTTCACTTCCTGTCTGTGCTGACCATCGACACATCTGATGCTGAAGACTACAGCTGTGTACTTGTGGAAGATGAAAATATC

AAGACGACAGCGAAACTTATTGTGGAAG GTGCAGTAGTTGAATTTGTGAAAGAACTTCAGGACATAGAAGTCCCAGAGTCATACTCAGGAGAGTTAGAG

TGCATCATATCTCCAGAAAACATAGAAGGCAAATGGTATCACAATGATGTGGAGTTGAAGTCCAATGGCAAATACTCAATTACATCCCGCCGTGGGCGCC

AGAACCTCACAGTCAAGGATGTAACCAAAGAGGACCAGGGAGAGTACAGCTTTGTTGTTGATGGGAAAAAGACAACCTGTAAACTGAAGATGAAAC CCC

GACCTATTGCTATTCTCCAAGGACTTAGCGATCAAAAGGTCTGCGAGGGTGACATTGTTCAACTTGAAGTCAAAGTCTCCTTAGAAAATGTAGAAGGTGT

CTGGATGAAAGATGGTCAAGAAGTACAACACAGTGACAGAGTTCACATTGTAATAGACAAGCAGTCCCACATGCTACTTATTGAAGACATGACCAAAGAA

GATGCTGGGAATTACTCCTTCACTATTCCTGCCCTTGGACTCTCCACCAGTGGGAATGTCTCTGTCTATA GTGTTGATGTGATAACACCTCTCAAAGAT

GTCAATGTGATTGAAGGTACCAAGGCTGTACTTGAATGCAAGGTCTCAGTTCCCGATGTAACTTCTGTTAAATGGTACCTAAATGATGAACAAATCAAGC

CTGATGATCGTGTGCAATCCATTGTCAAAGGCACCAAACAGCGACTTGTGATTAACCGAACCCATGCTTCTGATGAAGGACCTTACAAGCTGATGGTTGG

CAGGGTGGAAACCAGCTGTAACCTGTCTGTAGAGA AAATTAAAATTATCAGAGGTCTCCGTGACCTTACCTGCACAGAAACACAAAATGTGGTCTTTGA

GGTTGAGCTATCCCACTCAGGAATTGATGTTGTATGGAATTTTAAGGGCAAGGAAATTAAGCCCAGTTCTAAATATAAAATTGAAGCTCATGGGAAAATA

TACAAACTGACAGTCCTCAATATGATGAAAGATGATGAAGGGGAGTATGCATTCTATGCAGGAGAAAATACAACATCTGGAAAGCTAACTGTGGCAG GA

GGAGCCATCTCCACACCACTCACAGACCAGACTGTGGCTGAATCCCAGGAGGCTGTGTTTGAATGTGAAGTTGCCAACCCTGAGTCTGAGGGGGAATGGC

TGAAGGATGGAAAGCACTTGGCTCTGAGTAACAACTTCAGAGGTGAATCCGATGGCCACAAAAGGAGGCTTGTCATCGCTGCCGCCAAGTTAGATGACGC

TGGAGAATATACCTACAAGGTGGCTACCTCCAAAACATCTGCCAAGCTGAAAGTTGAAG CTGTCAAAATTAAGAAGACCCTGAGGAACCTCACTGTGAC

AGAGACACAGGATGCAGTCTTCTCTGTTGAACTCACACACCCAGATGTCAAAGGGGTCCAGTGGATCAAAAACGGAGTTGTCTTAGATTCCAACGACAAG

TATGAGATCTCAGTCAAAGGGACACTTTATTCACTGAAGATTAAAAACTGTGCCATGGCAGATGAATCTGTCTACGGCTTCAAACTGGGGAGGCTAGGAG

CTAGCGCCCGGCTGCACGTTGAGA CTGTCAAGATTATTAAGAAACCAAAGGACGTGACCGCCTTGGAAAACGCCACTGTTACCTTCGAAGTCAGTGTTT

CCCATGACACGGTGCCAGTAAAATGGTTCCATAAGAACGTGGAGATTAAGCCAAGTGACAAGCACAGACTGGTCTCAGAGAGAAAAGTCCACAAACTCAT

GCTTCAGAGCATCTCCCCCTCGGATGCCGGCGAGTACACAGCCATGGTGGGCCAGCTGGAGTGCAAAGCCAAGCTGTTTGTGGAGA CACTCCATATCAC

AAAGACTATGAAAAGTATCGAGGTTCCTGAAACCAAAGCTGCCTCTTTCGAGTGTGAGGTGTCCCACTTCAATGTCCCCTCCATGTGGCTAAAGAACGGA

GTGGAAATTGAGATGAGTGAAAAATTCAAGATCGTCGTGCAGGGGAAACTGCACCAGCTGATCATCATGAACACGAGCACGGAGGACTCAGCGGAATACA

CATTTGTTTGTGGCAATGACCAAGTCAGTGCTACCCTGACAGTGACCC CAATCATGATTACATCCATGCTGAAAGACATCAATGCTGAAGAAAAAGATA

CCATAACTTTTGAGGTGACAGTAAACTATGAAGGCATCTCTTACAAATGGTTAAAGAACGGTGTGGAGATCAAGTCGACTGACAGGTGCCAGATGAGAAC

CAAGAAGCTCACGCACTCGCTGAACATCAGGAATGTTCACTTTGGAGATGCTGCTGATTATACTTTTGTGGCTGGAAAAGCCACATCGACGGCCACCCTT

TATGTGGAAG CTCGTCATATAGAATTTAGGAAACACATTAAGGATATTAAGGTTCTGGAGAAGAAACGAGCCATGTTTGAATGTGAAGTTTCTGAGCCC

GACATAACTGTTCAGTGGATGAAAGATGGCCAAGAGCTTCAGATAGCAGACAG GATAAAGATCCAGAAGGAGAAATATGTCCACCGCCTTCTGATCCCA

TCCACACGCATGTCTGATGCCGGGAAATATACAGTGGTGGCAGGAGGCAACATGTCAACTGCTAACCTCTTTGTCGAAGGCAGGGATGTCCGCATCCGGA

GCATTAAGAAGGAGGTCCAG GTCATTGAGAAGCAGCGTGCTGTCGTGGAGTTCGAAGTCAATGAGGATGACGTAGACGCCCACTGGTATAAAGATGGCA

TTGAAATCAACTTCCAAGTTCAAGAGCGACACCAGTATGTGGTGGAGAGAAGAATTCACCGGATGTTTATATCAGAAACAAGACACAGTGACGCAGGCGA

ATACACCTTTGTGGCAGGCAGAAACAGGAGTTCTGTGACTCTTTATGTCAATG CTCCAGAACCACCCCAAGTCCTGCAGGAACTCCAGCCTGTCACTGT

ACAGTCCGGCAAGCCGGCTCGCTTCTGCGCCGTGATATCAGGCAGACCGCAGCCCAAAATTTCCTGGTACAAGGAGGAGCAGCTGCTTTCCACTGGCTTC

AAGTGCAAATTTCTGCACGACGGGCAGGAGTACACACTTCTGCTCATTGAGGCTTTCCCAGAGGATGCGGCAGTCTACACCTGTGAAGCCAAGAATGACT

ACGGAGTAGCCACAACGTCGGCTTCTCTGTCCGTGGAAG TTCCAGAAGTTGTATCTCCGGATCAGGAAATGCCAGTCTACCCGCCTGCCATAGTCACTC

CACTTCAGGACACAGTTACTTCTGAGGGGCGCCCAGCGCGTTTCCAGTGCCAAGTTTCAGGGACAG ATTTGAAGGTGTCTTGGTACTGCAAAGACAAGA

AAATCAAACCATCTCGGTTCTTCAGGATGACCCAGTTTGAAGACACCTACCAGCTGGAGATCGCTGAAGCCTACCCCGAGGACGAGGGAACGTATGCCTT

TGTTGCTAATAATGCTGTGGGCCAAGTGTCCAGCACTGCCACCCTGAGGCTGGAAG CCCCCGAGTCGATTCTGCATGAGAGGATCGGCCAGCAAATCGA

AATGGAGATGAAAG AAATTGCTAGCCTTCTGTCCGCCGAGGAAGATTTTCAAACCTATAGTTCTGATCTACGTTTACCTAATGCGAATGAAACACTTGA

ACTTCTGTCTGAGCCTCCAGCTCGTTCCACCCAGTTTGATTCCAGACAGGAAGGCGCTGCCCCAGTTTTCATCAGAGAAATATCAGACGTTGAAATAAGC

GTCGAAGATGTAGCTAAATTGTCTGTTACTGTCACTGGCTGCCCCAAGCCTAAAATTCAATGGTTCTTTAATGGGATGCTGTTAACCCCTTCTGCTGACT

ACAAATTTGTCTTTGATGGGGATACCCACAGCCTAATCATTCTGTTCACCAGATTTCAGGATGAGGGGGAGTACACGTGCCTGGCCAGTAATGAATATGG

AAAGGCAGTGTGTAGCGCTCACCTAAGAATAAGTCCCAGAGGAGAGAGGAGCACGGAGATGGAGTCAGGAGAGAAAAAGGCTCTGGAAAAGCCCAAAGGG

CCTTGTCCTCCTTATTTTTTCAAGGAATTAAAACCAGTGCACTGTGGCCCAGGAATCCCTGCTGTCTTTGAGTACTCGGTGCACGGAGAGCCTGCCCCCA

CTGTCTTGTGGTTCAAAGAAGACATGCCACTTTATACCAGTGTTTGCTACACCATCATTCACAGTCCTGACGGATCCGGGACCTTCATCGTTAATGACCC

ACAGAGGGGAGATAGTGGCCTGTACCTCTGTAAAGCCCAGAACCTCTGGGGGGAGTCCACCTGTGCCGCAGAGCTTCTTGTGCTTCCAGAAGACACAGAT

GTGCCCGATGCCTCCTGCAAGGAAGAGTCCACCTTAGGAGTTCCTGGTGATTTTCTGGAAACATCTGCCAGGGGCCCTTTAGTTCAGGGAGTTGACTCAC

GGCAGGAAATTACAGCTTTTGCCGAGGGTACCATTTCGAAAGCTGCTTTAATTGCAGAGGAAACGCTGCAGCTTTCTTACGAGCGTAGTGTTGATGACAG

TGAAGTGGGTACTGGGGTGACCATAGGGGCCCAGAAGCTGCCGCCTGTTGTATTGTCCACTCCCCAGGGCACTGGGGAGCTGCCTTCCATTGATGGTGCA

GTTCACACACAGCCAGGCAGAGGACCACCCCCCACTTTAAACCTGCAGGCAGTCCAGGCTCAGACAACCCTCCCCAAGGAAGCTACTCTACAGTTTGAAG

AGCCTGAGGGAGTCTTCCCAGGTGCCTCATCTGCAGCACAAGTGAGTCCGGTCACCATCAAACCTCTGATAACCTTAACAGCTGAACCCAAAGGGAATTA

TCCACAGTCTTCCACAGCAGCTCCTGATCATGCACTTCTGTCCTCTGTGGCTGCAGAAACACTTCAGCTAGGAGAAAAGAAAATCCCAGAAGTGGACAAA

GCACAAAGAGCTCTCCTCCTGAGTCAGAGCTTAGCTGAGGGATGTGTAGAAAGTTTAGAGGTTCCTGATGTTGCAGTCTCTAACATGCGCTCTGAGCCCC

AAGTCCCTTTCCAACATACATGCACAGAAGGCAAGATCCTGATGGCTAGTGCAGACACTCTAAAAAGCACAGGGCAAGATGTTGCACTGAGGACCGAGGA

AGGCAAGTCCCTAAGCTTCCCACTAGCACTTGAGGAAAAGCAGGTCCTACTTAAGGAAGAGCAATCAGAGGTCGTGGCAGTGCCCACTAGCCAAACCTCT

AAGTCTGAGAAAGAGCCAGAGGCCATAAAGGGAGTGAAGGAGGTACGAGAACAGGAGCTGCTTTCTAAGGAAACATTGTTTCCTAGTATGCCTGAAGAGC

AGCGATTACATCTGAAAACTCAGGTCCGCAGGGCTTTGCAAGCTGCCGTGGCCAGGGAACAAGCAAATCTTTTCTCTGAGTGGCTAAGAAACATTGACAA

GGTGGAGGTCACAGCCGTAAACTTCACTCAAGAGCCCAAGCGTATCCTGTGCACCTACCTTATTACCTCAGTGAGCTCACTAACCGAAGAGTTAACCGTC

ACTATTGAAGACATAGATCCTCAAATGGCTAACCTGGAAACTGGACTGAAGGATGCCTTGTGCTCCATTGTCTGTGAAGAAAGAAACATCTTAATGGCTG

AGGATCCGAGGATTCACGAAGAAGACAAAATAGACGTGCAAGGCGGAAGAGATCACCTTTCAGATGCACAGAAAGTTGAAACCGTCATAGAGGCAGAAGC

TGACTCTAAGTACCTTGTCTCCAAAGAAGAGGTCAGTTGGTCGAAAGTGGAAAGTCAACTCAAAGATGGAGATACCAATGAGGTTCCGCAGGCTGAGACT

CTGAAATTAGCAGAAGAGAGTGGTACCCAGAAGACCAGTACAGAGATGTCACAAGAAGAAGCTGAGGGTACCTTAGCTGACCTTTGCCCTGCTGTCCTTA

AACACTTAGTGGATACCATTTCTGAGGAAGGAGATACTGTCCACCTTACATCATCCATATCAAATGCTAAGGAGGTGCACTGGTATTTCAAGGGTAACCT

GGTGCCCTCAGACGGAAAGTTCAAGTGTTTAAAGGAGCAGAATGCCTACACTCTGGTAATTGAGGCAGTAAAGACGGAGGATGAAGGGGAGTATGTCTGC

GAAGCCTCAAATGACAGTGGGAAAGCAAAGACATCAGCAAAGCTCACTGTGGGAGAAAGAG CTGCCCCTGTGATCAAAAGGAGAATTGAGCCCCTGGAA

GTAGCTCTGGGCCACCTGGCCAAATTCACCTGTGAGATCCAAGGAGCCCCCAACGTCCGGTTCCAGTGGTTCAAAGCTGGCAGAGAGATCTATGAGAGCG

ACAAGTGTTCCATTCGATCTTCGAACTATGTCTCCAGCCTGGAGATCCTGAGAACCCAGGTCGTTGACTGCGGGGAGTACACCTGCAAAGCCTCCAATGA

GTATGGCAGTGTCAGCTGCACAGCCACACTAACTGTGACAG - UNI36362 - TGCCTACAGCTGAAAAGAAAGTTCGTAAATTACTTCCTGAACCTA

AGCCGCAGCCAAAGGAAGAGGTGGTGCTGAAAAGCG - UNI36362 - TTCTAAGAAAGAAACCCGAGGAAGAAGAACCTAAAGTAGAACCTAAAAAA

GTAGAAAAAGCTAAAAAACCGGAAG AGCCACAGCCACCTCCAAAAGCCGTTGAAGTTGAAGCTCCTCCAGAGCCTACACCAAAGGAAAGGAAAGTTCCA

GAACCGGCCAAAG - UNI17655 - TTCCTGAAATTAAGCCAGCGATACCTCTCCCTGGACCTGAACCAAAGCCAAAGCCTGAGCCAG - UNI1765

5 - AGGTGAAAACCATGAAAGCTCCACCCATCGAGCCGGCACCCACTCCCATCGCTGCCCCCGTGACAGCGCCTGTGGTTGGGAAGAAAGCAG AAGCC

AAACCTAAGGATGAGGCTGCCAAGCCAAAAGGTCCCATCAAAG GTGTAGCCAAAAAGACTCCTTCACCAATAGAAGCTGAAAGGAAAAAGCTCAGACCA

GGAAGCGGTGGAGAGAAACCTCCAGACGAAGCTCCGTTCACTTACCAACTCAAGGCCGTGCCACTGAAATTCGTGAAAGAAATCAAAGACATCGTTTTGA

CAGAGGCAGAGTCTGTGGGCTCTTCTGCCATCTTCGAATGTTTGGTCTCCCCATCCACTGCCATTACAACCTGGATGAAGGACGGCAGCAACATCCGTGA

GAGCCCAAAGCACAGATTCATTGCAGACGGCAAAGACAGGAAGCTGCACATTATCGACGTTCAGCTGTCTGATGCTGGTGAATACACCTGTGTGCTACGC

TTGGGAAATAAAGAGAAGACGTCCACTGCTAAGCTCATCGTAGAAG AACTTCCTGTGCGCTTTGTGAAAACACTGGAGGAGGAAGTCACGGTGGTCAAG

GGGCAGCCGTTGTACTTGAGCTGTGAGTTGAACAAAGAACGCGATGTGGTCTGGAGGAAGGATGGTAAGATTGTGGTGGAGAAACCTGGCAGGATCGTGC

CTGGTGTCATTGGCCTGATGCGGGCCCTGACCATCAATGATGCTGATGACACTGATGCCGGAACATACACTGTGACTGTGGAAAATGCCAACAACCTGGA

ATGTTCTTCTTGTGTAAAAGTAGTAG AAATCATTAGAGAATGGCTTGTGAAACCTATCCGAGATCAGCATGTGAAGCCCAAGGGAACAGCTGTTTTCAC

CTGTGACATAGCCAAGGACACGCCAAACATTAAGTGGTTCAAAGGCTATGACGAGATCCCCTTGGAACCAAACGACAAGACTGAGATACTGAAAGAGGGA

AACCACCTCTTTCTCAAGGTTAAGAATGCTATGCCAGAAGATATTGATGAGTATGCAGTGGAAATTGAAGGGAAAAGATACCCAGCAAAGCTGACACTTG

GAG AGCGCGAAGTTGAGCTACTTAAGCCGATAGAAGATGTCACCATTTATGAGAAGGAAAGTGCCAGCTTTGATGCAGAAATCTCAGAGGAAGACATTC

CTGGGGAGTGGAAGCTGAAGGGCGAGCTTCTGCGGCCCTCGCCT ACTTGTGAAATCAAAGCTGAAGGTGGGAAGCGCTTCTTAACTTTGCACAAAGTGA

AACTGGACCAAGCTGGCGAAGTCCTCTACCAGGCTTGCAATGCGATCACAACTGCCATTCTGACAGTCAAAG AAATCGAGCTTGACTTTGCTGTACCCC

TGAAGGATGTGACTGTCCCAGAGAAGAGACAGGCTCGGTTTGAATGTGTCCTCACCAGAGAGGCAAATGTCATATGGTCTAAAGGGCCTGATATAATCAA

GGCATCTGACAAATTTGATATTATTGCTGATGGAAAGAAACACATTCTTGTTATCAACGACTCTCAGTTTGACGATGAAGGAGTCTATACTGCAGAGGTG

GAGGGCAAGAAGACGTCAGCACAATTATTTGTGACAG GCATAAGACTTAAGTTCATATCACCACTGGAAGATCAAACAGTAAAAGAAGGCCAAACAGCA

ACTTTTGTCTGTGAGCTCTCTCATGAAAAAATGCACGTGGTCTGGTTCAAAAACGATGTCAAGCTACACACAACCAGGACAGTGCTCATGTCTTCTGAGG

GAAAGACTTATAAGCTGGAGATAAGGGAGACCACACTGGATGATATCTCACAGATCAAAGCTCAAGTGAAGAACCTCAGCTCTACAGCCAACCTGAAGGT

CTTGG AGGCCGATCCCTACTTCACCGTGAAATTACACGACAAGACTGGCGTGGAGAAGGACGAGATCATTCTTAAGTGTGAAGTGAGCAAAGATGTTCC

GGTCAAATGGTTCAAAGACGGGGAAGAGATTGTGCCTTCGCCCAAACATTCTGTCAAGACCGACGGCCTGCGCCGCATCTTAAAGATCAAGAAGGCAGAG

CTCAAAGACAAAGGGGAATATGTGTGCGACTGCGGTACAGACACCACCAAGGCCAACGTCACTGTTGAGG CTCGACTCATAAAAGTGGAGAAACCCCTG

TACGGCGTGGAAGTGTTTGTGGGTGAAACCGCCCGCTTTGAAATTGAACTGTCTGAACCTGACGTGCATGGCCAGTGGAAGTTAAAGGGAGAGCCTTTGA

CTGCTTCTCCT GACTGCGAAATCATCGAAGATGGGAAGAAACATGTCTTGGTTCTGTATAACTGTCAGCTGGATATGACCGGGGAGATATCCTTCCAGG

CCGCCAACGCTAAATCAGCAGCCAACCTGAAAGTGAAAG AACTGCCGCTCATTTTCATCACCCCTCTGAGTGACGTCAAAGTCTTTGAGAAAGATGAGG

CGAAGTTTGAGTGTGAAGTATCCAGGGAGCCCAAAACATTCCGCTGGCTGAAAGGAACCCAGGAAATCACTGGTGATGACAGATTTGAGCTCATCAAGGA

TGGCACCAGGCATTCATTGGTGATCAAGTCAGCAGCTTTTGAAGATGAGGCCAAATACATGTTTGAAGCTGAAGATAAACGCACAAGCGGCAAACTGATC

ATTGAAG - UNI35827 - GAATCCGTCTCAAATTCCTGACCCCACTCAAGGATGTGACAGCCAAAGAAAGGGAAAATGCCGTGTTTACTGTGGAGCT

GTCCCATGACAACATCCCAGTGAGCTGGTTCAAGAACGACCAGCGCCTGCACACCAGCAAGCGGGTCTCCATGCATGATGAAGGGAAAACACACTCCATC

ACGTTCAAAGACCTGTCTATTGACGACACCTCCCAAATTAGAGTGGAGGCCATGGGGATAAGTTCAGAGGCTAAGCTCACTGTGCTGG - UNI35827 

- - UNI35899 - AGGGAGACCCATACTTCACAGGAAAGCTTCAAGATTACACAGGCGTGGAGAAGGATGAAGTGATTCTTCAGTGTGAAATCAGCAA

AGCAGACGCACCCGTGAAATGGTTTAAGGACGGGAAGGAAATTAAGCCGTCTAAAAACGTTGTTATCAAGGCTGACGGCAAGAAACGCATGCTGATCCTG

AAGAAGGCCTTGAAATCAGATATCGGCCAATATACCTGTGACTGTGGGACAGACCAGACCTCTGGGAAGCTGGACATTGAAG - UNI32138 - - UN

I35827 - - UNI35899 - ATCGGGAAATTAAACTGGTGCGACCCCTGTACAGCGTGGAGGTGATGGAGACCGAGACGGCCCGCTTTGAAACTGAGA

TCTCTGAAGATGATATACATGCCAACTGGAAACTGAAGGGAGAGGCACTGCTCCAAACACCT - UNI32138 - - UNI33036 - - UNI35899 

- GAATGTGAAATTAAAGAAGAAGGCAAGATCCACGTCCTTATCTTACACAACTGCCGCCTAGACCAGACTGGAGGTGTAGATTTCCAAGCTGCCAATGT

CAAATCTAGTGCCCACCTCCGAGTTAAAC - UNI32138 - - UNI32541 - - UNI33036 - CACGGGTAATTGGTCTGCTGAGGCCTCTAAA

GGATGTTACAGTGACCGCAGGGGAAACGGCCACCTTTGACTGCGAGCTCTCCTATGAGGATATCCCAGTGGAATGGTACCTCAAAGGGAAGAAGCTGGAG

CCTAACGATAAG - UNI14991 - - UNI16643 - - UNI32541 - - UNI33036 - GTGGTGACACGTTCAGAAGGAAGAGTTCACACGCT

CACCCTGAGGGATGTGAAGCTAGAAGATGCTGGCGAAGTCCAACTAACTGCAAAGGATTTCAAAACTCAGGCCAATCTCTTTGTGAAAG - UNI14991

 - - UNI16643 - - UNI32541 - AACCCCCGGTTGAGTTCACTAAGCCTCTTGAGGACCAGACGGTCGAAGAGGAGGCCACTGCAGTACTGGAG

TGTGAAGTATCCAGAGAAAATGCCAAAGTGAAATGGTTCAAAAATGGGACAGAAATCCTCAAAAGCAAGAAGTATGAAATCGTTGCTGATGGCAGGGTCA

GGAAGCTCATTATTCATGGTTGTACCCCAGAGGATATCAAAACGTACACTTGTGATGCTAAAGATTTTAAGACCTCCTGTAACCTGAATGTTGTTC - U

NI14991 - CTCCTCATGTGGAATTCTTAAGACCACTCACAGACCTCCAAGTCAAAGAAAAAGAAACTGCTCGGTTCGAGTGCGAAATTTCCAAAGAAA

ATGAGAAG GTTCAGTGGTTTAAAGATGGTGCTGAAATTAAAAAGGGCAAAAAGTATGACATCATTTCTAAGGGAGCAGTACGAATTCTTGTCATCAACA

AATGTCTACTGAATGATGAAGCAGAATATTCCTGTGAAGTGAGGACAGCAAGAACTTCCGGCATGCTGACAGTCCTAG AAGAAGAAGCTGTCTTCACAA

AAAATCTTGCCAACCTTGAAGTTAGTGAAGGAGACACTATCAAACTGGTGTGTGAAGTCTCCAAGCCTGGGGCAGAAGTGATTTGGTACAAAGGGGATGA

GGAGATCATCGAAACAGGGAGATTTGAAATACTTACTGATGGAAGGAAGAGAATCTTGATCATTCAGAATGCGCAGCTTGAGGATGCAGGCAGCTACAAC

TGTCGACTCCCAAGTTCTCGAACGGACAGCAAAGTCAAAGTACACG AACTTGCTGCTGAGTTCATCTCGAAGCCTCAAAACCTTGAAATTCTTGAAGGA

GAAAAGGCTGAGTTTGTCTGCACTATCTCAAAGGAAAGCTTCGAAGTTCAGTGGAAGAGGGATGATCAGACACTTGAATCTGGAGATAAATATGACATCA

TTGCTGATGGCAAAAAGAGAGTCCTAGTTGTAAAGGATGCCACATTACAAGACATGGGCACTTACGTAGTCATGGTTGGGGCTGCCAGAGCCGCAGCTCA

CCTGACAGTCATTG AAAAACTCAGGATCATAGTTCCTCTTAAGGACACCAAGGTGAAGGAACAACAAGAGGTTGTCTTCAACTGCGAAGTCAATACTGA

AGGTGCCAAAGCCAAATGGTTCAGAAATGAAGAAGCCATATTTGATAGTTCAAAATACATCATTCTCCAAAAAGACCTGGTCTACACCCTCAGAATCAGA

GATGCACGGTTAGATGACCAAGCCAACTTTAATGTGTCTTTGACCAATCACAGAGGTGAAAATGTTAAAAGTGCAGCCAATCTAATAGTGGAAG AGGAA

GATCTTAGGATTGTTGAACCTCTTAAAGATATTGAAACAATGGAGAAGAAGTCAGTCACATTCTGGTGCAAGGTGAATCGTCTCAATGTGACACTGAAGT

GGACCAAAAATGGAGAAGAAGTGGCTTTTGACAACCGTATATCATACCGAATTGATAAGTACAAACACTCTCTAATCATCAAGGACTGTGGCTTCCCAGA

TGAAGGTGAATACGTCGTCACTGCTGGGCAAGATAAATCCGTGGCAGAGCTGCTCATCATAGAAGCCCCAACAGAATTCGTGGAGCACCTGGAAGACCAG

ACGGTCACAGAGTTTGATGACGCTGTCTTCTCCTGCCAGCTCTCCAGAGAGAAAGCGAATGTAAAATGGTACAGAAATGGAAGAGAAATCAAGGAAGGCA

AAAA ATACAAGTTTGAGAAGGATGGGAGCATCCACAGGCTCATCATAAAAGACTGCAGGCTGGAGGATGAGTGTGAATACGCTTGTGGTGTAGAGGACC

GCAAGTCCCGAGCTAGACTTTTTGTAGAAG AAATTCCAGTTGAGATTATCAGGCCTCCTCAAGACATTCTTGAAGCCCCTGGTGCAGACGTTATCTTCT

TGGCTGAGCTCAACAAAGATAAAGTGGAGGTCCAATGGCTTAGAAATAACATGATCGTCGTCCAGGGTGACAAGCACCAGATGATGAGTGAAGGAAAGAT

ACACAGGCTACAGATTTGTGATATTAAGCCACGTGACCAGGGCGAATACAGATTCATTGCCAAAGATAAAGAAGCCAGGGCTAAACTTGAATTAGCAG C

TGCACCTAAAATCAAGACAGCTGATCAAGATCTCGTCGTTGATGCTGGCCAGCCTCTGACAATGGTGGTACCCTATGATGCCTACCCCAAAGCAGAAGCT

GAATGGTTTAAAGAGAACGAACCTCTATCTACAAAAACCGTTGACACTACGGCTGAGCAGACTTCTTTCAGAATCTCAGAAGCCAAGAAGGACGACAAGG

GGAGGTATAAAATCGTGCTTCAGAACAAGCATGGGAAAGCAGAGGGCTTCATCAATTTACAAGTTATTG ATGTTCCCGGGCCAGTTCGTAACTTAGAAG

TGACAGAAACATTTGATGGTGAAGTAAGCCTCGCCTGGGAGGAACCACTAACGGATGGTGGGAGCAAAATCATAGGCTATGTTGTTGAAAGGCGTGATAT

CAAGAGAAAGACCTGGGTTCTGGTCACTGACCGAGCGGACAGCTGTGAGTTCACTGTCACTGGACTACAGAAAGGAGGAGTGGAGTACCTGTTCCGTGTG

AGTGCAAGGAACAGAGTTGGCACTGGAGAACCCGTAGAAACTGACAGTCCTGTAGAAGCAAGGAGTAAATATG ATGTTCCAGGCCCTCCTTTGAATGTA

ACCATCACCGATGTGAATAGATTTGGTGTCTCACTAACATGGGAGCCACCAGAGTACGATGGAGGTGCTGAAATCACAAACTATGTGATTGAGCTGAGAG

ACAAGACTTCTATCAGATGGGACACTGCCATGACCGTAAGAGCTGAAGACCTGTCAGCAACTGTCACTGATGTGGTTGAAGGACAGGAGTATAGTTTCCG

TGTCAGAGCCCAGAACCGAATCGGAGTTGGGAAACCAAGTGCAGCCACACCCTTTGTCAAAGTTGCTGATCCAATAG AGAGACCAAGTCCTCCTGTGAA

CCTAAACGCCTCAGAACAGACACAGTCATCAGTTCAGCTCACCTGGGAGCCTCCTCTGAAAGATGGAGGCAGCCCCATACTGGGCTACATAATTGAAAGA

CGTGAAGAGGGAAAAGACAATTGGATTCGCTGCAATATGAAACCTGTCCCTGAACTGACTTACAAG GTCACTGGATTGCAAAAAGGGAACAAATATTTA

TATAGAGTGTCTGCAGAAAATGCAGCTGGTGTTTCAGATCCATCTGAGATCCTCGGTCCTCTCACTGCTGATGATGCGTTTG TTGAACCAACGATGGAT

TTAAGTGCATTCAAAGATGGTTTGGAAGTCATAGTTCCCAATCCCATCAAGATCCTGGTCCCAAGCACAGGCTATCCAAGACCAAAAGCAACCTGGACTT

TTGGAGATCAAGTACTTGAAGAGGGGGATCGTGTGAAAATGAAGACCATATCAGCCTATGCCGAGCTTGTCATTTCTCCAAGCGAACGAACAGACAAAGG

CATTTACACACTCACGTTAGAAAATCCTGTGAAGTCAATTTCTGGAGAAATCAATGTCAATGTAATTG CTCCTCCAAGTGCGCCCAAAGAACTGAAATT

TAGTGATATAACAAAGGATTCTGTACATTTGACTTGGGAACCACCAGATGATGATGGAGGGAGTCCACTAACTGGATATGTTGTTGAAAAGAGAGACATG

AGCCGGAAAACATGGACTAAA GTTATGGACTTTGTTACTGATCTAGAATTCACAGTTCCTGATCTTGTTCAAGGAAAGGAGTATCTATTCAAAGTCTGT

GCCCGAAATAAGTGTGGCCCTGGAGAACCTGCATATACTGATGAACCTGTAAATATGTCTGCCCCTGCAA CGGTACCTGACCCACCAGAGAATGTTAAA

TGGAGAGACAGGACAGCCAACAGCATCTTCCTAACATGGGATCCTCCTAAAAATGATGGTGGCTCTCGTATCAAAGGATATATAGTTGAAAAATGTCCAC

GTGGTTCTGATAAATGGGTTGCCTGTGGAGAACCTGTTCCAGATACAAA AATGGAAGTGACAGGTCTTGAGGAAGGCAAATGGTATGCCTACCGTGTGA

AGGCCTTGAACAGGCAAGGTGCTAGCAAGCCAAGCAAACCCACTGAAGAGATCCAGGCGGTGGACACACAGG AGGCCCCTGAGATCTTCCTGGATGTGA

AGCTCCTGGCTGGGATCACTGTGAAAGCTGGAACGAAGATCGAACTTCCCGCCACGGTGACTGGAAAACCGGAACCGAAAATAACTTGGACCAAGGCTGA

CACCCTTCTGAAGCCAGACCAGAGAATCACCATTGAAAACGTTCCTAAAAAATCCACAGTGACAATCACAGACAGTAAGAGAAGTGACACAGGCACATAT

ATCATAGAAGCCGTGAACGTCTGTGGCCGGGCCACTGCTGTGGTAGAAGTGAATGTCTTAG ATAAACCTGGACCACCAGCTGCCTTTGACATCACAGAT

GTAACCAATGAGTCGTGTCTTCTGACCTGGAACCCACCAAGAGACGATGGCGGGTCTAAGATCACAAACTATGTGGTGGAGAGAAAAGCAACAGACAGTG

ATGTGTGGCATAAGCTCTCATCAACCGTTAAGGACACAAACTTCAAGGCAACCAAATTAACACCCAACAAAGAGTACATCTTCAGAGTTGCTGCAGAAAA

TATGTATGGTGTTGGTGAGCCGGTTCAAGCTGCTCCAATAATAGCCAAATACCAGTTTG ATCCACCCGGACCTCCAACTCGCCTAGAACCTTCCGACAT

CACTAAAGATGCGGTGACGCTCACATGGTGTGAGCCAGATGATGATGGTGGCAGTCCCATCACTGGATACTGGGTTGAAAGATTAGATCCTGACACTGAT

AAATGGGTTCGATGCAATAAGATGCCAGTGAAGGACACAACATACAG GGTAAAAGGTCTCACCAATAAGAAAAAGTACAGATTCCGCGTGCTTGCTGAA

AATTTGGCAGGGCCAGGAAAACCAAGTAGATCAACTGAACCAATCTTAATAAAGGATCCCATAG ATCCTCCATGGCCCCCTGGAAAACCAACTGTAAAG

GATATAGGCAAAACCTCCTTAGTATTGAACTGGACCAAGCCAGAACACGATGGAGGGGCAAAGATTGAGTCTTACGTCATTGAGATGCTAAAGACCGGAA

CAGACGAGTGGGTCAGGGTGGCTGAGGGAGTTCCGACCACTGAGCATTTGCTCACAGGGCTAATGGAAGGCCAGGAATACTCATTCCGAGTGAGAGCCGT

GAACAAGGCTGGAGAGAGTGAGCCCAGTGAACCCAGCGACCCTGTGCTTTGCCGGGAGAAACTAT ATCCTCCATCACCACCTCGCTGGCTCGAAGTGAT

TAATATCACAAAAAATACAGCTGACCTAAAATGGACAGTTCCAGAGAAAGATGGAGGGTCACCCATCACCAACTACATTGTGGAAAAGAGAGATGTGAGA

CGGAAAGGCTGGCAAACAGTGGACACCACTGTCAAGGACACCAAGTGCACGGTCACCCCACTGACAGAGGGGTCTCTGTATGTGTTCCGAGTTGCTGCAG

AAAATGCCATAGGACAAAGTGACTACACAGAAATCGGAGATTCTGTCCTGGCCAAAGACACCTTCA CCACCCCTGGACCACCCTATGCCCTGACAGTGG

TTGATGTGACAAAACGACATGTTGACCTAAAGTGGGAGCCACCTAAAAATGATGGCGGAAGACCAATACAGAG ATACATCATTGAGAAGAAAGAAAAAT

TAGGTACCCGTTGGGTGAAAGCCGGGAAGACCTCAGGCCCTGACTGTAACTTCAGAGTAACTGATGTCATTGAAGGAACAGAAGTCCAGTTTCAAGTTCG

GGCAGAAAATGAAGCAGGAGTTGGTCACCCAAGTGAGCCCACAGAAATTCTGTCAATCGAAGACCCAACAA GTCCTCCTTCACCTCCGCTTGATCTACA

TGTGACTGATGCTGGGAGAAAACACATTGCCATTGCTTGGAAACCACCAGAGAAAAATGGCGGAAGTCCTATCATAGGCTACCATGTTGAAATGTGTCCA

GTAGGCACAGAGAAATGGATGCGAGTTAATTCTCGCCCAATAAAAGATCTGAAGTTCAAGGTTGAAGAGGGTATTGTTCCGGACAAAGAATATGTTCTGA

GAGTGAGAGCTGTCAATGCTGTCGGTGTCAGTGAGCCATCTGAAATCTCCGAAAACGTGGTCGCCAAAGACCCAGACT GCAAACCAACTATTGATCTAG

AGACTCACGACATTGTTGTTATCGAAGGAGAAAAGTTAAACATCCCTGTGCCCTTCAGGGCTGTCCCAGTGCCAACCGTGAGCTGGCATAAAGATGGCAA

AGAAGTTAAAGCAAGTGACAGATTGACAATGAAGAACGACCACATCTCTGCACACCTCGAGGTTCCCAAGAGTGTCCATGCAGATGCTGGAGTGTACACC

ATCACCCTGGAGAATAAGCTCGGCTCAGCAACGGCTTCAATCAATGTCAAAGTCATAG GTCTACCTGGTCCATGCAAAGATATTAAAGCAAGTGACATA

ACCAAAAGTTCTTGTAAGTTAACATGGGAACCTCCAGAGTTTGATGGTGGAAGCCCGATTCTTCATTATGTCCTGGAACGGAGAGAAGCAGGGAGGAGGA

CATATATCCCAGTCATGTCTGGTGAGAACAAACTGTCTTGGACCGTAAAAGATCTCATACCAAATGGTGAATACTTCTTCCGAGTAAAAGCAGTCAACAA

GATTGGCGGAGGAGAATACATTGAACTCAAGAATCCTGTCATTGCTCAAGATCCAAAGC AACCACCTGATCCACCTGTAGATGTTGAGGTTCATAATCC

TACAGCTAAGGCAATGACTATCACGTGGAAGCCACCCTTGTATGATGGAGGAAGCAAGATAATGGGTTACATCATAGAAAAGATCACTAAGGGTGAGGAT

AGATGGAAGAGATGCAATGAACATCTGGTCCCTGTCCTGACCTACACAGCGAAAGGACTCGAGGAGGGGAAAGAGTACCAATTCCGTGTGCGAGCGGAGA

ACGCTGCTGGTATTGGTGAACCTTCCCGGGCCACTCCCCCAACCAAAGCTGTCGACCCTATTG ATGCCCCAAAAGTCATCCTCAGAACAAGCCTGGAAG

TAAAGCGGGGTGATGAAATAGCACTTGATGCAACCATCTCTGGCTCACCATACCCAACAATCACATGGATAAAAGATGAAAATGTCATTGTTCCAGAGGA

AATTAAGAAGCGAGCGGCACCCCCAGTTAGGAGGAAGAAGGGCGAGGCTGAAGAGGAGGAGCCCTTTTCCCTCCCTCTGACAGAACGTCTGAGCATCAAC

AATAGCAAACAGGGAGAATCTCAGCTGCGCATCCGTGACTCTCTGCGGCCTGACCATGGCCAGTACATGATCAAAGTTGAGAATGATCACGGTGTTGCAA

AAGCTCCTTGCTCCGTCAGTGTGTTAG ATACACCAGGACCACCAATCAACTTTGTATTTGAGGATATTAGAAAGGACTCTGTCCTGTGTAAGTGGGAAC

CACCGCTTGACGATGGTGGCAGTGAAATCATTAACTATACCTTGGAAAAGAAAGACAAGACCAAGCCCGACTCAGACTGGATTGTTATCACATCAACACT

CAGAAACTGCAAATATTCAGTAACAAAACTGATTGAAGGAAAAGAGTACCTCTTCCGTGTAAGAGCTGAAAATAGGTTTGGACCTGGGCCACCATGTGTT

TCAAAGCCACTTTTAGCCAAAGATCCATTTG AACCACCTGATGCACCAGATAAACCCATTGTGGAAGATGTCACCAGCAACAGTATGCTAGTAAAATGG

AATGAACCGAAAGATAATGGAAGCCCCATCTTGGGTTACTGGCTTGAAAAACGTGAGGTCAATAGTACACACTGGTCTCGTGTCAACAAAACCCTTCTCA

GTTCTTTGAAAACCAAGGTAGATGGCTTGCTGGAAGGACTCACCTATGTCTTCCGAGTTTGTGCTGAAAACGCTGCTGGACCTGGAAAGTTCAGCCCACC

TTCGGATCCTAAAACAGCTCGCGATCCAATCT CTCCACCTGGGCCGCCTGTCCCGAGAGTTGCTGATACAAGCTCTACAACCATTGAGCTGGAGTGGGA

ACCCCCAGCTTTCAATGGTGGTGGGGAAATTATGGGCTACTTTGTTGATAAGCAGCTGGTTGGCACAAATGAGTGGTCACGCTGCACAGAGAAGATGATC

AAAGTCCGTCAGTTCACTGTCAAAGAAATCCGAGAGGGTGCCGACTACAAACTTCGAGTGAGTGCTGTCAATGCAGCAGGCGAAGGACCACCTGGAGAAA

CAGAACCTGTTACTGTGGCTGAGCCACAAG AGCCTCCAACTGTGGAACTAGATGTTTCTGTCAAGGGTGGAATACAAATCATGGCTGGGAAGACTCTCA

GAATCCCAGCGGAGGTGACTGGCCGTCCTGTGCCCACAAAAGTATGGACCATCGAAGAAGGGGAGCTAGATAAAGAGCGTGTTATAATAGAGAATGTCGG

AACCAAATCTGAACTAATTATCAAGAACGCATTGAGAAAAGACCATGGCAGATACGTGATCACGGCAACAAACAGCTGTGGTTCCAAATTTGCCGCAGTC

CGGGTTGAAGTGTTCG ATGTCCCTGGCCCAGTTCTTGACCTCAAACCGGTTGTAACAAACAGAAAGATGTGTCTGCTTAATTGGTCCGATCCAGCAGAT

GATGGCGGAAGTGACATCACAGGGTTTATAATTGAAAGGAAGGATGCTAAGATGCACACTTGGAGACAGCCCATCGAGACTGAGAGATCCAAGTGTGACA

TCACAGGCCTTATAGAGGGACAAGAATACAAGTTCCGTGTCATTGCCAAGAACAAGTTTGGCTGTGGGCCTCCTGTTGAAATAGGACCAATTCTTGCAGT

TGATCCACTAG GCCCTCCAACATCTCCTGAAAGGCTCACATACACAGAAAGAACAAAATCCACCATCACACTTGACTGGAAAGAGCCACGCAGCGATGG

TGGCAGTCCCATTCAAGGATATATCATTGAAAAACGCCGCCATGACAAACCCGACTTTGAAAGAGTTAACAAGAGACTCTGCCCAACCACATCATTTCTG

GTTGAAAATCTTGATGAACACCAAATGTATGAGTTCCGTGTCAAAGCCGTCAATGACGTTGGTGAAAGTGAACCATCTCTGCCTCTTAACGTAGTCATAC

AGGATGATGAAG TCCCTCCCACTATTAAGTTGCGCCTGGCTGTTCGAGGAGACACTATCAAAGTTAAGGCAGGGGAGCCAGTTAACATCCCTGCAGACG

TGACCGGCCTCCCCATGCCTAAGATTGAGTGGTCCAAGAATGAAAAGGTGATTGATAAACCTACGGATACACTGAATATAACCAAAGAAGAAGTCTCCCG

AAGTGAGGCAAAGACTGAGCTTAGCATCCCTAAAGCAGCCCGAGAGGACAAGGGCACGTACACAATCACAGCTTCCAATCGTCTTGGCTCCGTATTCCGC

AACGTTCATGTGGAGGTTTATG ATCGTCCATCTCCACCCAGAAACCTCGCTGTTACTGACATCAAAGCTGAGTCTTGCTATTTGACGTGGGATGCCCCT

CTAGACAATGGAGGCAGTGAAATTACTCATTACATCATTGACAAGCGTGATGCCAGCAGGAAGAAGTCCGAATGGGAAGAAGTCACTAACACTGCTGTTG

AGAGAAGATACGGG ATCTGGAAGCTTATCCCCAATGGTCAGTACGAGTTCCGAGTGAGGGCAGTGAATAAATATGGAATCAGTGATGAATGCAAATCAG

ACAAGGTCGTCATTCAAGATCCCTACCGCCTCCCCGGGCCTCCTGGAAAACCGAAAGTCTTAGAACGTACCAAAGGATCTATGCTTGTGAGCTGGACCCC

TCCTCTGGACAACGGAGGGTCTCCAATTACTGGCTACTGGCTAGAGAAGAGAGAGGAAGGTGGTACCTACTGGTCACGTGTTAGCAGAGCACCAATAACC

AAAGTAGGACTGAAGGGTGTGGAATTCAATGTTCCGCGGTTGATTGAAGGCGTCAAATATCAATTTAGAGCCATGGCAATAAATGCTGCAGGAATTGGCC

CTCCCAGTGAACCATCAGACCCAGCTGTTGCAGGAGATCCTATAT ACCCTCCTGGGCCACCTTCTTGCCCAGAGGTCAAAGATAAAACAAAATCAAGCA

TCTCACTAGCATGGAAACCTCCAGCCAAAGACGGTGGCAGCCCAATCAAAGGCTACATTGTAGAGATGCAAGAGGAGGGAACCACGGACTGGAAGCCAGT

CAATGAACCCGATAAACTTCTCACTGCCTGTGAATGTGTGGTGCCTAATCTGAAAGAGCTCAGGAAGTACAGGTTCAGAGTGAAAGCTGTCAATGAAGCT

GGAGAGTCTGAACCAAGTGACACGACCGGAGAGATCCCTGCCACTGATATCCAAG AAGTTCCAGAGGTTTTCATTGACATTGGCGCACAAGACTGCCTG

GTTTGCAAAGCTGGCTCACAGGTCAAAATTCCTGCTGTGATCAAGGGACGCCCCACACCAAAATCATCTTGGGAATTTGATGGAAAAGCAAAGAAGGCAA

TGAAG GATGGAGTTCATGATATACCTGAAGATGCACAG CTGGAGACGGCCGAAAACTCATCGGTCATCATTATCCCAGAGTGTACTCGAGCTCACTCG

GGCAAATACAGCATCACAGCCAAGAACAAAGCAGGACAGAAAACTGCCAACTGCAGAGTTAAAGTCATGG ACGCACCAGGCCCTCCCAAAGATTTGAAG

GTCAGTGACATCACAAGGGGTAGTTGCCGCCTCTCATGGAAGATGCCAGATGATGATGGAGGTGATAGGATCAAAGGCTACGTCATTGAGAAGAAGACCA

TCGACGGGAAAGCCTGGACGAAAGTCAATCCAAATTGTGGAAGCACCACATTTGTGGTACCAGATCTTATCTCTGAGCAGCAATACTTCTTCCGTGTTCG

AGCAGAAAACCGTTTTGGAATTGGCCCACCTGCAGAAACCATCCAGAGGACCACTGCCAGAGACCCAATAT ATCCTCCTGATCCCCCTATCAAACTCAA

GATTGGTCTCATAACAAAGAACACAGTGCACCTGTCGTGGAAACCTCCAAAGAATGATGGTGGCTCTCCTGTCACCCATTATATTGTTGAGTGTTTGGCT

TGGGACCCTACCGGGAAAAAGAAAGAAGCCTGGAGGCAGTGCAATAGGCGTGATGTGGAAGAACTGGAGTTCACCGTGGAAGACCTCATAGAGGGAGGGG

AATATGAATTCAGAGTCAAAGCCGTCAACGAGGCCGGGGTCAGCAAGCCTTCAGCCACTGTTGGTCCTGTGATTGTCAAAGACCAGACAT GCCCACCAG

CCATTGAGCTAAAAGAATTCATGGAAGTTGAAGAAGGAACTGATGTTAACATTGTGGCCAAAATCAAAGGTGTGCCGTTCCCAACTCTCACCTGGTTCAA

GGCTCCGCCAAAGAAACCCGACAGCAAAGAGCCTGTTGTTTATGACACCCATGTCAACAAACAGGTGGTGGATGACACTTGCACTTTAGTCATTCCTCAG

TCTCGCCGGAGTGACACTGGCTTATATTCTATCACAGCCGTAAACAACCTGGGGACAGCATCAAAGGAGATGAGACTCAATGTCCTTG GTCGTCCTGGC

CCCCCTGTGGGACCCATAAAGTTTGAATCTATTTCAGCGGATCAGATGACATTATCTTGGCTTCCACCTAAAGATGACGGTGGGTCTAAGATTACAAACT

ATGTCATTGAGAAAAGAGAAGCCAACAGAAAGACATGGGTACGTGTCTCCAGTGAACCTAAAGAATGCATGTACACAATTCCCAAATTGCTAGAAGGCCA

TGAATACGTCTTCCGAATCATGGCCCAGAATAAGTACGGCATTGGAGAGCCACTTGACAGTGAACCTGAGACAGCACGGAACCTCTTCT CTGTCCCTGG

AGCTCCAGATAAACCAACAGTGAGCAGCGTCACTCGCAACTCCATGACTGTCAACTGGGAAGAGCCGGAATATGATGGAGGCTCTCCTGTGACAGGGTAC

TGGTTAGAAATGAAAGACACCACTTCAAAGAGATGGAAGAGAGTTAACCGAGATCCCATCAAAGCCATGACTCTAGGTGTTTCTTACAAAGTGACTGGCC

TTATTGAAGGATCAGACTATCAGTTCCGGGTATATGCAATCAATGCCGCTGGTGTGGGTCCAGCAAGTCTTCCCTCAGATCCAGTGACTGCTAGAGATCC

AGTTG CTCCCCCTGGTCCTCCATTCCCCAAAGTGACAGACTGGACAAAATCATCTGTGGACTTAGAATGGTCTCCTCCACTAAAAGATGGCGGATCCAA

AATCACTGGCTACATTGTTGAGTATAAGGAAGAAGGAAAAGAAGAATGGGAAAAG GGTAAAGATAAAGAAGTGAGGGGGACAAAACTGGTTGTTACTGG

ATTAAAAGAAGGAGCCTTCTACAAATTCCGTGTGAGAGCAGTCAATGTTGCTGGTGTTGGGGAACCTGGAGAAGTCACGGACGTTATTGAAATGAAGGAC

AGAATTG TGTCGCCTGACCTTCAGCTTGATGCCAGTGTCAGAGACAGAATAGTGGTCCACGCCGGAGGGGTGATCCGTATCATTGCCTATGTATCTGGG

AAGCCACCTCCCACTGTCACCTGGAGTATGAATGAAAGAGCCTTGCCTCAAGAGGCCGCCATTGAGACCACAGCAATTAGCTCATCCATGGTCATCAAGA

ACTGCCAGAGGAGCCACCAAGGCGTCTACTCTCTTCTTGCCAAAAATGAAGGCGGAGAAAGAAAGAAGACAATTATTGTTGATGTACTAG ATGTCCCAG

GACCTGTTGGAATACCATTCCTCTCTGACAACCTAACCAATGACTCCTGCAAACTGACATGGTTCTCTCCAGAAGATGATGGTGGCTCTCCAATCACCAA

TTATGTCATTCAGAAGCGGGAAGCTGACCGCAGGGCATGGACCCCTGTGACATACACAGTCACTCGACAAAATGCTACTGTTCAGGGCCTTATTCAAGGA

AAATCCTACTTTTTCCGAATTGCAGCTGAGAATAGCATTGGCATGGGCCCATTTGTTGAGACACCAAATGCACTTGTCATTAGAGACCCAATAA CTGTG

CCAGAGAGACCTGAGGACCTGGAAGTCAAAGAAGTCACTAAAAATACTGTGTCTTTGACTTGGAACCCTCCCAAGTATGATGGCGGGTCAGAAATTATAA

ACTATGTCCTAGAAAGCCGCCTCATTGGTACTGAGAAGTTCCACAAAGTTACAAATGACAACCTGCTTAGCAGGAAATACACTGTGAAAGGCTTAAAAGA

AGGCGATACATATGAGTACCGCGTCAGTGCCGTCAATATCGTTGGACAAGGCAAGCCATCATTTTGCACCAAGCCAATCACTTGCAAGGATGAACTGG C

TCCACCTACACTTGACCTCGACTTCAGAGATAAGCTTACCGTCCGAGTTGGTGAATCTTTCGCCCTCACTGGCCGATACTCAGGCAAACCAAAGCCTAAG

ATTGATTGGTTCAAAGATGAAGCTGATGTACTGGAAGATGATCGTACTCACATAAAGACCACTCCCACGACACTTGCTCTTGAGAAGACAAAGGCCAAAC

GCTCAGATTCTGGGAAATACTGTGTAGTTGTGGAGAACAGTACAGGCTCCAGGAAAGGTTTCTGTCAAGTCAATGTTGTTG ATCGTCCTGGACCACCAG

TAGGACCTGTCATTTTTGATGAGGTGACCAAAGAATACATGGTTATTTCTTGGAAGCCACCTCTAGATGATGGAGGAAGTGAAATTACCAATTATATTAT

TGAGAAGAAGGAGCTCGGTAAAGACATCTGGATGCCTGTGACATCTGCCAGTGCCAAAACTACATGCAAGGTCCCTAAACTGCTTGAAGGAAAAGATTAC

ATCTTCCGGATTCATGCGGAAAATCTATATGGAATAAGTGACCCTCTGGTGTCTGATTCAATGAAAGCCAAAGATCGATTCA GAGTCCCTGATGCACCT

GAGCAGCCAGTTGTCACAGAGGTCACCAAAGACTCGGCATTAGTAACCTGGAACAAGCCAAATGACGGAGGAAAGCCCATCACAAACTACATCCTGGAAA

AGAGGGAAACTATGTCTAAAAGATGGGTTCGAGTTACCAAAGAGCCTATTCATCCATACACTAAGTATAGGGTTCCTGATCTTCTAGAAGGATGCCAGTA

TGAATTCCGTGTTTCTGCAGAGAATGAAATTGGTATTGGAGATCCAAGTCCACCATCCAAACCAGTCTTTGCTAGAGACCCAATTG CTAAACCAAGTCC

ACCTATTAATCCTGAGGCAATAGATACAACATGTAATTCAGTTGAGCTAACTTGGCAGCCACCACGTCACGACGGTGGTAGCAAGATCCTGGGTTATATC

GTGGAGTACCAGAAAGTTGGGGATGAAGAGTGGAGACGAGCCAATCACACTCCTGAATCATGCCCTGAAACTAAATATAAAGTCACTGGCCTCAGGGATG

GTCAGAGCTACAAGTTCCGAGTACTGGCAGTCAACGAGGCTGGTGAATCGGACCCAGCCCACGTTCCTGAACCAGTTCTAGTAAAGGACCGACTTG AAC

CTCCTGAGCTTATACTTGATGCTAACATGGCAAGAGAACAACACATTAGAGTTGGTGACACCCTAAGACTTAGTGCCATCATCAAAGGTGTGCCATTCCC

CAAAGTAACCTGGAAAAAAGAAGACAGAGAGGCTCCAACAAAAGCCCAAATTGATGTTACTCCAGTTGGGAGCAAGCTTGAAATCCGTAATGCTGCCCAC

GAAGATGGTGGTATTTATTCCCTAACTGTGGAGAATCCGGCGGGTACAAAGACAGTCTCAGTCAAAGTATTGGTCTTAG ATAAACCTGGGCCACCTAGA

GATCTGGAAGTCAGTGAAATTAGGAAAGATTCTTGTTACCTGACTTGGAAGGAACCACTGGACGACGGTGGTTCTGTTGTAACCAATTATGTGGTTGAGA

GGAAAGATGTTGCCACTGCCCAGTGGTCCCCTCTTTCCACCACGTCAAAGAAGAAGAGCCATATGGCTAAACATCTGACTGAGGGCAATCAGTACCTCTT

CCGAGTAGCTGCTGAGAACCAATACGGACGTGGTCCTTTTGTTGAAACACCTAAGCCCATCAAGGCTCTGGATCCTCTCC ATCCCCCAGGGCCACCCAA

GGATCTGCACCACGTAGATGTCGACAAGACTGAAGTCTCTCTCGTTTGGAATAAGCCAGATCGTGATGGTGGTTCTCCAATCACAGGATACTTAGTGGAA

TATCAAGAAGAGGGTGACAAGGACTGGATCAAGTTCAAGACTGTGAAAAATTTAGACTGTGTTGTTACAGGCTTACAACAAGGAAAGACCTATAGATTCC

GTGTAAAAGCTGAAAATATCATAGGTCTTGGTCTTCCTGATACAACTATCCCAATAGAATGTCAAGAGAAACTAG TGCCTCCATCTGTGGAATTAGATG

TGAAGTTAATTGAAGGGCTTGTGGTGAAGGCTGGTACCACAGTTAGATTCCCTGCCATCATAAGAGGTGTACCTGTTCCTACTGCAAAATGGACAACTGA

TGGGACTGAGATTAAAACAGATGACCACTACACAGTTGAGACTGACAGCTTCTCATCCGTGCTGACCATTAAGAATTGTTTAAGGAAGGATACTGGGGAA

TACCAACTCACAGTTTCCAATGCAGCGGGTACCAAAACAGTAGCTGTCCATCTTACTGTTCTTGATGTACCTGGTCCACCAACAGGTCCTATTAATATCC

TGGATGTCACACCTGAATACATGACTATCTCATGGCAACCGCCTAAGGATGATGGAGGAAGCCCAGTGATAAATTACATTGTTGAGAAACAAGATACAAG

GAAAGGTACATGGGGTGTCGTCTCTGCAGGAAGCAGTAAGCTGAAGCTGAAGGTCCCACATCTCCAAAAAGGCTGTGAATACGTTTTCAGAGTCAAAGCA

GAGAACAAGATGGGTGTCGGTCCTCCCCTTGACTCCATACCTACTGTTGCTAAGCACAAGTTCAGTCCTCCATCTCCTCCTGGTAAACCAGTGGTAACTG

ACATTACTGAGAATGCTGCAACGGTGTCTTGGACACTGCCAAAATCTGATGGTGGCAGTCCAATAACTGGCTATTATGTAGAGCGCAGAGAAATAACCGG

CAAATGGGTGAGGGTCAACAAAACGCCTATTGCTGACCTGAAGTTCAGGGTGACTGGACTCTATGAGGGAAATACATACGAGTTTAGAGTTTTTGCTGAA

AATCTTGCAGGTTTAAGCAATCCATCACCCAGTTCTGACCCAATCAAAGCTTGCCGGCCCATCAAACCACCAGGGCCACCTATAAATCCTAAGCTGAAAG

ACAAGAGCAAAGAATCTGCTGACTTGGTGTGGACAAAGCCCCTCAGTGATGGTGGCAGCCCCATTTTGGGGTATGTAGTAGAGTATCAGAAACCTGGCAC

AGCGCAGTGGGATAGGATTAATAAAGACGAACTCATCAGGCAATGTGCCTTCCGGGTCCCCGGACTGATTGAAGGAAATGAGTACAGATTTCGCATTAGA

GCAGCTAACATTGTGGGTGAGGGAGAGCCAAGGGAGCTTGCAGAATCTGTGATTGCAAAAGACATCCTTCATCCCCCGGAAGTGGAACTTGACGTTACAT

GCCGTGATGTCATTACCGTCCGGGTGGGTCAAACTATCCGCATTCTTGCCCGAGTCAAAGGCAGACCTGAGCCAGACATAACTTGGTCCAAGGAAGGAAA

AGTACTGGTCAAAGACAAGCGGGTTGACCTAATTCATGATCTGCCTCGTGTTGAGCTACAAATTAAAGAAGCTGTCAGAGCTGACCATGGCAAGTATATC

ATCTCTGCTAAGAACAGCAGTGGGCATGCCCAAGGGTCAGCCATTGTTAATGTCCTTGACAGACCTGGGCCTTGCCAGAATCTGAAGGTTAGCAACGTAA

CCAAGGAAAACTGCACCATTTCTTGGGAAAACCCACTAGATAATGGTGGCTCAGAAATTACAAATTTCATAGTGGAATATCGTAAACCAAATCAGAAAGG

CTGGTCAATCGTTGCCTCAGATGTCACCAAGAGACTGGTCAAGGCCAACCTGTTAGCCAATAATGAATACTATTTCCGTGTTTGTGCAGAGAATAAAGTA

GGTGTTGGGCCAACCATTGAAACAAAGACTCCAATTTTGGCCATCAATCCTATTGACAGGCCAGGGGAGCCTGAAAACCTTCATATTGCAGATAAAGGAA

AGACCTTTGTCTATCTAAAGTGGCGACGGCCTGATTATGATGGTGGTAGCCCGAATCTATCATATCATGTTGAGAGGAGACTGAAGGGCTCTGCAGACTG

GGAAAGAGTGCACAAAGGAAGCATTAAGGAAACCCACTACATGGTTGACAAGTGTGTTGAAAACCAGATTTATGAGTTCAGAGTACAAACTAAGAATGAA

GGTGGAGAAAGTGATTGGGTGAGGACAGAGGAAGTTGTTGTGAAGGAAGATTTACAGAAGCCAGTACTTGATCTAAAATTAAGTGGGGTGCTAACTGTCA

AAGCAGGGGACACCATTAGACTCGAGGCAGGTGTGAGAGGCAAACCATTCCCAGAGGTTGCCTGGACCAAAGACAAAGATGCTACAGATTTAACAAGATC

ACCAAGGGTCAAGATTGATACCAGTGCCGAATCATCGAAATTCTCTCTTACCAAAGCCAAGCGAAGCGATGGCGGTAAATACGTAATCACCGCAACTAAC

CCAGCTGGCAGTTTTGTGGCCTATGCGACTGTCAATGTTTTAGATAAACCTGGTCCTGTAAGAAACCTGAAAATCACTGATGTGTCCAGTGACAGGTGTA

CTATCCGCTGGGATCCACCAGAAGATGATGGCGGCTGTGAAATCCAAAATTATATCCTAGAAAAATGTGAGAGCAAGAGAATGGTATGGTCTACCTATTC

TGCTAATGTCTTGACACCCAGTGCTACAGTGACTCGTCTCATAGAAGGAAATGAGTATATTTTCAGAGTTCGTGCAGAAAACAAAATAGGCACAGGGCCT

CCAACAGAAAGTAAACCAGTCATTGCAAAAACCAAGTATGACAGACCTGGCCGCCCTGATCCTCCAGAAGTCACTAAAGTAAGCAAAGAAGAGATGACCG

TGGTTTGGAACGCCCCTGAATATGATGGTGGGAAGTCTATCACAGGATACTATTTAGAGAAAAAAGAAAAGCATGCAGTCCGCTGGGTCCCTGTTAACAA

GAGTGCCATCCCTGAGCGACGCTTGAAAGTACAGAATCTCCTCCCAGGGCACGAGTACCAGTTCCGTGTCAAAGCAGAAAATGAAGTTGGCATTGGAGAA

CCAAGCTTACCATCAAGACCAGTGGTGGCAAAAGATCCCATAG AACCACCTGGGCCACCAACCAATTTCAAAGTGGTTGATACAACCAAAAGTTCCATA

ACTCTCGCATGGGGAAAACCAGTCTATGATGGTGGTGCACCGATAATTGGATATGTCGTAGAGATGAGACCCAAAATAGCAGACGCATCACCTGACGAAG

GCTGGAAAAGGTGCAACGCTGCAGCTCAACTTATTCGCATGGAATTCACAGTCACCAGCTTGGATGAGAACCAGGAGTACGAGTTCAGGGTGTGTGCCCA

GAATCAAGTTGGCATTGGGCGCCCTGCAGAGCTAAAGGAAGCCATCAAACCTAAAGAAATCCTAG AGCCTCCAGAGATTGACTTGGATGCCAGCATGAG

AAAACTGGTCGTAGTGAGAGCTGGCTGCCCTATTCGACTATTCGCAATAGTGAGAGGACGACCTGCCCCCAAAGTCACATGGCGCAAAGTGGGCATTGAT

AATGTGGTCAGAAAAGGACAAGTCGATCTAGTTGACACTATGGCCTTCCTTGTCATCCCCAACTCTACCCGTGATGACTCTGGAAAATACTCCCTGACCC

TTGTGAACCCAGCAGGAGAAAAGGCTGTTTTTGTGAATGTCAAAGTACTAG ATACTCCTGGACCTGTGGCTGATTTAAAAGTTTCAGATGTCACTAAAA

CATCATGTCACGTGTCCTGGGCACCTCCTGAAAATGATGGTGGAAGCCAAGTGACACATTATATTGTGGAGAAACGTGAGGCAGAAAGAAAAACATGGTC

AACAGTTACCCCTGAAGTGAAGAAAACAAGCTTCAATGTAACCAACCTTGTCCCTGGGAACGAGTATTTCTTCCGAGTAACTGCTGTCAATGAATATGGC

CCTGGTGTCCCGACAGACATCCCCAAACCTGTGCTTGCATCAGATCCTCTCA GTGAGCCAGATCCTCCAAGAAAACTGGAGGTGACCGAAATGACAAAG

AACAGTGCTACACTGGCCTGGTTACCTCCGTTGCGTGATGGAGGCGCTAAAATCGATGGCTATATCATTAGTTACAGAGAAGAAGACCAACCTGCAGATC

GCTGGACAGAGTACTCAGTGGTCAAAGACCTCAGCCTTATTGTTACTGGCCTAAAGGAAGGAAAGAAATATAAATTTAGAGTTGCAGCTAGAAATGCTGT

TGGAGTCAGCATGCCAAGAGAGGCCGAAGGCGTCTACGAAGCAAAAGAACAGCTAT TGCCACCAAAGATCCTCATGCCTGAGCAAATCACTATCAAAGC

CGGGAAGAAACTTCGAGTTGAGGCGCATGTGTATGGAAAGCCTAACCCCATCTGCAAATGGAAGAAAGGAGACGACGAAGTTGTTACATCCAGCCACCTG

GCCATCCACAAGGCAGACGGCTCCTCAGTTCTGATCATAAAAGACGTTACTAGAAAAGACAGTGGTTACTATAGCCTCACGGCAGAGAATAGCTCCGGGT

CAGACACTCAGAAAATCAAAGTTACAGTCATGG ATGCTCCTGGGCCCCCTCAGCCTCCATTTGACATTTCTGAAATAGATGCTGATGCTTGCTCCCTGT

CTTGGCACATCCCTCTGGAGGATGGAGGCAGCAACATTACCAATTACATAGTAGAGAAATGTGATGTAAGCCGTGGCGATTGGGTCACAGCTCTAGCATC

AGTCACCAAGACTTCCTGCAGGGTTGGAAAGCTGATCCCAGGCCAGGAGTATATCTTCCGGGTCCGAGCTGAAAACAGATTTGGCATTTCAGAGCCTCTC

ACATCTCCAAAGATGCTTGCTAAGTTCCCATTTG ATGTTCCTAGTGAGCCAAAGAATGCACGTGTCACTAAAGTCAACAAAGACTGCATATTTGTCGCG

TGGGACAGACCAGACAGTGATGGAGGAAGCCCCATCACTGGTTACCTGATTGAACGCAAAGAAAGAAACAGTTTGCTCTGGGTGAAAGCTAATGACACTA

TTGTCCGGTCAACTGAGTATCCTTGTGCTGGCCTCGTAGAAGGTCTAGAATATTCATTCAGAATCTATGCTCTAAACAAAGCTGGGTCCAGCCCACCTAG

CAAACCAACTGAGTATGTGACTGCAAGGATGCCGGTTG ATCCACCAGGGAAACCTGAAGTTGTTGACGTCACCAAGAACAGCGCATCGCTTATCTGGGC

CCGGCCAAAGCATGATGGAGGCAGCAGAATTATCGGCTATTTTGTAGAGGCTTGCAAACTTCCTGGTGATAAATGGGTTCGGTGCAATACCACACCTCAC

CAGATTCCCCAGGAAGAGTACACAGCTACTGGGTTAGAAGAGAATGCTCAGTATCAGTTCAGAGCGATTGCCAAGACTGCTGTGAACATCAGCCAGCCTT

CCGAGCCTTCTGATCCAGTGACCATTCTTGCAGAAAATG TTCCTCCACGGATAGAACTCAGTGTTGAGATGAAGTCTTTGCTTACCGTGAAGGCTGGGA

CTAATGTCTGCTTGGATGCTACTGTCTTCGGGAAACCGATGCCAACGGTTTCTTGGAAGAAAGACACCACACCAATAAAACAAGCCGAAGGCATAAAGAT

GGCAATGAAGCGGAACTTGTGTACCTTGGAGCTGTTCAGTGTGAACCGGAAAGACTCAGGAGACTATACCATTACTGCCGAAAATTCCAGTGGTTCCAAA

TCAGCCACCATTAAGCTGAAAGTACTAG ATAAGCCAGGTCCTCCAGCATCTGTGAAAATCAACAAGATGTATGCAGACCGTGCAATGCTGTCCTGGGAA

CCTCCTCTCGAGGATGGAGGCTCAGAAATCACCAACTACATCATTGACAAGCGTGAAACAAGCAGGCCCAACTGGGCCCAGGTCTCTGCTACTGTGCCCA

TCACCAGCTGCACTGTGGAGAAACTTATAGAGGGCCATGAATACCAGTTCCGTATCTGTGCCGAAAACAAATACGGAGTCGGCGATCCCATCCTCACTGA

GCCAGCGATTGCCAAAAACCCATATG ACCCGCCTGGACGCTGTGACCCTCCTGTCATTAGCAACATCACTAAAGATCACATGACCGTCAGCTGGAAAGC

CCCAGCGGATGATGGTGGCTCACCTATCACCGGATACTTGGTTGAAAAGCGGGAAACTCAGGCAGTCAACTGGACTAAAGTCAACAGAAAACCTGTTATA

GAAAGGACATTAAAAGCAACGGGTCTCCAGGAAGGCACGGAGTATGAATTCCGAGTTACGGCTATCAATAAAGCTGGACCCGGCAAACCCAGTGATGCAT

CCAAAGCCGTGTATGCTCAAGACCCACTGT ATCCTCCTGGCCCGCCAGCTTTCCCTAAAGTCTATGATACCACCCGTAGTTCTGTGAGTCTATCATGGG

GCAAGCCGGCCTATGATGGCGGCAGCCCTATCATTGGTTATCTTGTGGAAGTAAAGCGAGCTGATTCTGATCACTGGGTGAGGTGCAATTTGCCAGAGAA

GCTCCAGAAGACCCGCTTCGAGGTGACTGGCCTGATGGAAAACACCGAGTATCAGTTCCGAGTGTATGCCGTTAACAAGATTGGGTACAGCGACCCCAGC

GATGTGCCAGATAAACACTGCCCCAAGGACATCCTAA TTCCACCTGAGGGAGAACTTGATGCTGAACTAAGGAAAACACTTATCTTACGTGCTGGAGTT

ACAATGAGACTCTACGTGCCAGTAAAAGGACGGCCACCTCCAAAGATTACTTGGTCTAAACCGAACGTCAATCTAAGAGAAAGGATTGGCCTGGATATAA

AGTCGACAGACTTTGACACCTTCTTGCGCTGCGAAAATGTGAACAAATATGATGCAGGAAAATATATCTTAACCTTGGAGAACAGCTGCGGCAAGAAGGA

GTACACTATTGTGGTGAAAGTGCTGG ACACTCCTGGTCCACCTGTCAATGTGACTGTTAAGGAGGTATCCAAGGACTCTGCATATGTTACCTGGGATCC

TCCCATTATTGATGGTGGGAGCCCCATCATAAACTATGTGGTTGAGAAACGGGATGCAGAGAGGAAGTCCTGGTCGACAGTGACAACCGAGTGCTCGAAG

ACAAGCTTCAGAGTCTCTAACTTGGAGGAGGGGAAATCCTACTTCTTCAGAGTGTTTGCCGAAAATGAATACGGCATCGGGGATCCGGGGGAGACACGTG

ATGCTGTCAAAGCTTCTG AAACCCCGGGACCTGTGGTCGACCTGAAAGCACTGGCTATAACTAAGTCATCTTGTACCATCGGCTGGAAGAAGCCTCGAA

GTGATGGCGGAAGCAGAATTACTGGCTATGTGGTGGATTTCCTGACAGAAGAAAATAAGTGGCAACGGGTCATGAAATCACTGAGCCTTCAGTACTCCAC

AAAGGATCTGAAGGAGGGGAAGGAGTACACCTTCAGAGTGAGTGCAGAGAATGAAAACGGAGAAGGAACCCCAAGTGAAATTGTGGTTGTGGCCAAGGAC

GATGTTG TGGCTCCCGATCTTGACTTGAAGGATCTACCTGATCTGTGCTACTTGGCTAAAGAAAACAGCAACTTCCGTCTCAAGATCCCCATAAAAGGC

AAACCAGCACCATCGGTGTCTTGGAAGAAGGGGGAAGATCCCCTAGCAACAGACACAAGAGTCAGTGTCGAATCAACTGCAGTTAACACAACCCTTGTAG

TATATGACTGCCAAAAATCCGATGCTGGAAAATACACAATCACACTCAAGAATGTTGCTGGCACCAAGGAAGGAACTCTTTCTATAAAGGTTGTTGGCAA

GCCTGGCATCCCCACCGGACCAATCAAATTTGATGAAGTCACAGCAGAAGCCATGACCTTGAAGTGGGGTCCTCCAAAGGATGATGGAGGTTCTGAAATC

ACCAACTATGTACTAGAGAAGAGAGACTCTGTGAATAACAAGTGGGTGACATGTGCTTCCGCTGTCCAGAAAACCACCTTTAGAGTAACCAGACTTCACG

AGGGCATAGAATACACCTTCAGGGTCAGTGCTGAAAATAAATATGGTGTAGGAGAAGGCCTAAAGTCAGAGCCAATTGTTGCCAAACATCCATTTG ATG

TGCCTGATGCTCCCCCACCTCCCAATATTGTGGATGTCAGACATGATTCAGTATCTCTAACATGGACTGATCCCAAAAAGACTGGTGGCTCACCAATTAC

AG GGTATCATATTGAATTCAAGGAAAGAAACAGCCTTCTGTGGAAGAGAGCTAACAAGACTCCTATAAGGATGAAAGATTTTAAAGTGACAGGATTAAC

TGAAGGTCTTGAATATGAATTCAGAGTTATGGCTATCAATCTAGCTGGAGTGGGCAAGCCAAGCCTGCCATCAGAGCCAGTTGTGGCACTTGATCCAATT

G ATCCTCCTGGAAAACCTGAGGTTATCAGCGTAACAAGGAATTCAGTGACTCTCATCTGGACAGAACCTAAATACGATGGTGGCCATAAATTAACAGGA

TATATCGTGGAGAAGCGGGATCTACCCTCTAAGTCTTGGATGAAAGCCAACCATGTTAATGTCCCAGACTGTGCCTTTACTGTAACTGATCTTGTTGAAG

GTGGAAAATATGAATTCCGAATCAGAGCAAAGAATACAGCGGGTGCTATTAGTGCTCCATCAGAGAGCACAGGAACCATTATTTGCAAGGATGAATACG 

AGGCACCAACCATTGTCCTTGATCCAACAATTAAAGATGGGCTAACAGTCAAGGCAGGGGATAGCATTGTTTTAAGTGCCATTAGCATTCTCGGCAAACC

CCTTCCAAAGTCAAGCTGGTCCAGGGCAGGAAAAGATATCAGACCATCAGACATAGCTCAAATAACTTCAACCCCAACATCTTCTATGCTGACAGTTAAG

TATGCCACAAGAAAGGATGCTGGCGAGTATACCATCACCGCTACCAATCCTTTTGGCACAAAGGAGGAACATGTGAAGGTATCAGTCCTTGATGTACCTG

GTCCCCCAGGTCCCATTGAAATCAGTAATGTTTCAGCTGAAAAAGCAACACTTACTTGGACACCTCCCTTAGAAGATGGGGGCTCACCGATTAAAGCTTA

TGTTCTTGAGAAGAGAGAAACCAGCCGGCTTTTGTGGACAGTGGTTTCTGAAGATATTCAGGCATGCAGACATGTGGTAACCAAACTCATCCAAGGAAAT

GAATACCTCTTCCGTGTGTCAGCAGTAAACCATTACGGCAAAGGAGAACCCGTTCAGTCTGAGCCTGTCAAAATGGTGGACAGATTTG GTCCTCCTGGC

CCTCCTGGAAAACCCGAGATCTCAAATGTCACCAAGAACACTGCCACTGTCAGCTGGAAGAGGCCAACTGATGATGGTGGCAGCGAGATCACAGGATATC

ATGTAGAAAGGAGAGAAAAGAAAGGCCTGCGGTGGGTGAGAGCAACCAAAACACCAGTTTCCGATCTCAGGTGCAAAGTAACTGGACTGCAAGAAGGAAA

TACCTATGAGTTCCGTGTCAGTGCAGAAAACAGAGCCGGGATTGGTCCTCCCAGTGACGCCTCGAATCCTGTTCTGATGAAAGATGTTGCAT ATCCCCC

AGGACCACCTTCAAATGCACATGTCACTGATACCACCAAGAAATCGGCTTCTTTAGCATGGGGCAAGCCTCATTATGATGGTGGGCTTGAAATCACTGGC

TATGTGGTAGAGCATCAAAAAGTAGGAGATGATGCCTGGATCAAAGACACAACAGGAACAGCCCTCAGAATCACTCAGTTTGTGGTTCCTGATCTTCAGA

CTAAGGAAAAATACAATTTTAGAATTAGTGCCATCAACGATGCAGGTGTGGGGGAACCAGCTGTGATTCCAAATGTTGAAATTGTAGAGAAGGAAGTGGC

TCCTGATTTTGAGCTAGATGCTGAGCTGCGAAGAACACTTGTGGTTAGGGCAGGGCTCAGTATTAGGATTTTTGTGCCAATTAAAGGTCGTCCTGCACCT

GAAGTGACATGGACCAAAGATAATATCAACCTGAAGCACCGAGCCAACATCGAAAACACAGAGTCATTTACTCTTCTCATTATTCCAGAATGTAACAGAT

ATGACACTGGTAAATTTGTGATGACCATCGAAAACCCAGCTGGGAAGAAAAGCGGCTTCGTTAACGTCAGAGTCCTAGACACACCAGGCCCTGTCCTTAA

CCTAAGGCCTACAGACATCACAAAGGACAGTGTCACCCTACACTGGGACCTACCTCTGATAGATGGGGGCTCACGTATAACAAATTATATTGTGGAGAAA

CGTGAAGCAACCAGGAAATCCTACTCCACAGTCACTACTAAGTGCCATAAATGTACATATAAAGTGACTGGCTTGACAGAAGGCTGTGAATATTTCTTCA

GAGTGATGGCAGAAAATGAATATGGGGTTGGTGAGCCAACGGAAACCACAGAACCTGTGAGAGCCTCTGAGGCACCGTTACCCCCAGATAGCCTTAACAT

TATGGACATTACCAAGAACACAGTCAGCCTGGCGTGGCCTAAGCCAAGGCATGATGGTGGGAGCAAGATCACTGGCTATGTGATTGAAGCCCAGAGAAAA

GGGTCTGACCAGTGGACCCACATCTCAACAGTGAAAGGGTTAGAATGTGTGGTGAGGAACCTAACCGAAGGAGAGGAATATACCTTCCAAGTGATGGCGG

TAAACAGTGCAGGCAGGAGTGCCCCTAGAGAGAGCAGACCTGTCATTGTCAAAGAGCAGACGATGCTCCCAGAGCTGGATCTCCGTGGCATCTATCAGAA

GCTAGTCATTGCCAGAGCTGGTGACAACATCAAAGTTGAAATCCCAGTACTTGGTCGACCCAAGCCCACAGTCACATGGAAAAAGGGAGACCAAATCCTT

AAACAGACACAGAGAGTTAATGTTGAAAACACAGCAACGTCAACCATCTTAAATATCAATGAGTGTGTCAGAAGTGACAGTGGACCCTATCCATTAACAG

CAAAGAACACTGTAGGAGAGGTTGGTGACGTTATAACCATTCAAGTCCATGATATTCCAGGACCACCTACTGGACCCATTAAATTTGATGAAGTTTCATC

TGACTTTGTAACCTTCTCTTGGGAGCCACCAGAGAATGATGGAGGTGTACCAATAAGCAACTATGTAGTAGAGATGAGACAGACAGACAGTACTACATGG

GTGGAGTTAGCAACAACTGTTATACGTACTACCTATAAAGCAACTCGTCTGACCACAGGAGTGGAGTATCAATTCCGTGTAAGGGCTCAAAACAGATATG

GAGTTGGACCGGGCATCACATCTGCATCTGTAGTTGCAAACTATCCATTCAAGGTGCCCGGGCCTCCCGGTACCCCTCAGGTTACTGCAGTCACCAAAGA

CTCCATGACAATCAGCTGGCATGAACCACTTTCTGATGGTGGAAGCCCCATTTTAGGATATCACATTGAAAGGAAAGAACGGAATGGCATCCTCTGGCAG

ACTGTGAGCAAAGCATTAGTACCAGGCAACATTTTCAAATCAACTGGACTTACCGATGGCATTGCTTATGAATTCCGAGTAATTGCAGAAAACATGGCAG

GCAAGAGCAAGCCAAGCAAGCCATCTGAACCAATGTTTGCTTTGGATCCCATTGACCCACCCGGGAAACCAGTTCCTCTAAACATTACAAGACACACAGT

GGCACTGAAGTGGGCTAAGCCTGAATATACCGGAGGCTTTAAAATTACTAGCTATGTGGTTGAAAAGAGGGACCTTCCTAATGGACGATGGCTGAAGGCC

AACTTCAGCAACATTTTAGAGAATGAATTTACGGTCAGCGGCCTAACTGAAGATGCTGCATACGAGTTCCGTGTGATTGCCAAAAATGCTGCCGGTGCCA

TCAGTCCACCGTCTGAGCCATCAGATGCCATCACATGCAGGGACGACCTGGAGGCACCAAGAATAATGGTGGATGTTAGATTTAAGGATACCATCACATT

AAAAGCTGGCGAAGCATTCAAGTTGGAAGCTGATGTTTCAGGTCGCCCACCTCCAACAATGGAATGGACTAAAGATGGAAAGGAGCTTGAAGGCACAGGG

AAATTAGAAATAAAAATTGCAGACTTCTCCACTCATCTGATAAACAAGGATTCCTCAAGAACGGATAGTGGGGCTTACATCCTGACAGCAACCAATCCTG

GTGGCTTTGCCAAACACATTTTCAATGTCAAAGTTCTTGATAGACCGGGACCACCTGAGGGACCTTTGGCTGTGTCTGATGTGACATCAGAGAAGTGTGT

GTTGTCATGGTTGCCTCCACTGGACGATGGAGGTGCCAAAATTGATCATTACATCGTACAGAAACGTGAAACCAGCAGGTTGGCATGGACAAATGTTGCC

ACAGAAGTCCAAGTAACAAAGCTGAAGGTTACTAAGCTCCTGAAAGGGAATGAATACATATTCCGTGTCATGGCAGTAAATAAATACGGGGTTGGAGAGC

CACTTGAATCAGAACCTGTGCTTGCAGTGGATCCATATGGACCACCTGACCCACCCAAGAACCCGGAAGTTACAACTATCACCAAGGACTCCATGGTCGT

CTGCTGGGGGCATCCTGACTCTGATGGTGGAAGTGAAATTATCAACTACATTGTGGAGCGGCGTGATAAAGCTGGCCAGCGCTGGGTAAAATGCAACAAA

AAAGCTCTGACTGACTTAAGATTTAAAGTATCTGGGCTGACAGAAGGACATGAATACGAGTTCAGAATTATGGCAGAAAACGCAGCTGGAATCAGTGCTC

CGAGTGCTACCAGCCCGTTTTATAAAGCTTGCGACACTGTGTTTAAACCTGGCCCACCGGGTAACCCACGTGTCCTTGATACAAGCAGGTCGTCCATTTC

AATTGCGTGGAATAAACCCATTTATGATGGAGGTTCAGAAATCACTGGGTATATGGTTGAGATTGCCCTGCCTGAAGAAGATGAATGGCAGGTTGTCACT

CCACCAGCTGGGCTCAAGGCAACTTCCTATACCATCACCAGCCTCATAGAGAATCAGGAATATAAAATCCGCATTTATGCCATGAATTCTGAGGGACTTG

GGGAACCTGCCCTTGTTCCCGGAACTCCAAAGGCAGAAGAAAGAATGTTGCCTCCAGAGATAGAACTGGATGCTGACTTACGCAAAGTTGTCACTATACG

AGCCTGCTGCACCTTGAGGCTCTTTGTTCCCATCAAAGGGAGACCAGCACCTGAGGTCAAGTGGGCCCGAGAGCATGGAGAATCTCTGGACAAGGCTAGC

ATTGAATCCACAAGCTCTTACACCCTGCTTGTTGTTGGAAATGTTAACAGATTCGACAGTGGCAAGTACATACTAACGGTAGAAAACAGCTCTGGCAGCA

AGTCGGCGTTTGTCAATGTTAGAGTGCTAGATACGCCAGGCCCTCCACAGAATCTAAAGATAAAGGAGGTCACAAAGACATCTGTCACATTGACGTGGGA

GCCTCCTCTCCTGGATGGAGGCTCAAAAATAAAGAACTATATTGTTGAGAAGCGAGAGTCCACAAGAAAGGCATATTCAACCGTGGCAACGAATTGCCAT

AAGACGTCCTGGAAGGTAGACCAGCTGCAAGAAGGCTGCAGTTACTATTTCCGTGTCCTCGCTGAAAACGAATATGGCATTGGACTGCCCGCCGAAACAG

CTGAGTCTGTGAAGGCATCGGAGCGACCTCTTCCTCCAGGGAAGATAACTTTGACGGATGTCACACGAAACAGTGTGTCTCTCTCTTGGGAGAAGCCAGA

ACATGACGGGGGCAGCCGAATTCTAGGCTACATTGTAGAGATGCAGAGCAAAGGCAGTGACAGATGGGCCACGTGTGCCACAGTGAAAGTCACAGAAGCC

ACCATCACCGGCCTGATCCAGGGTGAGGAATACTCTTTCCGTGTTTCAGCGCAGAATGAAAAGGGCATCAGTGACCCCAGACAACTGAGTGTGCCAGTAA

TTGCTAAAGACCTTGTTATCCCACCAGCCTTCAAACTCCTCTTCAATACATTCACGGTACTGGCAGGTGAAGACCTGAAAATTGATGTACCATTCATTGG

ACGCCCTCCACCAGCTGTCACCTGGCATAAAGATGACATACCTCTGAAGCAAACAACTAGAGTGAATGCAGAGAGCACGGAAAACAATTCTCTACTGACA

ATAAAGGAAGCCTGCCGAGAAGATGTTGGACATTACACGGTTAAACTGACTAACTCGGCAGGTGAAGCCACTGAAACCCTTAATGTTATCGTTCTTGACA

AGCCAGGGCCCCCAACAGGACCAGTGAAGATGGATGAAGTGACAGCAGACAGTGTCACTCTTTCCTGGGAACCACCAAAGTATGATGGCGGAAGCTCTAT

CAATAATTACATTGTAGAGAAACGAGACACATCCACAACCGCCTGGCAAATCGTGTCAGCTACGGTTGCAAGAACAACCATAAAGGCCTGCAGACTAAAG

ACTGGCTGTGAGTATCAGTTCAGAATTGCAGCAGAAAACAGATATGGGAAGAGTACCTACCTCAACTCAGAGCCTGTTGTTGCCCAGTACCCATTCAAAG

TGCCAGGGCCACCGGGCACACCATTCGTCACGCTTGCCTCCAAAGACAGCATGGAGGTACAATGGCATGAGCCAGTCAGTGATGGTGGGAGCAAAGTCAT

TGGCTACCATCTAGAGCGCAAGGAAAGAAATAGCATCCTCTGGGTCAAGCTGAATAAGACACCTATTCCTCAAACCAAGTTCAAGACAACTGGCCTTGAA

GAAGGCATTGAATATGAATTTAGAGTGTCTGCAGAGAACATCGTAGGCATCGGCAAGCCAAGTAAGCCATCAGAATGTTATGCTGCTCATGACCCATGCG

ATCCACCAGGTCGGCCAGAGGCAATCATTGTCACAAGGAACTCTGTGACTCTTCAGTGGAAGAAACCCACCTACGATGGTGGAAGCAAGATCACTGGTTA

CATTGTTGAGAAGAAAGAATTGCCTGATGGCCGCTGGATGAAAGCCAGTTTTACAAATATCATTGACACCCAGTTTGAGGTAACTGGCCTACTGGAAGAT

CATAGATATGAGTTTCGAGTTATAGCTCGAAATGCTGCAGGAGTTTTCAGTGAGCCCTCAGAAAGTACAGGGGCAATCACAGCAAGAGATGAGGTTGAGC

CACCCAGAATAAGCATGGACCCCAAATACAGGGACACGGTTGTGGTTCAAGCTGGTGAGTCATTCAAGATCGATGCAGATATATATGGCAAACCAATACC

GACCACTCAGTGGGTAAAGGGTGACCAGGAGCTTTCAAGCACAGCTCGGTTAGAAATTAAGAGCACCGACTTTGCCACCAGTCTCAGTGTCAAAGATGCG

GTACGTGTGGATAGTGGCAATTATATCCTAAAGGCCAAAAACGTTGCAGGGGAGAAATCAGTTACTATCAATGTCAAAGTTCTCGATAGACCAGGGCCAC

CTGAGGGACCTGTTGCTATATCAGGGGTTACAGCAGAAAAATGTACTCTAGCTTGGAAACCCCCACTTCAGGATGGTGGGAGTGACATCACAAATTACAT

TGTGGAAAGGCGAGAAACCAGCCGCCTCGTCTGGACTCTGGTTGATGCCAATGTGCAAACGCTCAGCTGTAAAGTCCTGAAGCTTCTTGAGGGCAATGAA

TATATTTTCCGTATAATGGCTGTGAACAAATACGGTGTTGGTGAACCTCTTGAATCTGAGTCATTGATTGCCAAGAATCCATTTGTAGTCCCAGATGCAC

CCAAAGCTCCAGAAGTTACAGCTGTGACCAAAGACTCAATGATTGTTGTATGGGAAAGGCCAGCGTCTGATGGTGGCAGTGAGATTCTAGGATATGTTCT

AGAAAAACGGGACAAAGAAGGCATAAGATGGACAAGATGCCACAAGCGTCTAATTGGAGAGCTGCGCCTGAGAGTGACTGGACTGTTAGAAAATCACAAT

TATGAATTCAGAGTCTCCGCTGAAAATGCTGCTGGACTTAGTGAACCAAGCCCCCCTTCTGCTTACCAGAAGGCATGTGACCCCATTTATAAGCCAGGCC

CTCCAAACAACCCCAAAGTCATGGATGTTACCAGATCTTCGGTTTTCCTTTCTTGGACCAAACCTATCTATGATGGTGGCTGTGAAATCCAAGGATACAT

CGTAGAAAAATGTGATGTGAGTGTTGGTGAATGGACAATGTGTACGCCACCAACTGGAATCAATAAGACAAATCTAGAAGTCGAGAAGTTGTTGGAAAAG

CATGAATACAACTTCCGGATCTGTGCCATTAATAAGGCCGGAGTAGGGGAGCATGCTGATGTCCCTGGGCCTGTAATGGTTGAAGAAAAACTTGAAGCAC

CTGATATAGACCTTGACCTTGAACTAAGGAAAGTGATTAATATAAGGGCAGGTGGTTCCTTAAGGCTGTTTGTTCCTATAAAAGGCCGTCCTACACCAGA

AGTCAAGTGGGGGAAGGTTGATGGTGATATCCGGGACGCAGCTATAATTGATGTCACTAGCAGCTTCACCTCTCTTGTTCTTGACAATGTCAATCGATAT

GATAGTGGAAAATACACTCTCACACTAGAAAACAGCAGTGGAACAAAATCTGCCTTTGTGACGGTAAGGGTCCTGGACACACCAAGCCCACCTGTCAACT

TAAAAGTCACAGAAATCACCAAGGACTCGGTATCAATTACATGGGAACCTCCTTTGTTGGACGGAGGATCAAAAATTAAAAATTACATTGTTGAGAAACG

AGAAGCCACAAGAAAATCCTATGCTGCAGTTGTAACAAACTGCCATAAGAATTCGTGGAAAATCGATCAGCTCCAAGAAGGTTGCAGTTACTACTTCAGG

GTTACCGCTGAGAACGAATACGGTATTGGCTTGCCTGCCCGCACTGCAGATCCAATCAAGGTTGCAGAAGTCCCACAACCTCCAGGGAAAATAACTGTGG

ATGATGTCACCAGAAACAGTGTCTCTCTCAGTTGGACAAAGCCCGAACATGACGGTGGCAGTAAAATCATCCAGTATATCGTAGAAATGCAAGCTAAAAA

CACTGATAAGTGGTCAGAGTGTGCTAGGGTGAAGTCCCTTGACGCAGTTATTACCAACCTAACTCAGGGAGAAGAATACCTTTTCAGAGTCATTGCTGTA

AATGAAAAAGGAAGAAGCGACCCCAGGTCCCTTGCGGTTCCAATCATCGCCAAAGATCTGGTCATCGAGCCAGACGTGAGACCAGCATTCAGCAGTTACA

GTGTACAGGTTGGCCAAGACTTGAAAATAGAAGTGCCAATTTCTGGACGTCCTAAACCAAGCATTTCCTGGACTAAGGATGGGATGCCATTGAAGCAGAC

CACAAGAATCAATGTTACCGACTCCCTGGACCTCACCACACTCAGCATTAAAGAAACTCATAAGGATGATGGTGGACAGTATGGAATCACAGTTTCCAAT

GTGGTGGGTCAGAAAACAGCAGCTATTGAAATCATAACTCTAGATAAACCTGATCCTCCAAAAGGGCCTGTTAAATTTGATGAGATCAGTGCTGAGAGCA

TCACATTATCCTGGAACCCTCCCTTATATACAGGGGGCTGTCAAATTACCAACTACATTGTTCAGAAAAGAGACACAACCACCACAGTATGGGATGTCGT

CTCTGCTACTGTTGCCAGAACGACCCTCAAAGTAACCAAGCTGAAAACGGGTACAGAATACCAATTCAGAATATTTGCTGAAAACCGATACGGACAAAGC

TTTGCTCTGGAGTCTGAGCCAGTTGTAGCTCAATATCCCTACAAAGAACCAGGCCCTCCAGGAACGCCATTTGTCACAGCCATCTCCAAAGAGTCTATGG

TGGTACAGTGGCATGAACCGATCAATAATGGTGGAAGCCCAGTCATAGGTTACCACCTTGAGAGAAAGGAAAGGAATAGTATTTTGTGGACAAAAGTCAA

CAAAACCATTATTCATGACACCCAGTTTAAAGCACTGAACCTTGAAGAAGGCATTGAGTATGAATTTAGAGTTTATGCTGAAAATATTGTTGGGGTAGGC

AAGGCAAGCAAGAATTCTGAATGCTATGTAGCCAGAGACCCCTGTGACCCACCAGGTACCCCAGAAGCAATAATAGTTAAGAGAAATGAAATCACTTTAC

AGTGGACCAAGCCTGTGTACGATGGTGGCAGTATGATCACAGGTTACATCGTAGAGAAACGTGATTTACCCGAGGGTCGCTGGATGAAAGCCAGTTTCAC

AAATGTCATTGAAACTCAATTCACCGTGTCAGGTCTTACTGAAGATCAAAGATATGAATTCAGAGTCATTGCAAAGAATGCAGCTGGGGCAATAAGTAAA

CCCTCTGACAGTACTGGACCAATAACTGCCAAGGATGAGGTTGAACTCCCACGAATTTCAATGGATCCAAAATTCAGAGACACAATAGTGGTAAATGCTG

GAGAAACATTCAGGCTTGAGGCCGATGTCCATGGAAAACCCCTACCCACCATTGAGTGGTTAAGAGGAGACAAGGAAATTGAAGAATCTGCCAGGTGTGA

AATAAAGAACACAGATTTCAAAGCTTTACTTATTGTAAAAGATGCCATTCGAATTGATGGTGGACAGTATATTTTAAGAGCCTCGAATGTTGCCGGGTCT

AAGTCATTTCCAGTAAATGTGAAAGTGCTAGACAGACCAGGACCACCAGAAGGGCCAGTTCAGGTTACTGGAGTCACAGCTGAAAAGTGCACTTTGGCAT

GGTCTCCACCACTTCAAGATGGTGGCAGTGACATTTCTCACTACGTGGTAGAAAAGCGAGAAACCAGTCGACTTGCATGGACTGTGGTTGCTTCAGAAGT

TGTGACTAATTCTCTGAAAGTTACCAAGCTCTTAGAAGGGAATAAATATATTTTCCGAATAATGGCTGTCAACAAGTACGGTGTCGGGGAACCTTTGGAA

TCTGCTCCAGTACTCATGAAAAATCCATTTGTGCTTCCTGGACCACCAAAGAGCTTAGAAGTCACAAACATTGCCAAAGACTCCATGACAGTCTGCTGGA

ATCGGCCAGACAGTGATGGTGGCAGTGAGATCATTGGTTACATTGTGGAGAAGAGAGACAGAAGTGGCATTCGGTGGATCAAGTGTAACAAACGCCGCAT

TACAGATTTGCGACTCAGGGTGACAGGATTAACAGAAGACCATGAGTATGAATTCAGAGTCTCTGCAGAAAATGCTGCTGGAGTTGGAGAACCAAGTCCT

GCTACCGTTTACTATAAGGCATGTGATCCTGTGTTCAAACCTGGCCCACCCACCAATGCACACGTTGTAGACACCACTAAAAATTCAATTACACTTGCCT

GGAGCAAACCTATCTATGATGGCGGCAGTGAGATCCTGGGCTACGTTGTAGAAATCTGTAAAGCTGATGAAGAAGAATGGCAAATAGTTACTCCACAGAC

TGGCCTGAGAGTCACTCGATTTGAAATTGCCAAACTAATCGAACACCAAGAATATAAAATACGAGTTTGCGCCCTCAACAAAGTTGGTTTAGGTGAGGCT

GCCTCAGTTCCTGGTACGGTGAAACCGGAAGATAAACTCGAGGCACCTGAACTTGACCTTGACTCTGAGTTAAGGAAAGGGATCGTTGTCAGAGCTGGTG

GATCTGCCAGAATCCATATTCCATTCAAGGGTCGTCCAACGCCTGAGATCACTTGGTCAAAAGAGGAAGGTGAATTCACAGATAAGGTCCAAATTGAGAA

GGGAATTAACTTCACCCAACTCTCAATAGATAACTGTGACAGAAACGACGCCGGGAAATACATCCTCAAGTTGGAGAACAGCAGCGGATCAAAGTCGGCT

TTCGTAACCGTGAAAGTACTTGACACACCAGGACCGCCACAGAATCTGGCTGTCAAGGAAGTGAGAAAAGACTCTGTCCTTCTGGTATGGGAGCCACCTA

TCATTGACGGTGGGGCAAAGGTCAAGAACTATGTCATCGACAAGCGCGAGTCCACTCGAAAAGCATATGCTAACGTGAGTAGTAAATGCAATAAAACGAG

CTTCAGAGTCGAGAACCTGACCGAAGGAGCCATCTACTACTTTAGAGTCATGGCAGAGAATGAATTTGGGGTTGGTGTTCCCACGGAGACATCTGATGCT

GTGAAAGCTTCTGAGCCTCCTTCCCCACCAGGAAAGGTCACACTCACTGACGTGTCCCAGACCAGTGCATCCCTTATGTGGGAGAAACCCGAGCATGATG

GAGGGAGCAGAATTCTGGGCTATGTTGTTGAAATGCAGCCCAAAGGAACAGAAAAGTGGAGCGTTGTGGCTGAATCCAAAGTCTGTAATGCAGTGGTTAG

TGGCCTGAGCTCCGGGCAAGAATATCAGTTCCGTGTCAAAGCTTACAATGAGAAAGGAAAAAGTGACCCGAGAGTGCTTGGCATTCCTGTCATAGCCAAG

GACTTGACCATCCAGCCTAGTTTTAAGCTGCCATTTAATACATATAGTGTCCAAGCGGGAGAGGATCTGAAAATAGAAATTCCAGTCATAGGCAGACCAA

GACCTAAAATTTCTTGGGTCAAAGATGGTGAGCCTCTTAAACAGACCACCAGAGTAAATGTTGAAGAAACGGCTACTTCGACTATTTTACACATTAAAGA

AAGCAGCAAAGATGACTTCGGGAAATACAGTGTCACAGCAACAAACAGTGCAGGCACAGCAACAGAAAACCTCAGTGTTATTGTTTTAGAAAAGCCTGGT

CCTCCCGTTGGACCAGTGAAGTTTGATGAAGTTAGTGCAGACTTTGTGGTCATATCTTGGGAACCTCCCGCCTATACTGGTGGGTGCCAAATCAGCAACT

ACATTGTAGAGAAGCGAGATACTACCACTACCAACTGGCAGATGGTGTCAGCAACAGTTGCCAGGACAACCATTAAAATAAGCAAACTGAAAACAGGCAC

CGAATACCAGTTTAGGATTTTTGCTGAGAACAGGTATGGGAAAAGCACTCCCCTGGATTCTAAGCCCGTTGTTGTACAATATCCATTTAAAGAGCCTGGA

CCACCTGGAACCCCTTTTGTAACATCTATCTCCAAAGATCAAATGCTTGTGCAGTGGCATGAGCCAGTTAATGATGGAGGCAGCAAAGTGACTGGCTACC

ATCTTGAACAGAAGGAAAAGAATAGCATCCTGTGGGTCAAGTTGAATAAGATCCCCATCCAAGACACCAAATTCAAAACAACGGGGCTTGATGAAGGGCT

TGAATATGAGTTCAGGGTTTCTGCCGAGAACATTGTGGGCATTGGCAAGCCTAGCAAAGTGTCAGAGTGCTATGTTGCGCGTGATCCGTGTGACCCACCT

GGTCGACCTGAAGCCATCGTCATTACAAGAAACAGCGTCACGCTGAAATGGAAGAAACCTGTTTATGATGGTGGCAGCAAGATAACGGGTTACATCGTAG

AAAAGAAAGACCTTCCTGACGGCCGGTGGATGAAAGCCAGCTTCACCAATGTTGTGGAAACTGAGTTTACAGTGACTGGGCTTGTAGAAGACCAAAGATA

TGAATTTAGAGTCATTGCAAGAAATGCGGCTGACAACTTTAGTGAGCCATCTGAAAGCAGTGGCGCCATCACTGCAAGGGATGAAATCGATGCACCAAAT

GCCTCGCTGGATCCTAAATACAGAGATGTCATCATTGTTCATGCAGGAGAGACCTTTGTTCTCGAAGCTGATATCCGTGGCAAACCCATACCTGACATCA

TATGGTCAAAAGATGGGAACGAACTCGAAGAAACAGCAGCTAGGATGGAAATTAAATCTACTCTGCAGAAAACGACTCTCATTGTCAAGGACTGTATACG

CACCGATGGGGGACAGTATACCTTGAAACTCAGCAATGTCGGGGGCACCAAGACTATACCTATTACCGTGAAGGTGCTGGATAGGCCAGGGCCTCCCGAA

GGACCTCTGAAAGTTACTGGAGTTACAGCCGAAAAGTGTTACCTGGCATGGAACCCACCTTTGCAAGATGGTGGTGCTAGTATTTCACATTACATCATTG

AAAAGAGAGAGACAAGCAGACTCTCCTGGACCCAGGTTTCAAATGAAGTACAGGCCCTCAACTACAAAGTCACGAAGTTGCTTCCTGGGAACGAGTATAT

TTTCCGGGTTATGGCAGTGAATAAATATGGAATTGGAGAGGCCCTGGAGTCTGAACCGGTGATAGCCTGTAACCCATACAAGCGTCCAGGTCCTCCTTCA

ACACCCGAGGCCTCAGCCATCACCAAAGACTCTATGGTACTAACATGGACACGTCCAGTGGATGACGGAGGTGCTGAAATTGAGGGGTACATTCTTGAAA

AGCGAGATAAGGAAGGCATCAGATGGACCAAGTGCAACAAGAAAACATTAACAGACCTTCGGTTCAGGGTGACAGGCCTCACAGAAGGCCACTCCTATGA

ATTCAGAGTTGCTGCTGAGAACGCAGCTGGTGTCGGGGAACCCAGTGAGCCGTCCGTTTTCTACCGTGCATGTGATGCCTTGTATCCACCAGGTCCACCA

AGCAACCCCAAAGTGACAGACACCTCCAGGTCTTCTGTCTCCCTAGCATGGAATAAGCCAATTTATGATGGTGGTGCACCCGTTAGAGGATATGTGATTG

AGCTCAAAAAAGCTGCGGCTGACGAATGGACTACCTGTACGCCACCATCGGGATTACAAGGGAAGCAGTTCACAGTGACCAAGCTTAAGGAGAATACAGA

GTACAACTTCCGCATCTGTGCTTTCAATACTGAAGGTGTAGGTGAGCCTGCAACGATACCAGGCTCCGTTGTTGCTCAGGAGAGGATGGAAGCACCAGAA

ATAGAACTGGATGCTGATCTCAGAAAGGTGGTCACTCTGCGTGCAAGTGCCACTTTGCGCCTATTTGTCACTATCAAAGGCCGCCCAGAACCTGAAGTTA

AGTGGGAAAAGGCTGAAGGCATTCTCACGGAAAGAGCCCAGATCGAGGTGACGAGTTCTTATACAATGCTGGTGATTGACAACGTGACCAGATTTGACAG

TGGTAGATACAACCTCACCCTAGAAAACAACAGTGGCTCCAAAACGGCTTTTGTCAATGTCAGAGTTCTTGACTCACCAAGCGCACCCGTGAATCTGACC

ATAAGAGAAGTGAAGAAAGACTCGGTGACGCTGTCCTGGGAGCCACCACTTATTGACGGTGGAGCAAAGATTACAAATTATATCGTTGAAAAACGAGAAA

CTACAAGAAAAGCTTACGCTACCATTACAAACAACTGCACTAAGAATACTTTCAAAATCGAAAATCTACAAGAAGGGTGTTCTTATTACTTCCGAGTCCT

GGCTTCTAATGAATATGGGATTGGTTTGCCAGCCGAAACAGCAGAGCCTGTCAAAGTGTCCGAACCACCACTCCCACCTGGAAGGGTAACCCTTGTAGAT

GTGACCCGTAATACAGCTACGATTAAGTGGGAGAAGCCAGAGAGCGATGGCGGCAGCAAGATCACTGGTTATGTTGTGGAAATGCAGACAAAGGGCAGTG

AAAAGTGGAGCGCATGCACACAAGTGAAGACTTTGGAGACAACTATATCTGGCCTAACTGCAGGGGAAGAGTATGTCTTCAGGGTAGCTGCAGTTAATGA

AAAAGGAAGAAGCGACCCAAGACAGCTTGGGGTGCCAGTCATTGCAAAAGACATTGAAATAAAGCCCTCCGTTGAGCTTCCTTTTAATACTTTCAACGTT

AAGGCTAATGACCAACTCAAAATTGACATACCATTTAAAGGAAGACCTCAAGCTACCGTGGCCTGGAAAAAAGATGGTCAGGTCCTTAGAGAGACAACTA

GAGTCAACGTAGCTTCCTCAAAGACCGTAACAACCCTATCTATTAAAGAAGCCTCAAGGGAAGATGTTGGAACTTACGAACTATGTGTTTCAAATACTGC

TGGATCCATAACAGTTCCTATTACTGTCATTGTCCTTGACAGGCCAGGACCTCCAGGACCCATACGAATTGATGAAGTTAGTTGTGACAATGTGTCTATT

TCTTGGAATCCTCCAGAGTATGATGGTGGCTGCCAAATTAGCAACTACATTGTTGAAAAGAGAGAAACCACTTCTACAACGTGGCAGGTAGTTTCACAAG

CAGTGGCAAGAACATCCATTAAGATAGTCCGTCTGACAACAGGAAGTGAGTATCAGTTCCGTGTCTGTGCAGAGAATCGGTATGGAAAGAGTTCCTACAG

TGAGTCCTCAGCCGTTGTCGCTGAGTATCCATTCAGCCCTCCTGGGCCTCCTGGTACTCCTAAAGTTGTGCATGCCACAAAATCTACCATGGTTGTAAGC

TGGCAAGTACCAGTTAATGACGGAGGGAGCCAAGTGATTGGCTATCACCTTGAATACAAAGAAAGAAGCAGCATTCTCTGGTCAAAAGCAAACAAAGTCC

TCATTGCAGATACTCAGATGAAGGTCTCTGGTCTGGATGAGGGGCTGATGTACGAGTATCGTGTATATGCTGAGAATATCGCTGGAATTGGTAAATGCAG

TAAAGCCTGTGAACCGGTCCCTGCAAGAGACCCTTGTGACCCTCCTGGACAACCTGAAGTCACCAATATCACAAGAAAATCAGTGTCACTTAAGTGGTCT

AAACCACGTTATGATGGTGGAGCGAAGATCACCGGATACATTGTTGAACGCAGAGAGCTACCGGACGGCAGGTGGCTGAAGTGCAATTTCACCAACGTTC

AGGAAACATACTTTGAAGTAACTGAGCTAACTGAAGACCAGCGTTATGAATTCCGGGTTTTTGCAAGAAATGCTGCTGATTCAGTCAGTGAGCCATCTGA

ATCCACTGGACCTATCACGGTGAAAGACGACGTTGAGGCGCCAAGAATTATGATGGATGTCAAATTCCGAGATGTCATCATTGTCAAGGCCGGAGAAGTC

CTTAAGATAAATGCAGACATTGCAGGGCGACCTCTGCCGGTAATTTCCTGGGCCAAAGATGGGGTAGAAATTGAAGAAAGGGCAAAAACAGAAATTGTCT

CAACAGACTATACTACCACATTAACAGTTAAAGACTGTGTAAGAAGAGACACTGGGCAGTATGTCCTTACACTGAAGAATGTGGCAGGAACTCGGACTAT

GGCAGTTAACTGTAAAGTACTTGATAAGCCTGGCCCGCCAGCAGGGCCACTTGAAATAAATGGCCTCACTGCTGAGAAGTGCTCCCTTTCCTGGGGACGT

CCCCAGGAAGATGGCGGTGCAGATATTGATTATTATATCGTAGAAAAACGTGAAACAAGCCGCCTTGCATGGACCATATGTGAAGCAGAGTTAAGGACAA

CATCTTGTAAAGTGACCAAGCTACTCAAAGGCAACGAATATATCTTCAGAGTAACTGGTGTTAATAAATATGGTGTTGGTGAGCCCTTGGAGAGCATGGC

CGTGAAGGCGCTAGATCCATTCACCACTCCTAGCCCACCCACATCTTTGGAAATTACATCTGTGACCAAAGATTCCATGACACTTTGCTGGTCAAGACCT

GAGACTGATGGAGGCAGTGACATCTCTGGATACATAATCGAAAGGCGTGAGAAAAACAGTCTACGGTGGATGCGTGTGAACAAGAAGCCAGTGTATGATC

TGAGAGTGAAGTCCACAGGACTCCGAGAAGGATGTGAATATGAGTATCGGGTTTTTGCTGAAAATGCTGCCGGCCTGAGTCTTCCAAGTGAAACTTCTCC

CTTGGTTCGAGCAGAAGACCCTGTGTTCTTGCCATCTCCTCCATCTAAACCCAAAATAGTGGACTCGGGCAAGACAACAATCACCATTGGCTGGGTTAAA

CCTTTGTTTGACGGTGGGGCTCCAATAACGGGATATACCGTAGAATACAAAAAGTCTGAGGAAACCGACTGGAAAGTTGCCATTCAGAGCTTCAGAGGCA

CAGAATACACAATGAGTGGGCTAACAACAGGAGACGAGTATGTTTTTAGAGTGAGGTCACTCAATAAGATGGGTGCCAGTGACCCCAGTGATAGCTCCGA

TCCCCAGGTAGCCAAAGAGAGAGAAGAAGAACCTGTATTTGACGTTGACAGTGAGATGAGGAAGACCTTGATTGTCAAGGCTGGGTCCTCGTTTACCATG

ACAGTTCCTTTCAGAGGAAGACCAATCCCCAACGTCTCCTGGAGTAAGCCCGACACCGACCTCCGCACGAGAGCGTACATCGACTCCACAGATTCTCGTA

CATTACTTACTATTGAGAATGCCAACAGAAATGATTCTGGAAAATACACGCTGACAATTCAGAATGTGCTGAGCGCTGCTTCCATGACCTTCGTCGTCAA

AGTCTTAGATTCCCCGGGGCCTCCAGCCAATATTACTGTACGTGAAGTAACCAAGGAAACTGCTATGCTGTCCTGGGATGTTCCTGAAAATGATGGCGGA

GCACCGGTGAAGAATTACCACATAGAAAAACGTGAGGCCAGCAAGAAGGCGTGGGTGTCGGTCACTAACAACTGCAACCGCCTCTCTTACAAAGTGACCA

ACTTACAGGAAGGAGCTATCTACTACTTCCGAGTCTCTGGGGAGAACGAGTTTGGTGTTGGTGTGCCAGCTGAGACAAAGGAAGGAGTCAAAATAACAG 

AAAAACCAAGCCCACCAGAAAAGCTTGGTGTAACAAGTGTATCCAAAGACAGTGTCTCATTGAGCTGGCTGAAGCCAGAACACGACGGTGGTAGCAGAAT

CATACACTATGTCGTCGAAGCACTTGAAAAAGGACAGAAAACGTGGGTTAAGTGCGCTGTGGTGAAGACAACCCACCACGTTGTTTCCGGTCTGAGAGAG

AGTCATGAGTACTTCTTCCGGGTCTTTGCAGAAAACCAAGCTGGTCTGAGTGACCCCAGGGAGCTCCTGCTTCCTGTCCTCATCAAGGACCAGCTAG AA

CCACCCGAAATTGATATGAAGAATTTCCCAAGTCACACTGTGTATGTAAGAGCTGGTTCCAACCTTAAAGTTGACATTCCAATTTCTGGAAAACCATTAC

CCAAAGTGACCTTATCAAGAGATGGTGTACCACTGAAGGCCACCATGAGATTTAATACTGAGATTACCGCTGAGAACCTGACCATCAATCTCAAAGAAAG

TGTTACCACTGACGCTGGAAGATATGAGATCACTGCTGCCAACTCCAGTGGAACCACCAAAACTTTCATTAACATCATTGTGCTGGACAGGCCTGGACCC

CCTACTGGCCCTGTAGCCATTAGTGATATAACTGAAGAAAGTGTGACTCTCAAATGGGAGCCACCAAAGTATGATGGCGGAAGCCACGTCACCAATTACA

TTGTCCTGAAGAGAGAAACAAGTACTGCAGTGTGGTCTGAAGTGTCAGCAACAGTAGCAAGAACCATGATTAAAGTCATGAAACTAACCACAGGAGAAGA

ATACCAATTCCGCATCAAGGCAGAAAATCGCTTCGGCATCAGTGATCATATAGATTCAGTGTGTGTGGTTGTCAAACTACCATACA CTACACCTGGACC

ACCATCTACACCCTGGGTATCTAACGTTACTCGAGAAAGCATCACTGTGGGTTGGCACGAACCAGTGTCCAATGGAGGTAGTGCAGTCACGGGCTACCAC

CTGGAAATGAAAGACAGAAATAGTATTTTGTGGCAGAAAGCCAACAAAATGATCATCCGTACAACTCACTTCAAAGTTACAACAATCAGCGCTGGACTTA

TTTATGAATTCAGGGTGTATGCAGAGAATGCTGCTGGTATCGGAAAGCCCAGTCACCCATCTGAACCAGTCTTGGCCATTGATGCCTGCG AACCCCCAA

GAAATGTGCGGATCACTGATATCTCAAAGAACTCTGTCAACCTTTCATGGCAACAACCAGCTTTTGATGGAGGAAGCAAGATTACAGGCTACATTGTTGA

GAGGCGCGACCTTCCAGATGGGAGATGGACCAAGGCTAGCTTCACCAATGTTATTGAGACTCAATTCACTGTCTCTGGATTGACTCAGAATTCCCAGTAT

GAATTCCGGGTCTTTGCTAGAAATGCTGTTGGTTCTGTCAGCAACCCATCTGAGGTTGTAGGCCCCATCACATGCATTGACTCTTATG GTGGGCCTGTG

ATTGACTTGCCTCTAGAATATACAGAAGTTGTCAAATATAGAGCAGGTACCTCCGTGAAGCTCAGAGCTGGTATTTCCGGCAAACCCGAGCCTACGATTG

AGTGGTACAAAGATGATAAAGAATTACAAACCAATGCATTGGTGTGTGTGGAAAATAGCACTGACCTTGCATCTATACTCATCAAAGATGCCAACCGCCT

TAACAGTGGAAGCTATGAGTTGAAACTGAGGAATGCCATGGGTTCCGCCTCAGCCACCATCAGAGTACAGATCCTTG ACAAACCAGGACCTCCAGGCGG

ACCAATTGAATTTAAGACTGTCACTGCAGAAAAGATAACTCTGCTCTGGAGGCCCCCAGCTGACGACGGTGGCGCAAAGATCACGCACTACATCGTGGAA

AAACGGGAGACAAGCCGAGTCGTGTGGTCTATGGTGGCTGAAAATCTGGAAGAGTGCATCGTTACAACTACCAAAATTATCAAAGGGAATGAGTACGTCT

TCCGAGTCCGAGCTGTGAATAAGTATGGAATTGGCGAGCCGCTAGAATCTGAGCCAGTTGTAGCCAAGAATGCCTTTG TTACACCTGGGCCTCCAAGCA

TCCCAGAGGTGACAAAGATTACCAAGAATTCAATGACTGTTGTCTGGGACAGGCCAACTGTAGATGGTGGCAGTGAAATAAATGGCTATTTCCTTGAAAG

ACGAGACAAGAAGAGTCTAGCGTGGCTTAAAGTATTAAAGGAGACTATTCGTGACACCAGACAAAAGGTGACAGGACTCACGGAAAACAGTGACTATCAG

TATCGAGTCTGTGCTGTAAATGCTGCTGGAGTGGGTCCATTCTCAGAACCATCCGACTTCTACAAGGCTGCTGATCCAATTG ATCCTCCAGGACCACCT

GCCAAGATAAGAATTGCAGACTCGACCAAATCATCCATCACCCTTGGCTGGAGTAAGCCTGTCTATGATGGTGGCAGTGATGTTACTGGATATGTGGTTG

AGATGAAACAAGGAGATGAAGAAGAATGGACCATTGTCTCTACCAGGGGAGAGGTCAGAACTACAGAATATGTGGTCTCTAACCTGAAACCCGGAGTCAA

TTATTATTTCCAAGTATCAGCAGTAAACTGTGCCGGCCAAGGAGAACCTATAACAATGACTGAACCTGCACAGGCTAAAGATGTCCTTG AGGAACCAGA

AATCGACCTAGATGTGGCTCTCAGAACATCTGTTATAGCTAAAGCTGGTGAAGATGTCCAACTACTGATTCCCTTTAAAGGCAGACCGCCACCTACTGTC

ACCTGGAGGAAAGATGAGAAGAATCTTGGCAGCGATACCAGATACAGCATCCAAAACACTGATTCGTCTTCTTTGCTTGTTATTCCTCAAGTCACTCGCA

ATGATACAGGAAAATACATCCTGACAATAGAAAACGGAGTAGGCCAACCAAAGTCTTCCACCGTGAGTGTTAAGGTGCTCGACACACCAGCTGCCTGCCA

GAAGTTACAGGTGAAACATGTTTCCCTAGGCACAGTCACATTGCTCTGGGATCCTCCTCTCATCGATGGAGGGTCTCCCATCATTAACTATGTCATCGAA

AAGAGAGATGCCACGAAGAGAACATGGTCTGTTGTGTCACACAAGTGTTCCGGCACATCCTTTAAAGTAACAGATTTATCAGAGAAGACTCCATTCTTCT

TCAGGGTTCTTGCAGAAAATGAAATTGGCATTGGTGAGCCTTGCGAGACCACGGAGCCCGTGAAGGCTGCTGAGGTGCCAGCACCTATCCGAGATCTCTC

AATGAAAGATTCCACAAAGACATCTGTTGTCCTGAGCTGGACCAAGCCTGACTTTGATGGTGGGAGCATCATCACAGACTATCTGGTGGAACGGAAAGGC

AAAGGTGAACAAGCATGGTCCCATGCTGGCATCAGTAAGACATGTGAGATTGAGATTGGACAACTTAAAGAGCAATCAGTCTTGGAATTCCGAGTGTCTG

CTAGAAATGAGAAAGGACAGAGCGACCCTGTCACTATTGGGCCACTTACAGTGAAGGAGCTTGTAATTACACCTGAAGTTGACTTGTCAGAAATCCCTGG

GGCACAAATATCTGTGAGAATTGGACATAACGTACACCTTGAATTACCTTATAAAGGAAAACCCAAGCCATCCATCAGTTGGCTGAAAGATGGCTTGCCA

CTGAAGGAAAGTGAATATGTTCGTTTCAGTAAGACAGAAAACAAAATCACCTTGAGTATTAAGAATTCGAAGAAAGAGCATGGAGGGAAATATACTGTTA

TTCTTGATAATGCAGTGTGTAGAAACTCATTCCCCATTACAATCATCACCCTCGGCCCACCGTCAAAGCCCAAAGGACCCATTAGATTTGATGAAATCAA

GGCTGACAGCGCCATCATGTCATGGGACATACCTGAAGATGACGGAGGAGGAGAAATCACCTGTTACAGCATTGAGAAGCGGGAAGCATCACAAACAAAT

TGGAAGATGGTGTGTTCAAGTGTTGCCAGAACAACTTTCAAAGTTTCCAATCTGGTCAAAGATTCTGAATACCAGTTTAGAGTTAGAGCAGAAAATAGAT

ATGGAGTCAGTGAGCCACTTGCCTCAAATATCATCGTGGCAAAACACCAATTCAGGATTCCTGGTCCTCCAGGAAAGCCAGTCATCTACAATGTAACTTC

GGATGGCATGTCACTAACTTGGGATGCACCAGTTTATGATGGTGGTTCAGAAGTTACTGGATTCCATGTTGAAAAGAAAGAAAGAAACAGCATTCTTTGG

CAAAGGGTTAACACATCACCAATATCTGGGAGAGAATACAGAGCTACTGGCTTAATAGAAGGGCTGGACTATCAATTCCGTGTATATGCTGAGAATTCTG

CTGGCCTGAGCTCACCTAGTGACCCAAGCAAGTTTACATTAGCTGTTTCCCCAGTAG ACCCACCCGGCACTCCTGACTACATTGATGTCACCCGGGAAA

CCATCACACTTAAATGGAACCCACCATTACGTGATGGGGGCAGTAAGATCGTGGCCTACAGCATTGAGAAGCGGCAAGGAAGTGACCGCTGGGTGAGATG

CAACTTCACTGACGTCAGTGAGTGTCAGTACACAGTTACGGGACTCAGTCCTGGAGATCGATATGAGTTCAGAATAATTGCAAGAAATGCTGTTGGCACT

ATAAGCCCCCCCTCACAGTCTTCTGGCCTCATTATGACAAGAGATGAAAACG TTCCACCAACAGTAGAATTTGGCCCTGAGTACTTCGATGGTCTTGTT

ATTAAGTCTGGAGACAGTCTTAGGATCAAAGCTTTGGTTCAAGGACGACCGGTCCCACGAGTAACTTGGTTCAAAGATGGAGTTGAAATTGAGAGGAGAA

TGAACATGGAAATAACTGATGTTCTTGGCTCTACCAGCCTCTTTGTCAGAGACGCAACTCGAGATCACCGTGGTGTTTACACCGTGGAAGCCAAAAATGT

ATCTGGTTCCACAAAAGCAGAAGTTACAGTGAAAGTACAAG ATACACCAGGAAAAGTAGTCGGGCCAATAAGATTTACTAATATTACTGGTGAAAAGAT

GACCCTGTGGTGGGAGGCACCTCTCAATGACGGCTGCGCTCCTGTCACGCACTACATCATTGAAAAGCGTGAAACCAGCAGACTTGCTTGGGCATTGATT

GAGGATAATTGCGAAGCCCTAAGTTACACTGCCATTAAACTAATCACTGGCAATGAGTATCAGTTCCGGATTTCTGCAGTTAACAAGTTTGGTGTTGGCA

GGCCACTTGAGTCCGACCCCGTGGTTGCTCAAATACAATACA CCATTCCAGATGCTCCCGGAGTTCCAGAACCTAGCAATGTCACAGGCAACAGCATTA

CCCTGACTTGGACGAGGCCAGAATCAGATGGTGGCAGTGAGATTCAACACTACATCCTTGAAAGGAGAGAAAAGAAAAGCACAAGATGGGTAAAAGTGAT

CAGCAAACGACCAATCTCTGAGACAAGGTTCAAAGTCACAGGTCTGGTGGAAGGCAACGAGTATGAGTTCCATGTCATGGCTGAAAACGCTGCGGGCATA

GGACCAGCAAGTGGGATCTCAAGACTCATTAAATGCAGAGAGCCTGTTAACCCACCAAGTGCCCCCTCGGTAGTCAAAGTGACAGACACATCAAAGACAA

CTGTGAGCTTGGAATGGGCCAGGCCAGTCTTTGACGGCGGGATGGAGATAATTGGATACATAATAGAAATGTGCAAAGCTGACTTAGGGGACTGGCACAA

AGTAAACACAGAGCCATGTGTGAAAACAAGATACACGGTCACTGATCTACAGGCTGGTGAAGAATACAAATTCCGGGTCAGTGCGGTCAATGGTGCTGGG

AAAGGAGACAGCTGTGAGGTGACCGGCACAATAAAAGCAGTCGATCGGTTATCAGCTCCCGAGTTAGACATTGATGCAAACTTCAAGCAGACTCACATTG

TTAGAGCGGGAGTTAGCATTCGTCTCTTCATTGCCTACCAGGGTAGACCCACTCCTACAGCAGTATGGAGCAAGCCTGACTCTAACCTTAGCATCCGGGC

TGATATCCACACAACAGACTCCTTCAGCACCCTCACCGTGGAAAACTGCAACAGAAATGATGCAGGGAAATACACACTCACGGTAGAAAACAACAGCGGT

AAGAAGTCGATAACATTCACTGTAAAGGTGCTGGACTCTCCAGGACCACCTGGTCCCATTACCTTCAAAGATGTGACCCGGGGATCTGCTACACTGATGT

GGGACGCCCCTCTCCTTGATGGTGGTGCCCGGATCCATCACTATGTGATAGAGAAGCGGGAAGCGAGTCGCCGTAGCTGGCAGGTTGTCAGTGAAAAATG

CACTCGCCAGATCCTCAAGGTGAGTGAGCTGACAGAAGGTGTTCCGTACTATTTCCGTGTTTCTGCTGAAAATGAGTACGGTGTTGGTGAACCCTATGAA

ATGCCAGAACCAATTGTAGCCACAGAACAGCCCGCTCCACCTAGGAGGCTTGATGTCGTTGACACTAGCAAATCCTCTGCGGTCCTAGCCTGGCTTAAAC

CCGATCATGATGGAGGTAGTCGGATCACTAGCTACCTGCTTGAAATGCGACAAAAGGGATCTGACTTCTGGGTTGAAGCTGGTCACACCAAACAGCTGAC

TTTCACAGTGGAGCGCCTCGTTGAGAATACTGAATATGAATTCCGGGTGAAAGCCAAGAACGACGCTGGCTACAGTGAACCCAGGGAAGCCTTCTCATCT

GTCATTATCAAGGAGCCTCAAATTGAGCCCACTGCTGATCTCACTGGAATCACCAATCAGCTCATCACTTGCAAAGCAGGAAGCACATTTACCATTGACG

TGCCAATCAGTGGTCGTCCTGCCCCCAAAGTAACATGGAAGCTAGAAGAAATGAGACTCAAGGAGACAGATCGAATGAGTATCGCAACAACAAAAGACAG

GACCACCCTGACTGTAAAGGACAGTATGAGAGGTGACTCTGGCAGATACTTCCTGACCCTAGAAAACACAGCCGGTGTTAAAACATTTACTATCACAGTT

GTGGTCATTGGAAGACCAGGGCCAGTAACTGGTCCCATTGAGGTCTCATCTGTCTCGGCTGAATCATGTGTCCTATCATGGACTGAACCAAAAGACGATG

GAGGCACTGAAATTACAAATTATATAGTTGAAAAGCGCGAGTCGGGTACCACCGCCTGGCAGCTTATCAATTCTAGTGTGAAGCGCACGCAGATTAAAGT

CACACACCTCACAAAATACAAAGAATACTGTTTCCGGGTCAGCTCAGAGAATAGATTCGGGGTCAGCAAGCCTCTGGAATCAGTGCCAATAGTTGCTGAA

CATCCATTTG TTCCACCAAGTGCTCCTACCAGGCCTGAGGTCTACTATGTGTCTGCCAATGCTATGTCAATTCGTTGGGAAGAACCCTACCATGATGGC

GGTAGTAAAATCGTTGGCTACTGGGTTGAGAAGAAAGAACGTAACACCATTCTTTGGGTGAAAGAAAACAAAGTGCCGTGCTTAGAGTGTAACTACAAAG

TGACAGGCTTGGTAGAAGGACTGGAGTATCAGTTCCGAACATATGCACTCAATGCTGCGGGCGTCAGCAAGGCCAGTGAAGCTTCAAGACCTATCATGGC

TCAAAATCCAGTTG ATCCACCTGGTAGGCCAGAAGTGACAGATGTCACAAGATCAACAGTGTCACTAATTTGGTCTGCCCCAGTGTATGACGGAGGCAG

CAAAGTTGTGGGCTACATCATAGAACGGAAGCCAGTCAGTGAAGTTGGAGATGGTCGCTGGCTGAAGTGCAACTATACCATTGTCTCTGATAATTTCTTC

ACTGTGACCGCTCTCAGCGAAGGGGACACTTATGAATTCCGTGTGTTGGCCAAGAACGCAGCAGGCGTAATTAGCAAAGGCTCTGAATCTACAGGCCCTG

TAACTTGCCGAGATGAATATG CTCCACCAAAAGCTGAATTGGATGCCAGGTTACAAGGCGATCTGGTGACCATCAGAGCAGGTTCAGATCTTGTTCTTG

ATGCTGCTGTTGGTGGCAAACCTGAACCCAAAATCATCTGGACCAAAGGAGACAAGGAACTGGATCTCTGTGAAAAAATTTCTCTACAGTACACTGGCAA

GCGAGCCACTGCTGTGATCAAATACTGTGACCGGAGTGACAGTGGGAAATACACACTGACAGTGAAGAACGCTAGTGGGACCAAGTCCGTATCTGTCATG

GTCAAAGTTCTTG ATTCTCCTGGCCCATGTGGAAAACTCACTGTCAGCAGAGTGACCGAGGAGAAGTGCACCTTAGCCTGGAGCCTTCCACAGGAAGAT

GGAGGAGCAGAGATAACTCACTATATTGTAGAGAGACGGGAGACTAGCAGGCTCAATTGGGTGATCGTGGAAGGGGAATGCCTGACCGCATCCTACGTGG

TTACCAGACTCATCAAGAACAATGAATACACATTCCGCGTGAGGGCAGTGAACAAGTACGGCCTCGGCGTGCCAGTTGAGTCAGAGCCTATTGTGGCCAG

AAACTCTTTCA CGATTCCATCACAACCTGGCATACCAGAAGAAGTTGGGGCTGGCAAAGAGCACATCATTATTCAGTGGACGAAACCTGAATCTGATGG

TGGCAATGAAATCAGCAACTACCTCGTCGACAAACGGGAGAAGAAAAGCTTGCGCTGGACCCGTGTCAACAAAGACTACGTGGTGTACGACACCAGGCTG

AAGGTGACCAGCCTCATGGAAGGCTGTGATTATCAGTTCCGAGTGACTGCCGTGAACGCTGCTGGCAACAGTGAGCCCAGTGAAGCTTCAAACTTCATCT

CATGCAGAGAGCCATCAT ACACCCCTGGGCCACCTTCTGCTCCAAGAGTTGTGGATACCACCAAGCGCAGCATTAGTTTGGCATGGACCAAGCCCATGT

ACGACGGTGGTACTGACATCATAGGATACGTCCTTGAAATGCAAGAGAAGGACACAGATCAATGGTGCCGAGTACATACAAACGCCACGATAAGAAACAA

CGAATTCACTGTGCCTGACCTTAAGATGGGCCAGAAGTACTCCTTCAGGGTTGCTGCTGTGAACGCCAAGGGTATGAGTGACTACAGTGAGACGACTGCT

GAAATTGAGCCCGTGGAAAGACTAG AAATACCAGATCTTGAGCTTGCAGATGATCTGAAGAAGACCGTGATTGTCAGGGCTGGAGCCTCCTTGCGCCTG

ATGGTGTCTGTCTCTGGAAGACCTTCTCCTGTCATCACGTGGAGCAAAAAAGGCATTGACCTTGCAAATCGGGCAATTATTGACAACACAGAGAGCTACT

CTTTACTCATTGTAGACAAAGTTAATCGGTATGATGCTGGAAAATACACAATTGAAGCTGAAAATCAGTCTGGCAAGAAATCAGCAACGGTCCTAGTTAA

AGTCTATG ATACTCCTGGTCCCTGCCCTTCAGTGAGCGTTAAAGAAGTTTCGAGAGATTCTGTGACCATCACTTGGGAAATCCCCACAATTGATGGTGG

TGCTCCGGTCAACAATTACATTATTGAGAAGCGAGAAGCCGCCATGAGGGCATTCAAGACAGTAACCACCAAATGCAGCAAGACTCTTTACCGCATATCT

GGACTCGTCGAGGGAACCATGTACTACTTTAGAGTGCTTCCAGAAAACATCTATGGCATCGGAGAGCCTTGCGAAACATCAGACGCAGTTCTAGTCTCAG

AAGTACCTTTGGTGCCCACAAAACTAGAAGTGGTTGATGTCACCAAATCCACTGTGACCCTTGCTTGGGAGAAACCACTCTATGACGGTGGAAGCCGACT

CACCGGATATGTTCTTGAGGCCTGCAAAGCCGGCACCGAGAGATGGATGAAAGTTGTCACTTTGAAACCCACAGTCTTAGAGCACACTGTTATTTCCCTG

AATGAAGGCGAGCAGTACTTGTTTAGAGTGAGGGCTCAAAATGAGAAAGGTGTGTCAGAACCGAGAGAGATCGTCACACCAGTGACAGTACAAGACCTCA

GAG TGTTGCCAACGATTGACCTTTCCACAATGCCCCAAAAGACCATCCATGTCCCAGCTGGCAGACCAATTGAGCTGGTGATACCGATCACTGGTCGGC

CGCCACCTACTGCTTCCTGGTTCTTTGCTGGTTCTAAACTGAGAGAATCAGAGCGTGTCACAGTTGAAACCCACACTAAAGTCACCAAGCTAACCATCCG

TGAAACTACTATAAGAGATACGGGAGAATATACGCTTGAACTAAAGAATGTTACTGGAACCACCTCAGAGACAATAAAAGTTATTATTCTTG ACAAGCC

TGGTCCACCAACTGGGCCCATCAAGATTGATGAAATTGATGCCACGTCAGTTACGATATCCTGGGAACCTCCCGAATTGGATGGTGGTGCTCCACTGAGT

GGCTATGTGGTAGAGCAGCGTGATGCTCATCGTCCAGGATGGCTGCCAGTTTCTGAGTCTGTAACAAGACCAACGTTTAAGTTTACCAGACTCACCGAAG

GAAATGAATACGTGTTCCGCGTGGCTGCAACAAACCGCTTCGGGATTGGCTCGTACTTGCAGTCTGAGGTCATAGAATGCCGAAGCAGCATCA GTATTC

CTGGACCTCCAGAAACATTACAGATATTTGATGTCTCCCGTGATGGCATGACACTTACATGGTATCCACCTGAAGATGATGGTGGCTCCCAAGTGACTGG

ATATATCGTGGAACGTAAAGAAGTAAGAGCTGATCGGTGGGTCCGTGTAAATAAAGTACCAGTGACTATGACCCGGTACCGCTCCACCGGCCTTATTGAA

GGCTTAGAATATGAACATCGGGTCACAGCCATTAATGCAAGAGGAACTGGAAAACCAAGTCGTCCTTCCAAACCCACCGTTGCCATGGATCCAATTG CT

CCACCAGGAAAACCACAAAATCCAAGAGTTACAGATACAACAAGGACTTCAGTCTCCCTGGCCTGGAGTGTTCCGGAAGATGAAGGTGGATCTAAAGTCA

CAGGGTACTTGATCGAAATGCAAAAAGTAGATCAACGTGAATGGACCAAATGTAACACCACCCCAACCAAGATTCGGGAGTATACCCTAACACACCTACC

TCAGGGCGCTGAATACAGATTCCGTGTCCTAGCCTGTAATGCTGGTGGACCTGGAGAACCTGCTGAGGTACCAGGAACCGTCAAAGTCACAGAGATGCTG

G AATACCCTGACTATGAACTTGATGAGAGATACCAGGAAGGTGTCTTTGTTCGACAAGGTGGGGTCATCAGGCTTACCATCCCAATCAAAGGAAAACCA

TTCCCAGTATGTAAATGGACCAAGGAAGGCCAAGACATTAGTAAGCGTGCCATGATTGCAACATCGGAAACACATACTGAGCTTGTGATCAAAGAAGCAG

ACAGAAACGATTCTGGAACTTACGACTTGGTTCTGGAAAACAAATGTGGCAAGAAGACCGTTTACATTAAGGTCAAGGTGATAGGAAGTCCCAACACTCC

AGAAGGGCCACTGGAATACGATGACATACAAGCCCGCTCTGTAAGGGTCAGCTGGAGACCTCCTGCTGACGATGGTGGTGCTGACATCCTGGGCTACATC

CTTGAGAGAAGAGAGGTACCTAAGGCTGCCTGGTATACCATTGACTCCAGAGTCCGAGGCACATCTCTGGTGGTGAAAGGCCTCAAAGAAAACGTGGAAT

ACCATTTCCGTGTCTCAGCAGAAAACCAGTTTGGCATAAGCAAACCCTTGAAATCTGAGGAGCCAGTCATACCAAAGACACCACTGA ATCCACCAGAAC

CACCAAGCAATCCTCCTGAAGTACTTGATGTGACCAAAAGTTCCGTTAGCTTGTCATGGTCTCGACCTAAAGATGACGGCGGCTCTCGAGTGACGGGCTA

CTACATTGAGCGCAAGGAGACATCCACTGACAAGTGGGTCAGACACAACAAAACCCAGATAACCACCACGATGTACACTGTCACCGGCCTCGTTCCCGAT

GCTGAGTACCAGTTCCGCATCATCGCACAGAATGACGTTGGCCTTAGTGAGACCAGCCCTGCTTCTGAACCTGTTGTTTGCAAAGATCCCTTTG ATAAG

CCAAGCCAACCAGGAGAACTTGAGATTCTCTCGATATCCAAAGACAGTGTCACCCTCCAGTGGGAGAAACCCGAATGTGATGGTGGCAAAGAAATCCTTG

GATACTGGGTTGAATACAGACAGTCTGGAGACAGTGCTTGGAAGAAGAGCAATAAGGAACGGATCAAGGACAGACAGTTCACCATCGGCGGTTTGCTAGA

AGCTACTGAATATGAGTTCCGAGTATTTGCTGAGAACGAGACTGGGCTCAGCCGACCACGTAGAACAGCTATGTCTGTCAAGACTAAACTAACAT CTGG

AGAAGCCCCAGGAGTGCGCAAAGAAATGGCTGATGTGACCACCAAATTAGGTGAAGCTGCACAACTCTCATGCCAGATAGTTGGAAGGCCCCTTCCTGAC

ATTAAATGGTACCGGTTTGGTAAAGAGCTCATACAAAGCCGGAAGTACAAAATGTCCTCAGATGGGCGCACGCATACTCTGACAGTAATGACAGATGAAC

AAGAAGATGAAGGTGTTTATACATGTGTAGCCACAAATGAAGTAGGAGAAGTAGAAAGCAGCAGCAAGCTTCTTCTGCAAGCGGCACCACAGTTCCATCC

TGGTTACCCACTGAAAGAGAAGTATTACGGGGCCGTGGGGTCTACGCTTCGGCTCCACGTTATGTATATTGGCCGCCCAGTACCTGCCATGACTTGGTTC

CATGGCCAGAAACTTTTGCAAAACTCAGAAAAAATCACCATTGAAAACACTGAGCACTATACTCACCTTGTCATGAAGAATGTCCAACGAAAGACTCATG

CTGGGAAATACAAGGTTCAGCTCAGCAATGCCTTTGGGACAGTGGATGCCACCCTAGATGTGGAAATACAAG ATAAACCAGACAAGCCTACTGGACCCA

TTGTGATTGAAGCACTACTCAAGAACTCGGTGGTGATCAGCTGGAAACCACCTGCTGATGATGGCGGCTCCTGGATCACCAATTACGTGGTAGAGAAATG

TGAGGCCAAAGAAGGTGCTGAATGGCAATTGGTGTCTTCAGCCATCTCGGTGACAACCTGCAGAATTGTGAACCTCACAGAGAATGCCGGCTACTATTTC

CGGGTCTCAGCTCAGAACACCTTTGGCATCAGTGAGCCACTAGAGGTCGCCTCCATTGTGATCATCAAGAGTCCATTCG AAAAGCCAGGTGTTCCTGGT

AAACCAACCATCACTGCTGTCACAAAGGATTCTTGTGTTGTGGCTTGGAAGCCACCTGCAAGCGATGGCGGTGCAAAGATCAGAAATTACTACCTTGAGA

GGCGCGAGAAGAAGCAAAACAAGTGGATTGCTGTGACGACAGAGGAAATTCGAGAAACCGTCTTCTCAGTGCAAAACCTTATTGAAGGTCTTGAATATGA

GTTCCGTGTGAAATGTGAAAACCTGGGTGGAGAGAGTGAATGGAGTGAAATATCAGAACCCGTCACTCCAAAATCCGACGTCCCGATTCAGGCTCCACAC

TTCAAGGAGGAGCTGAGAAACCTGAATGTAAGGTATCAGAGCAACGCCACTCTGGTCTGCAAGGTGACCGGTCACCCAAAGCCTATTGTGAAATGGTACA

GACAAGGCAAAGAAATTATCGCCGATGGACTCAAGTACAGGATTCAAGAATTTAAGGGCGGTTACCACCAGCTCATCATTGCAAGCGTCACAGATGATGA

TGCCACGGTGTACCAAGTCAGAGCCACCAACCAAGGGGGCTCCGTGTCTGGCACTGCTTCCTTGGAAGTGGAAG TTCCAGCTAAGATACACTTGCCCAA

GACTCTCGAAGGCATGGGAGCGGTCCATGCTCTCCGAGGGGAAGTGGTTAGCATCAAGATCCCCTTCAGTGGTAAGCCAGACCCCGTGATCACCTGGCAG

AAAGGACAAGATCTCATCGACAATAATGGCCACTACCAAGTGATTGTCACAAGATCCTTCACGTCACTTGTCTTCTCCAATGGAGTGGAGAGAAAAGATG

CTGGCTTCTATGTCGTCTGTGCTAAAAACAGATTTGGAATTGATCAAAAGACAGTCGAACTGGATGTGGCTGATGTCCCCGACCCACCCAGGGGTGTCAA

AGTTAGTGACGTCTCACGCGATTCTGTCAACTTAACATGGACAGAGCCAGCTTCTGATGGTGGTAGCAAGGTCACCAACTACATCGTGGAAAAGTGTGCA

ACTACTGCAGAAAGATGGCTCCGAGTGGGACAGGCCCGAGAAACCCGTTACACTGTGATCAACTTGTTTGGAAAAACAAGTTACCAGTTCCGAGTAATAG

CTGAAAATAAATTTGGCCTGAGCAAGCCATCAGAGCCCTCAGAACCAACCGTTACCAAAGAAGATAAGACCAGAGCTATGAATTATGATGATGAGGTGGA

TGAAACCAGAGAGGTCACCACGACTAAAGCATCACACTCCAAAACTAAAGAACTCTACGAGAAATACATGATAGCTGAAGATCTGGGGCGTGGTGAGTTT

GGAATTGTCCACCGTTGCGTTGAAACATCCTCAAAGAGGACATTCATGGCCAAATTTGTTAAAGTCAAAGGAACCGATCAGGTTTTAGTCAAGAAAGAGA

TTTCCATTCTAAACATTGCTAGGCACAGGAACATCTTATACCTCCATGAATCATTTGAAAGCATGGAAGAGTTAGTTATGATCTTTGAATTTATATCAGG

ACTCGACATATTTGAACGCATCAACACGAGCGCCTTTGAGCTTAATGAAAGAGAAATTGTAAGCTATGTCCGCCAAGTCTGCGAAGCACTGGAGTTCTTA

CATAGCCAGAATATTGGCCACTTTGACATTCGACCAGAAAATATCATTTACCAGACAAGAAAGAACTCCACTATTAAAATAATAGAGTTTGGTCAAGCCC

GTCAGCTGAAGCCAGGAGACAACTTTAGGCTGCTGTTCACTGCCCCTGAATACTATGCCCCTGAAGTCCACCAGCATGATGTTGTCAGCACTGCCACAGA

CATGTGGTCGCTTGGTACATTGGTGTATGTGCTACTGAGTGGAATCAACCCATTTTTGGCTGAAACTAACCAACAGATGATTGAGAACATCATGAACGCT

GAATATACTTTTGATGAAGAAGCCTTCAAAGAAATTAGCCTTGAAGCGATGGATTTTGTCGACCGGCTATTGGTGAAAGAGCGAAAATCTCGCATGACAG

CATCAGAGGCCCTGCAGCACCCATGGCTGAAGCAAAGGATCGACAGAGTCAGTACTAAAGTCATCAGAACACTGAAACACCGGCGGTACTACCACACCCT

GATAAAGAAAGACCTCAATATGGTTGTATCAGCAGCCCGGATCTCCTGTGGTGGTGCAATACGATCTCAGAGGGGAGTGAGCGTGGCTAAAGTTAAAGTT

GCATCCATTGAAATTGGTCCGGTCTCTGGGCAAATAATGCACGCCATTGGCGAAGAAGGCGGGTATGTCAAATATGTTTGCAAGATCGAAAATTATGATC

AGTCTACCCAGGTGACCTGGTACTTTGGCGTGAGACAGCTGGAAAACAGTGAGAAATATGAAATCACCTATGAAGATGGAGTGGCCACCATGTATGTCAA

AGACATCACCAAATTTGATGATGGGACCTACAGATGCAAAGTCGTCAATGACTACGGTGAAGATAGCTCTTACGCAGAGCTGTTCGTTAAAGGAGTGAGG

GAAGTTTATGACTACTATTGCCGCCGAACCAAGAAAGTCAAGCGCAGAACAGATGCGATGCGGCTCCTTGAAAGGCCACCAGAATTTACCCTGCCTCTCT

ATAACAAGACGGCATACGTGGGTGAAAATGTCCGTTTTGGAGTAACTATTACCGTCCACCCAGAACCTCGTGTGACGTGGTATAAATCAGGTCAGAAAAT

CAAGCCAGGTGATGATGAAAAGAAATACACATTCGAGTCTGACAAGGGTCTTTATCAATTAACAATCAACAGCGTGACCACAGACGATGATGCTGAATAC

ACCGTTGTGGCAAGGAACAAACATGGTGAAGACAGCTGTAAAGCAAAGCTGACGGTGACTTTACATCCACCCCCGACGGAAACCACGCTCAGACCCATGT

TCAAGCGGCTGCTGGCAAATGCCGAATGCCATGAAGGCCAAAGTGTCTGCTTTGAGATCAGAGTTTCTGGCATCCCTGCACCAACATTAAAATGGGAGAA

GGATGGCCAGCCGCTGTCCCTCGGGCCCCACATTGAAATTGTCCATGAAGGCTTAGATTATTATGCACTGCATATCAGGGACACTTTGCCGGAAGACACA

GGTTATTACAGAGTCACGGCCACAAACACGGCCGGATCCACCAGCTGCCAGGCTCACTTACAGGTAGAGCGGTTGCGCTACGTAAAGCAGGAATTCCAGA

GTAAAGAGGAACGTGAGCGCCATGTCCAAAAACAGATTGACAAGACACTGAGGATGGCTGAAATCCTTTCTGGAACTGAAACTGTGCCATTGACTCCCGT

AGCCCAAGAGGCTCTGCGAGAAGCTGCCATTCTTTACAAACCAGCAGTGAGCACCAAGACTGTCAAAGGAGAATACCGACTTCAGACGGAGGAAAAGAAA

GAGGAGAGAAAACTCCGCATGCCTTACGAAGTCCCAGAGCCCCGCAGGTTCAAACAAGCCACAGTAGAAGAAGACCAGCGCATCAAGCAGTTCGTGCCTA

TGTCTGACATGAAGTGGTATAAGAAGATCCGGGATCAATATGAAATGCCTGGGAAACTTGACAGAGTTGTCCAGAAAAGGCCCAAGCGCATCCGCCTTTC

AAGATGGGAACAGTTCTATGTGATGCCTCTTCCTCGCATTACTGACCAATACCGACCTAAATGGCGGATCCCCAAACTGACCCAAGACGATCTGGAAATG

GTGAGGCCGGCCCGACGGCGTACCCCTTCCCCAGATTATGATCTTTACTATTATAGAAGGAGGAGACGCTCTCTGGGTGACATGTCAGATGAGGAACTGC

TCCTCCCCATTGATGACTACCTGGCGATGAAGAGAACCGAGGAAGAGAGGCTGCGTCTGGAGGAGGAGCTTGAACTGGGCTTCTCGGCTTCACCTCCCAG

CCGAAGCCCCCCGAGGTTTGAGCTGTCTAGCCTGCGCTATTCTTCACCGCCAGCTCATGTCAAGGTGGAAGACAGAAGAAGAGACTTCAGGTACTCGACC

TATCACGTCCCCACAAAGGAGGAAACCAGCACGAGTTATGCAGAGCTGCGGGAACGGCATGCCCAGGCCTCATACAGGCAGCCGAAGCTACGGCAGAGAA

TCATGGCCGAGAAGGAGGAAGAGGAGCTACTGCGGCCAGTGACAACCACCCAGCGTCTCTCAGAATACAAGAGTGAGCTGGACTACATGTCAAAAGAAGA

AAAGTCTAAAAAGAAATCAAAACGACAGAGACAAGTGACAGAAATAACGGAAATCGAAGAGGAATACGAAATCTCAAGACGGGCTCAAAGGGAATCATCC

TCCTCCGTGTCCAGACTACTGAGACGCCGTCGCTCCTTGTCTCCAACTTATATTGAGTTAATGAGACCAGTGTCTGAGCTGATTCGGTCCCATCCACGAC

CTGCTGAGGAATATGAAGATGATGCAGAAAGAAGGTCTCCTACTCCAGAGAGAACTCGCCCACGTTCTCCCAGCCCTGTGTCTAGCGAGCGATCCCTCTC

AAGATTTGAGAGGTCTGCAAGATTTGACATCTTCTCCAGGTACGAGTCCATGAAAGCTGCCTTAAAAACTCAGAAGACATCGGAAAGGAAGTATGAGGTT

TTGAGTCAGCAGCCTTTCACACTGGACCATGCCCCTCGAATCACACTGCGGATGCGCTCCCACAGGGTTCCCTGTGGCCAAAACACACGCTTCATCCTAA

ACGTCCAGTCGAAGCCGACTGCCGAAGTTAAATGGTACCACAATGGTGTAGAACTCCAAGAGAGCAGTAAGATTCATTACACCAACACAAGTGGGGTCCT

GACCTTGGAGATTCTGGACTGCCAGACTGAGGACGGTGGAACCTACCGTGCCGTGTGCACCAACTACAAAGGAGAGGCATCAGACTACGCAACCCTGGAT

GTAACTGGCGGAGCTTATACCACCTATGCATCCCAGCGCAGAGATGAGGAGGTCCCCAAGTCAGTCTTCCCTGAACTGACAAAAACAGAGGCATATGCAG

TCTCGTCGTTCAAGAGAACATCTGAGCTGGAAGCTGCTTCTTCAGTCAGGGAAGTGAAGTCACAAATGACAGAGACGAGGGAAAGTCTCTCAACCTATGA

GCATTACGCCTCTGCGGAAATGAAAAGCGCCACATCAGAGGAAAAGTCACTGGAAGAAAAAGCCACGGTGAGAAAGATTAAGACAACACTGGCAGCAAGA

ATTTTAACCAAGCCACGCTCCATAACTGTCCATGAAGGTGAGTCTGCGAGGTTTTCCTGCGACACTGATGGGGAGCCGGTACCAACAGTGACCTGGCTGC

GTGAAGGACAAGTGGTGAGTACTTCTGCTCGCCACCAAGTGACCACCACCAAGTACAAGTCGACCTTTGAGATTTCTTCAGTTCAGGCCTCTGATGAGGG

CAACTACAGCGTGGTAGTTGAAAACAGCGATGGGAAGCAAGAAGCACAGTTCACCCTGACCGTGCAAAAGGCCAGGGTTATTGAAAAGGCTGTGACGTCA

CCACCCAGAGTCAAGTCCCCAGAGCCTCGGGTGAAGTCCCCAGAAACAGTGAAGTCTCCCAAAAGAGTGAAATCTCCAGAACCAGTAACTTCTCATCCAA

AAGCCGTGTCACCCACAGAGACAAAGCCAACAGAGAAGGGTCAACATCTCCCAGTCTCTGCCCCACCAAAGATAACTCAGTCCCTGAAAGCAGAAGCTTC

TAAAGACATTGCAAAGCTGACCTGTGCGGTTGAAAGTAGTGCACTGTGTGCAAAAGAGGTCGCCTGGTATAAAGATGGCAAGAAACTCAAGGAAAATGGG

CATTTTCAATTTCATTACTCAGCAGATGGGACCTACGAACTCAAAATTCACAACCTTAGCGAATCTGATTGCGGAGAGTATGTTTGTGAGGTCTCTGGTG

AAGGAGGAACTTCCAAAACCAGCTTCCAGTTTACTGGACAATCCTTCAAGAGTATCCATGAGCAGGTGTCAAGCATATCAGAAACTACAAAATCGGTTCA

GAAAACTGCTGA GTCACCAGAAGCCAAGAAGCAGGAACCAATAGCTCCTGAATCAATTTCCTCAAAGCCAGTAATTGTTACTGGGCTGCGGGATACAAC

AGTTTCTTCAGACAGTGTTGCTAAATTTACAATTAAAGTTACTGGAGAGCCCCAGCCAACTATCACCTGGACAAAGGATGGAAAG GCTATTGCACAAGG

CAGTAAATACAAACTCTCTAGCAACAAAGAAGAATTCATCTTAGAAATCCTCAAGACCGAGACATCTGATGGCGGACTTTACGCCTGTACAGTAACAAAT

TCTGCTGGATCTGTGTCCTCGAGCTGCAAGCTGACAATAAAAG CTGTAAAAGACACCGAGGCACAGAAAGTATCTACCCAGAAGACCTCCGAAGTCACA

TCTCAGAAGAAAGCGAGTGCCCAAGAGGAAATTTCTCAAAAAGCCCTAACTTCTGAAGAAATCAAAATGTCAGAAGTAAAATCTCATGAAACGCTGGCCA

TCAAGGAGGAAGCGTCCAAAGTTCTGATTGCTGAGGAGGTCAAGAGGTCAGCAGCAGCCTCCCTGGAGAAATCCATCGTCCATGAAGAAGTCACCAAAAC

CTCACAGGCATCCGAAGAAGTCAAAACTCACGCGGAGATCAAAACACTGTCTACCCAGATGAACATAACCAAGGGCCAGCGAGCGACCCTGAAAGCCAAC

ATTGCTGGGGCCACAGATGTGAAATGGGTCCTGAACGGCACTGAGCTTCCGAACTCAGAGGAATACAGATACGGGGTATCTGGCAGTGACCAAACTCTCA

CCATCAAACAAGCCAGTCACAGAGAGGAAGGGATCCTCAGCTGCATAGGCAAAACCAGCCAGGGAGTTGTCAAGTGTCAGTTTGACTTGACCCTGAGTGA

AGAACTCTCGGATGCTCCAAGCTTCATCACACAGCCCAGATCTCAAAACATTAACGAGGGACAAAATGTTCTCTTTTCTTGTGAGGTCAGCGGGGAGCCG

TCCCCTGAAATTGAGTGGTTTAAAAATAACCTTCCA ATTTCCATTTCTTCAAATATCAGTGTGAGTCGCTCCAGAAACGTGTACACTCTTGAAATCCGA

AATGCGGCTGTAAGTGACAGCGGAAAGTACACAATTAAGGCTAAGAATTTCCACGGCCAGTGCTCTGCAACAGCGTCCCTCACAGTGCTCC CTCTGGTG

GAAGAACCACCGAGAGAGGTGGTATTGAAAACGAGCAGTGACGTGAGCTTGCACGGAAGCGTCTCGTCTCAGTCAGTCCAAATGTCTGCCTCTAAGCAGG

AGGCATCCTTCAGCAGCTTCAGCAGCAGCAGCGCTAGCAGCATGACTGAAATGAAGTTTGCGAGCATGTCTGCCCAAAGCATGTCTTCCATGCAAGAGTC

CTTTGTAGAAATGAGTTCCAGCAGTTTTATGGGAAAATCTAGCATGACACAACTGGAAAGCTCAACCAGTAGAATGCTCAAAGCAGGCGGAAGAG GAAT

TCCACCTAAAATTGAAGCTCTTCCCTCTGATATCAGCATCGACGAAGGCAAAGTCCTAACAGTAGCCTGTGCCTTTACTGGGGAGCCTACTCCAGAAATA

ACATGGTCCTGTGGTGGAAGGAAAATCCAAAACCAAGAACAACAAGGAAGATTCCACATTGAAAACACAGATGACCTGACCACCCTGATCATCATGGACG

TACAGAAACAAGATGGCGGACTTTATACCCTAAGCTTAGGGAATGAATTTGGATCTGACTCTGCCACTGTGAATATTAATATCCGTTCTATGTAAGAGGG

CCAGGGCCAAGAGCGGGGGCCCTTTACACTCGATGCTCATTCATAATCTCTCTCAAATGATTCACATGAACTAATCTTTCTGACCTGTAAATATTTTTAA

GTAGTTTTATATCCATCTGAATGAGTCACAGTTCCAAAACTATGCATTTCAATCCTTTCATACTTGACCTGAGAATATTTGCTAATGACACACATGTACA

TACTGTATATAGCCGGGTTCACGGTTATAAAGTTTTGTACCATTTTATTTTATGACATTTTACACTGTAACTTTTGAAACTAACTGTTGGTGGGAGAAAG

TTTCTTATAGATTATAGAACGAATACCCTGCCAATACTTAATCAATCTTTGTGCCTCAACATACTGTTGATGTCTAAGTATGCCTCAGTGGGTTGAGAAA

TTCCCCACTGAAGATGTCCTATCCACCTAAAAAAAAAAGGATGCTTCTGTACATGTCCCTGACATGTGCACTGACACCTATTGAATCAGAAATGTAAGGC

ATTGGTGATGTTTGCATCTACCCTCCTGTAAGCAACACTTTAACGTCTTACGTTTTCTCTGATGATGTCACACTGAAAATTATCATGACAAATATAACCA

GAGCAAAGTGTAACGGCCATACACTTTGTTCGCCCACTTCACACTGTCTCTGGCATACAGAGTGCATGGATAGCTTGGGAAATGTACCATCTCCTGGCCA

TCCCCTCGTCTAACCAAGCTATGCAAGTATTCCTATGCCAGAGCGGTGTCGACTCCTGGAGGTCCCAGGTGCAGCTCCTGCCTTGTGTGGTAGTTCTAAA

TTCAAATTTCACCGGGAACTGGGCAACTAAGCAATGAGCCACAGCAAAATAATAATAATAATAATTTAAAAAAATGTAACAAGTGAAGCTGTCGTTAAAA

CAACAATACTACCAACTGCCCATAAAAAAAAAAATTACTAATTTGATGTAGTCCTTTTCATGCCAGTATATGTTCAATTGGTAGTTATAAATGTTGGACC

TCCTTGAGATTAAAAAAAAATAAAGCAAGCTATCTGCACCTCAAAA
Translation
 MTTQAPMFTQPLQSVVVLEGSTATFEAHVSG GSPVPEVSWFRDGQVISTSTLPGVQISFSDGRARLMIPAVTKANSGRYSLRATNGSGQATSTAELLV

TA AETAPPNFSQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELVVQG

 GEEVVPAKKTKTIVSTAQISETRQTRIEK KIEAHFDARSIATVEMVIDGATGQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPV

RHVRAPTPSPVR RSVSPAGRISTSPIRSVKSPLLIRKTQTTTMATGPEVPPPWKQEGYVASSTEAEMRETTMTSSTQIRREERWEGRYGVQEQVTISGA

AAAAASASVSSSFTAGAITTGTKE VKQETDKSAAVATVVAAVDMARVREPAISAVEQTAQRTTTTAVHIQPAQEQ ARKEAEKTAVTKVVVAADKAKEQ

ELKSRTREVMVTTQEQTHISHEQ IRKETEKAFVPKVVISATKAKEQETRITGEITTKQEQKRITQET MMKETRKTVVPKVIVATPKIKEQDLVSRSRE

AITTKRDQVQITQEK KRKEVETTALSTIAVATAKAKEQETVLRSREAMATRQEHIQVTHGQ VGVGKKAEAVATVVAAVDQARVREPREPTHVEESHSQ

QTTLEYGYKEHISTTKVPEQPRRPASEPHVVPQAVKPAVIQAPSETHIKTTDQMGMHISSQ VKKTTDISTERLVHVDKRPRTASPHFTVSKISVPKTEH

GYE ASIAGSAIATLQKELSATSSTQKITKSVKAPTVKPGETRVRAEPTPSPQFPFADMPPPDTYKSQAGIEVKKEVGVSISGSTVREEHFEVLRGREAK

 VTETARVPAPAEVPVTPPTLVS GLKNVTVIEGESVTLECHISGYPSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGT

VSTSCYLAVQV VSEEFDKETTLTEKFATEEKR RFVESRDVVMTDTSITEEQAGPGEPAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSGV

PLTTGYR RYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEA ADYEALVKTQQEMLYQTQMSTFIQEPKVGEIAPGFAYSEYEK

EYEKEQALIRKKMAKDTVMVRTFVEDQ EFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAIESGFDIRIKNYRILEGMGVTFHCKMS

GYPLPK IAWYKDGKRIRHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPFSAPTYMPTPEAVSRIR RSVSPRSLSR

SPIRMSPAMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPASFKCLEGQTARFDLKVVGRPMPETFWFHNG GQQIVNDYTHKVV

IKEDGTQSLIIVPASPSDSGEWTVVAQNRAGKSTISVTLTVEA AVEHQIKPAFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRI

R RIEGTRGEAALKIDSIISQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQK

PFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSATLIVKDEKSLVE

ESQLPDGKKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDC

KSYDTGEVKVTAENPEGVTEHKVKLEIQQREDFRSVLRRAPEPKPEFHVHEPGKLQFEVQKVDRPVDTSETKEVVKLKRAERITHEKVSEESEELRSKFK

RRTEEGYYEAITAVELKSRKKDESYEELLKKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPERIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVV

GKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQA AKQLITFTQELQDVVAKEKDTMATFECETSE

PFIKVKWYKDGIEVHAGDKYRMHSDRKVHFLSVLTIDTSDAEDYSCVLVEDENIKTTAKLIVEG GAVVEFVKELQDIEVPESYSGELECIISPENIEGK

WYHNDVELKSNGKYSITSRRGRQNLTVKDVTKEDQGEYSFVVDGKKTTCKLKMKP PRPIAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWMKDGQEVQ

HSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGNVSVYS SVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQSI

VKGTKQRLVINRTHASDEGPYKLMVGRVETSCNLSVEK KIKIIRGLRDLTCTETQNVVFEVELSHSGIDVVWNFKGKEIKPSSKYKIEAHGKIYKLTVL

NMMKDDEGEYAFYAGENTTSGKLTVAG GGAISTPLTDQTVAESQEAVFECEVANPESEGEWLKDGKHLALSNNFRGESDGHKRRLVIAAAKLDDAGEYT

YKVATSKTSAKLKVEA AVKIKKTLRNLTVTETQDAVFSVELTHPDVKGVQWIKNGVVLDSNDKYEISVKGTLYSLKIKNCAMADESVYGFKLGRLGASA

RLHVET TVKIIKKPKDVTALENATVTFEVSVSHDTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQSISPSDAGEYTAMVGQLECKAKLFVET TLHI

TKTMKSIEVPETKAASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTP PIMITSMLKDINAEE

KDTITFEVTVNYEGISYKWLKNGVEIKSTDRCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEA ARHIEFRKHIKDIKVLEKKRAMFECE

VSEPDITVQWMKDGQELQIADR RIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNMSTANLFVEGRDVRIRSIKKEVQ VIEKQRAVVEFEVNEDDVDA

HWYKDGIEINFQVQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSVTLYVNA APEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKE

EQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEV VPEVVSPDQEMPVYPPAIVTPLQDTVTSEGRPARFQCQVSGTD 

DLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYAFVANNAVGQVSSTATLRLEA APESILHERIGQQIEMEMKE EIASLLSAEEDFQT

YSSDLRLPNANETLELLSEPPARSTQFDSRQEGAAPVFIREISDVEISVEDVAKLSVTVTGCPKPKIQWFFNGMLLTPSADYKFVFDGDTHSLIILFTRF

QDEGEYTCLASNEYGKAVCSAHLRISPRGERSTEMESGEKKALEKPKGPCPPYFFKELKPVHCGPGIPAVFEYSVHGEPAPTVLWFKEDMPLYTSVCYTI

IHSPDGSGTFIVNDPQRGDSGLYLCKAQNLWGESTCAAELLVLPEDTDVPDASCKEESTLGVPGDFLETSARGPLVQGVDSRQEITAFAEGTISKAALIA

EETLQLSYERSVDDSEVGTGVTIGAQKLPPVVLSTPQGTGELPSIDGAVHTQPGRGPPPTLNLQAVQAQTTLPKEATLQFEEPEGVFPGASSAAQVSPVT

IKPLITLTAEPKGNYPQSSTAAPDHALLSSVAAETLQLGEKKIPEVDKAQRALLLSQSLAEGCVESLEVPDVAVSNMRSEPQVPFQHTCTEGKILMASAD

TLKSTGQDVALRTEEGKSLSFPLALEEKQVLLKEEQSEVVAVPTSQTSKSEKEPEAIKGVKEVREQELLSKETLFPSMPEEQRLHLKTQVRRALQAAVAR

EQANLFSEWLRNIDKVEVTAVNFTQEPKRILCTYLITSVSSLTEELTVTIEDIDPQMANLETGLKDALCSIVCEERNILMAEDPRIHEEDKIDVQGGRDH

LSDAQKVETVIEAEADSKYLVSKEEVSWSKVESQLKDGDTNEVPQAETLKLAEESGTQKTSTEMSQEEAEGTLADLCPAVLKHLVDTISEEGDTVHLTSS

ISNAKEVHWYFKGNLVPSDGKFKCLKEQNAYTLVIEAVKTEDEGEYVCEASNDSGKAKTSAKLTVGERA AAPVIKRRIEPLEVALGHLAKFTCEIQGAP

NVRFQWFKAGREIYESDKCSIRSSNYVSSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTV - UNI36362 - VPTAEKKVRKLLPEPKPQPKEE

VVLKSV - UNI36362 - VLRKKPEEEEPKVEPKKVEKAKKPEE EPQPPPKAVEVEAPPEPTPKERKVPEPAKV - UNI17655 - VPEIKPAIP

LPGPEPKPKPEPE - UNI17655 - EVKTMKAPPIEPAPTPIAAPVTAPVVGKKAE EAKPKDEAAKPKGPIKG GVAKKTPSPIEAERKKLRPGSGG

EKPPDEAPFTYQLKAVPLKFVKEIKDIVLTEAESVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNK

EKTSTAKLIVEE ELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECS

SCVKVVE EIIREWLVKPIRDQHVKPKGTAVFTCDIAKDTPNIKWFKGYDEIPLEPNDKTEILKEGNHLFLKVKNAMPEDIDEYAVEIEGKRYPAKLTLG

E EREVELLKPIEDVTIYEKESASFDAEISEEDIPGEWKLKGELLRPSP TCEIKAEGGKRFLTLHKVKLDQAGEVLYQACNAITTAILTVKE EIELDF

AVPLKDVTVPEKRQARFECVLTREANVIWSKGPDIIKASDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSAQLFVTG GIRLKFISPLEDQTVK

EGQTATFVCELSHEKMHVVWFKNDVKLHTTRTVLMSSEGKTYKLEIRETTLDDISQIKAQVKNLSSTANLKVLE EADPYFTVKLHDKTGVEKDEIILKC

EVSKDVPVKWFKDGEEIVPSPKHSVKTDGLRRILKIKKAELKDKGEYVCDCGTDTTKANVTVEA ARLIKVEKPLYGVEVFVGETARFEIELSEPDVHGQ

WKLKGEPLTASP DCEIIEDGKKHVLVLYNCQLDMTGEISFQAANAKSAANLKVKE ELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEI

TGDDRFELIKDGTRHSLVIKSAAFEDEAKYMFEAEDKRTSGKLIIEG - UNI35827 - GIRLKFLTPLKDVTAKERENAVFTVELSHDNIPVSWFKN

DQRLHTSKRVSMHDEGKTHSITFKDLSIDDTSQIRVEAMGISSEAKLTVLE - UNI35827 - - UNI35899 - EGDPYFTGKLQDYTGVEKDEVI

LQCEISKADAPVKWFKDGKEIKPSKNVVIKADGKKRMLILKKALKSDIGQYTCDCGTDQTSGKLDIED - UNI32138 - - UNI35827 - - UNI

35899 - DREIKLVRPLYSVEVMETETARFETEISEDDIHANWKLKGEALLQTP - UNI32138 - - UNI33036 - - UNI35899 - ECEIK

EEGKIHVLILHNCRLDQTGGVDFQAANVKSSAHLRVKP - UNI32138 - - UNI32541 - - UNI33036 - PRVIGLLRPLKDVTVTAGETAT

FDCELSYEDIPVEWYLKGKKLEPNDK - UNI14991 - - UNI16643 - - UNI32541 - - UNI33036 - VVTRSEGRVHTLTLRDVKLED

AGEVQLTAKDFKTQANLFVKE - UNI14991 - - UNI16643 - - UNI32541 - EPPVEFTKPLEDQTVEEEATAVLECEVSRENAKVKWFKN

GTEILKSKKYEIVADGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVP - UNI14991 - PPHVEFLRPLTDLQVKEKETARFECEISKENEK V

QWFKDGAEIKKGKKYDIISKGAVRILVINKCLLNDEAEYSCEVRTARTSGMLTVLE EEEAVFTKNLANLEVSEGDTIKLVCEVSKPGAEVIWYKGDEEI

IETGRFEILTDGRKRILIIQNAQLEDAGSYNCRLPSSRTDSKVKVHE ELAAEFISKPQNLEILEGEKAEFVCTISKESFEVQWKRDDQTLESGDKYDII

ADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIE EKLRIIVPLKDTKVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRI

RDARLDDQANFNVSLTNHRGENVKSAANLIVEE EEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVAFDNRISYRIDKYKHSLIIKDCG

FPDEGEYVVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKK KYKFEKDGSIHRLIIKDCRLEDECEYAC

GVEDRKSRARLFVEE EIPVEIIRPPQDILEAPGADVIFLAELNKDKVEVQWLRNNMIVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARA

KLELAA AAPKIKTADQDLVVDAGQPLTMVVPYDAYPKAEAEWFKENEPLSTKTVDTTAEQTSFRISEAKKDDKGRYKIVLQNKHGKAEGFINLQVID D

VPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLVTDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDSPVEARSKY

D DVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVA

DPIE ERPSPPVNLNASEQTQSSVQLTWEPPLKDGGSPILGYIIERREEGKDNWIRCNMKPVPELTYK VTGLQKGNKYLYRVSAENAAGVSDPSEILGP

LTADDAFV VEPTMDLSAFKDGLEVIVPNPIKILVPSTGYPRPKATWTFGDQVLEEGDRVKMKTISAYAELVISPSERTDKGIYTLTLENPVKSISGEIN

VNVIA APPSAPKELKFSDITKDSVHLTWEPPDDDGGSPLTGYVVEKRDMSRKTWTK VMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYTDEP

VNMSAPAT TVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVEKCPRGSDKWVACGEPVPDTK KMEVTGLEEGKWYAYRVKALNRQGASKPSK

PTEEIQAVDTQE EAPEIFLDVKLLAGITVKAGTKIELPATVTGKPEPKITWTKADTLLKPDQRITIENVPKKSTVTITDSKRSDTGTYIIEAVNVCGRA

TAVVEVNVLD DKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERKATDSDVWHKLSSTVKDTNFKATKLTPNKEYIFRVAAENMYGVGEPVQ

AAPIIAKYQFD DPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYR RVKGLTNKKKYRFRVLAENLAGPG

KPSRSTEPILIKDPID DPPWPPGKPTVKDIGKTSLVLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTTEHLLTGLMEGQEYSFRVRAVNKAG

ESEPSEPSDPVLCREKLY YPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENA

IGQSDYTEIGDSVLAKDTFT TTPGPPYALTVVDVTKRHVDLKWEPPKNDGGRPIQR RYIIEKKEKLGTRWVKAGKTSGPDCNFRVTDVIEGTEVQFQV

RAENEAGVGHPSEPTEILSIEDPTS SPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGIVPDKEY

VLRVRAVNAVGVSEPSEISENVVAKDPDC CKPTIDLETHDIVVIEGEKLNIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVHADA

GVYTITLENKLGSATASINVKVIG GLPGPCKDIKASDITKSSCKLTWEPPEFDGGSPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFR

VKAVNKIGGGEYIELKNPVIAQDPKQ QPPDPPVDVEVHNPTAKAMTITWKPPLYDGGSKIMGYIIEKITKGEDRWKRCNEHLVPVLTYTAKGLEEGKEY

QFRVRAENAAGIGEPSRATPPTKAVDPID DAPKVILRTSLEVKRGDEIALDATISGSPYPTITWIKDENVIVPEEIKKRAAPPVRRKKGEAEEEEPFSL

PLTERLSINNSKQGESQLRIRDSLRPDHGQYMIKVENDHGVAKAPCSVSVLD DTPGPPINFVFEDIRKDSVLCKWEPPLDDGGSEIINYTLEKKDKTKP

DSDWIVITSTLRNCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLLAKDPFE EPPDAPDKPIVEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVN

STHWSRVNKTLLSSLKTKVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTARDPIS SPPGPPVPRVADTSSTTIELEWEPPAFNGGGEIMGYFVDKQL

VGTNEWSRCTEKMIKVRQFTVKEIREGADYKLRVSAVNAAGEGPPGETEPVTVAEPQE EPPTVELDVSVKGGIQIMAGKTLRIPAEVTGRPVPTKVWTI

EEGELDKERVIIENVGTKSELIIKNALRKDHGRYVITATNSCGSKFAAVRVEVFD DVPGPVLDLKPVVTNRKMCLLNWSDPADDGGSDITGFIIERKDA

KMHTWRQPIETERSKCDITGLIEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLG GPPTSPERLTYTERTKSTITLDWKEPRSDGGSPIQGYIIEKRRH

DKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNDVGESEPSLPLNVVIQDDEV VPPTIKLRLAVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSK

NEKVIDKPTDTLNITKEEVSRSEAKTELSIPKAAREDKGTYTITASNRLGSVFRNVHVEVYD DRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHY

IIDKRDASRKKSEWEEVTNTAVERRYG IWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLERTKGSMLVSWTPPLDNGGSPIT

GYWLEKREEGGTYWSRVSRAPITKVGLKGVEFNVPRLIEGVKYQFRAMAINAAGIGPPSEPSDPAVAGDPIY YPPGPPSCPEVKDKTKSSISLAWKPPA

KDGGSPIKGYIVEMQEEGTTDWKPVNEPDKLLTACECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQE EVPEVFIDIGAQDCLVCKAGSQ

VKIPAVIKGRPTPKSSWEFDGKAKKAMK DGVHDIPEDAQ LETAENSSVIIIPECTRAHSGKYSITAKNKAGQKTANCRVKVMD DAPGPPKDLKVSDI

TRGSCRLSWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNCGSTTFVVPDLISEQQYFFRVRAENRFGIGPPAETIQRTTARDPIY YPPDPPIKLKIG

LITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGKKKEAWRQCNRRDVEELEFTVEDLIEGGEYEFRVKAVNEAGVSKPSATVGPVIVKDQTC CPPA

IELKEFMEVEEGTDVNIVAKIKGVPFPTLTWFKAPPKKPDSKEPVVYDTHVNKQVVDDTCTLVIPQSRRSDTGLYSITAVNNLGTASKEMRLNVLG GRP

GPPVGPIKFESISADQMTLSWLPPKDDGGSKITNYVIEKREANRKTWVRVSSEPKECMYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFS S

VPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPVTA

RDPVA APPGPPFPKVTDWTKSSVDLEWSPPLKDGGSKITGYIVEYKEEGKEEWEK GKDKEVRGTKLVVTGLKEGAFYKFRVRAVNVAGVGEPGEVTDV

IEMKDRIV VSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWSMNERALPQEAAIETTAISSSMVIKNCQRSHQGVYSLLAKNEGGERKKTIIV

DVLD DVPGPVGIPFLSDNLTNDSCKLTWFSPEDDGGSPITNYVIQKREADRRAWTPVTYTVTRQNATVQGLIQGKSYFFRIAAENSIGMGPFVETPNAL

VIRDPIT TVPERPEDLEVKEVTKNTVSLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCT

KPITCKDELA APPTLDLDFRDKLTVRVGESFALTGRYSGKPKPKIDWFKDEADVLEDDRTHIKTTPTTLALEKTKAKRSDSGKYCVVVENSTGSRKGFC

QVNVVD DRPGPPVGPVIFDEVTKEYMVISWKPPLDDGGSEITNYIIEKKELGKDIWMPVTSASAKTTCKVPKLLEGKDYIFRIHAENLYGISDPLVSDS

MKAKDRFR RVPDAPEQPVVTEVTKDSALVTWNKPNDGGKPITNYILEKRETMSKRWVRVTKEPIHPYTKYRVPDLLEGCQYEFRVSAENEIGIGDPSPP

SKPVFARDPIA AKPSPPINPEAIDTTCNSVELTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQSYKFRVLAVNEAGES

DPAHVPEPVLVKDRLE EPPELILDANMAREQHIRVGDTLRLSAIIKGVPFPKVTWKKEDREAPTKAQIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAG

TKTVSVKVLVLD DKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVVTNYVVERKDVATAQWSPLSTTSKKKSHMAKHLTEGNQYLFRVAAENQYGRGPF

VETPKPIKALDPLH HPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGDKDWIKFKTVKNLDCVVTGLQQGKTYRFRVKAENIIGLGL

PDTTIPIECQEKLV VPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGTEIKTDDHYTVETDSFSSVLTIKNCLRKDTGEYQLTVSNAAG

TKTVAVHLTVLDVPGPPTGPINILDVTPEYMTISWQPPKDDGGSPVINYIVEKQDTRKGTWGVVSAGSSKLKLKVPHLQKGCEYVFRVKAENKMGVGPPL

DSIPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYVERREITGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSNPSP

SSDPIKACRPIKPPGPPINPKLKDKSKESADLVWTKPLSDGGSPILGYVVEYQKPGTAQWDRINKDELIRQCAFRVPGLIEGNEYRFRIRAANIVGEGEP

RELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWSKEGKVLVKDKRVDLIHDLPRVELQIKEAVRADHGKYIISAKNSSGHA

QGSAIVNVLDRPGPCQNLKVSNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLVKANLLANNEYYFRVCAENKVGVGPTIETKT

PILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSADWERVHKGSIKETHYMVDKCVENQIYEFRVQTKNEGGESDWVRTE

EVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTSAESSKFSLTKAKRSDGGKYVITATNPAGSFVAYAT

VNVLDKPGPVRNLKITDVSSDRCTIRWDPPEDDGGCEIQNYILEKCESKRMVWSTYSANVLTPSATVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAK

TKYDRPGRPDPPEVTKVSKEEMTVVWNAPEYDGGKSITGYYLEKKEKHAVRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPSLPSRPVVA

KDPIE EPPGPPTNFKVVDTTKSSITLAWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLIRMEFTVTSLDENQEYEFRVCAQNQVGIGRP

AELKEAIKPKEILE EPPEIDLDASMRKLVVVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGE

KAVFVNVKVLD DTPGPVADLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREAERKTWSTVTPEVKKTSFNVTNLVPGNEYFFRVTAVNEYGPGVPT

DIPKPVLASDPLS SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYIISYREEDQPADRWTEYSVVKDLSLIVTGLKEGKKYKFRVAARNAVGVS

MPREAEGVYEAKEQLL LPPKILMPEQITIKAGKKLRVEAHVYGKPNPICKWKKGDDEVVTSSHLAIHKADGSSVLIIKDVTRKDSGYYSLTAENSSGSD

TQKIKVTVMD DAPGPPQPPFDISEIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPL

TSPKMLAKFPFD DVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKERNSLLWVKANDTIVRSTEYPCAGLVEGLEYSFRIYALNKAGSSP

PSKPTEYVTARMPVD DPPGKPEVVDVTKNSASLIWARPKHDGGSRIIGYFVEACKLPGDKWVRCNTTPHQIPQEEYTATGLEENAQYQFRAIAKTAVNI

SQPSEPSDPVTILAENV VPPRIELSVEMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDTTPIKQAEGIKMAMKRNLCTLELFSVNRKDSGDYTITAEN

SSGSKSATIKLKVLD DKPGPPASVKINKMYADRAMLSWEPPLEDGGSEITNYIIDKRETSRPNWAQVSATVPITSCTVEKLIEGHEYQFRICAENKYGV

GDPILTEPAIAKNPYD DPPGRCDPPVISNITKDHMTVSWKAPADDGGSPITGYLVEKRETQAVNWTKVNRKPVIERTLKATGLQEGTEYEFRVTAINKA

GPGKPSDASKAVYAQDPLY YPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDHWVRCNLPEKLQKTRFEVTGLMENTEYQFRVYA

VNKIGYSDPSDVPDKHCPKDILI IPPEGELDAELRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCENVNKYDAGKY

ILTLENSCGKKEYTIVVKVLD DTPGPPVNVTVKEVSKDSAYVTWDPPIIDGGSPIINYVVEKRDAERKSWSTVTTECSKTSFRVSNLEEGKSYFFRVFA

ENEYGIGDPGETRDAVKASE ETPGPVVDLKALAITKSSCTIGWKKPRSDGGSRITGYVVDFLTEENKWQRVMKSLSLQYSTKDLKEGKEYTFRVSAENE

NGEGTPSEIVVVAKDDVV VAPDLDLKDLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESTAVNTTLVVYDCQKSDAGKYTITLK

NVAGTKEGTLSIKVVGKPGIPTGPIKFDEVTAEAMTLKWGPPKDDGGSEITNYVLEKRDSVNNKWVTCASAVQKTTFRVTRLHEGIEYTFRVSAENKYGV

GEGLKSEPIVAKHPFD DVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITG GYHIEFKERNSLLWKRANKTPIRMKDFKVTGLTEGLEYEFRVMAIN

LAGVGKPSLPSEPVVALDPID DPPGKPEVISVTRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPDCAFTVTDLVEGGKYEFRIRAKN

TAGAISAPSESTGTIICKDEYE EAPTIVLDPTIKDGLTVKAGDSIVLSAISILGKPLPKSSWSRAGKDIRPSDIAQITSTPTSSMLTVKYATRKDAGEY

TITATNPFGTKEEHVKVSVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKAYVLEKRETSRLLWTVVSEDIQACRHVVTKLIQGNEYLFRVSAVN

HYGKGEPVQSEPVKMVDRFG GPPGPPGKPEISNVTKNTATVSWKRPTDDGGSEITGYHVERREKKGLRWVRATKTPVSDLRCKVTGLQEGNTYEFRVSA

ENRAGIGPPSDASNPVLMKDVAY YPPGPPSNAHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDDAWIKDTTGTALRITQFVVPDLQTKEKYNF

RISAINDAGVGEPAVIPNVEIVEKEVAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKHRANIENTESFTLLIIPECNRYDTGKFV

MTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTVTTKCHKCTYKVTGLTEGCEYFFRVMAENE

YGVGEPTETTEPVRASEAPLPPDSLNIMDITKNTVSLAWPKPRHDGGSKITGYVIEAQRKGSDQWTHISTVKGLECVVRNLTEGEEYTFQVMAVNSAGRS

APRESRPVIVKEQTMLPELDLRGIYQKLVIARAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNVENTATSTILNINECVRSDSGPYPLTAKNTVGE

VGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWEPPENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGVEYQFRVRAQNRYGVGPGIT

SASVVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQTVSKALVPGNIFKSTGLTDGIAYEFRVIAENMAGKSKPSK

PSEPMFALDPIDPPGKPVPLNITRHTVALKWAKPEYTGGFKITSYVVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEP

SDAITCRDDLEAPRIMVDVRFKDTITLKAGEAFKLEADVSGRPPPTMEWTKDGKELEGTGKLEIKIADFSTHLINKDSSRTDSGAYILTATNPGGFAKHI

FNVKVLDRPGPPEGPLAVSDVTSEKCVLSWLPPLDDGGAKIDHYIVQKRETSRLAWTNVATEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLESEPV

LAVDPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNKKALTDLRFKVSGLTEGHEYEFRIMAENAAGISAPSATSPF

YKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQVVTPPAGLKATSYTITSLIENQEYKIRIYAMNSEGLGEPALVP

GTPKAEERMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWAREHGESLDKASIESTSSYTLLVVGNVNRFDSGKYILTVENSSGSKSAFVNV

RVLDTPGPPQNLKIKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKAS

ERPLPPGKITLTDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDRWATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVI

PPAFKLLFNTFTVLAGEDLKIDVPFIGRPPPAVTWHKDDIPLKQTTRVNAESTENNSLLTIKEACREDVGHYTVKLTNSAGEATETLNVIVLDKPGPPTG

PVKMDEVTADSVTLSWEPPKYDGGSSINNYIVEKRDTSTTAWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPVVAQYPFKVPGPPGT

PFVTLASKDSMEVQWHEPVSDGGSKVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGIEYEFRVSAENIVGIGKPSKPSECYAAHDPCDPPGRPE

AIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPDGRWMKASFTNIIDTQFEVTGLLEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVEPPRISMD

PKYRDTVVVQAGESFKIDADIYGKPIPTTQWVKGDQELSSTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGEKSVTINVKVLDRPGPPEGPVAI

SGVTAEKCTLAWKPPLQDGGSDITNYIVERRETSRLVWTLVDANVQTLSCKVLKLLEGNEYIFRIMAVNKYGVGEPLESESLIAKNPFVVPDAPKAPEVT

AVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKV

MDVTRSSVFLSWTKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNLEVEKLLEKHEYNFRICAINKAGVGEHADVPGPVMVEEKLEAPDIDLDL

ELRKVINIRAGGSLRLFVPIKGRPTPEVKWGKVDGDIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEIT

KDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPARTADPIKVAEVPQPPGKITVDDVTRNS

VSLSWTKPEHDGGSKIIQYIVEMQAKNTDKWSECARVKSLDAVITNLTQGEEYLFRVIAVNEKGRSDPRSLAVPIIAKDLVIEPDVRPAFSSYSVQVGQD

LKIEVPISGRPKPSISWTKDGMPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVSNVVGQKTAAIEIITLDKPDPPKGPVKFDEISAESITLSWNP

PLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESEPVVAQYPYKEPGPPGTPFVTAISKESMVVQWHEP

INNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKALNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEAIIVKRNEITLQWTKPVY

DGGSMITGYIVEKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLE

ADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTAEKCTLAWSPPLQD

GGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNKYIFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDG

GSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHVVDTTKNSITLAWSKPIYD

GGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEIAKLIEHQEYKIRVCALNKVGLGEAASVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHI

PFKGRPTPEITWSKEEGEFTDKVQIEKGINFTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSVLLVWEPPIIDGGAK

VKNYVIDKRESTRKAYANVSSKCNKTSFRVENLTEGAIYYFRVMAENEFGVGVPTETSDAVKASEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRILG

YVVEMQPKGTEKWSVVAESKVCNAVVSGLSSGQEYQFRVKAYNEKGKSDPRVLGIPVIAKDLTIQPSFKLPFNTYSVQAGEDLKIEIPVIGRPRPKISWV

KDGEPLKQTTRVNVEETATSTILHIKESSKDDFGKYSVTATNSAGTATENLSVIVLEKPGPPVGPVKFDEVSADFVVISWEPPAYTGGCQISNYIVEKRD

TTTTNWQMVSATVARTTIKISKLKTGTEYQFRIFAENRYGKSTPLDSKPVVVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGSKVTGYHLEQKEK

NSILWVKLNKIPIQDTKFKTTGLDEGLEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIVITRNSVTLKWKKPVYDGGSKITGYIVEKKDLPD

GRWMKASFTNVVETEFTVTGLVEDQRYEFRVIARNAADNFSEPSESSGAITARDEIDAPNASLDPKYRDVIIVHAGETFVLEADIRGKPIPDIIWSKDGN

ELEETAARMEIKSTLQKTTLIVKDCIRTDGGQYTLKLSNVGGTKTIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGASISHYIIEKRETSR

LSWTQVSNEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEALESEPVIACNPYKRPGPPSTPEASAITKDSMVLTWTRPVDDGGAEIEGYILEKRDKEGI

RWTKCNKKTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVRGYVIELKKAAA

DEWTTCTPPSGLQGKQFTVTKLKENTEYNFRICAFNTEGVGEPATIPGSVVAQERMEAPEIELDADLRKVVTLRASATLRLFVTIKGRPEPEVKWEKAEG

ILTERAQIEVTSSYTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYA

TITNNCTKNTFKIENLQEGCSYYFRVLASNEYGIGLPAETAEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSACT

QVKTLETTISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIAKDIEIKPSVELPFNTFNVKANDQLKIDIPFKGRPQATVAWKKDGQVLRETTRVNVASS

KTVTTLSIKEASREDVGTYELCVSNTAGSITVPITVIVLDRPGPPGPIRIDEVSCDNVSISWNPPEYDGGCQISNYIVEKRETTSTTWQVVSQAVARTSI

KIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMVVSWQVPVNDGGSQVIGYHLEYKERSSILWSKANKVLIADTQM

KVSGLDEGLMYEYRVYAENIAGIGKCSKACEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPRYDGGAKITGYIVERRELPDGRWLKCNFTNVQETYFEV

TELTEDQRYEFRVFARNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIIVKAGEVLKINADIAGRPLPVISWAKDGVEIEERAKTEIVSTDYTTT

LTVKDCVRRDTGQYVLTLKNVAGTRTMAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSRLAWTICEAELRTTSCKVTK

LLKGNEYIFRVTGVNKYGVGEPLESMAVKALDPFTTPSPPTSLEITSVTKDSMTLCWSRPETDGGSDISGYIIERREKNSLRWMRVNKKPVYDLRVKSTG

LREGCEYEYRVFAENAAGLSLPSETSPLVRAEDPVFLPSPPSKPKIVDSGKTTITIGWVKPLFDGGAPITGYTVEYKKSEETDWKVAIQSFRGTEYTMSG

LTTGDEYVFRVRSLNKMGASDPSDSSDPQVAKEREEEPVFDVDSEMRKTLIVKAGSSFTMTVPFRGRPIPNVSWSKPDTDLRTRAYIDSTDSRTLLTIEN

ANRNDSGKYTLTIQNVLSAASMTFVVKVLDSPGPPANITVREVTKETAMLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAI

YYFRVSGENEFGVGVPAETKEGVKITE EKPSPPEKLGVTSVSKDSVSLSWLKPEHDGGSRIIHYVVEALEKGQKTWVKCAVVKTTHHVVSGLRESHEYF

FRVFAENQAGLSDPRELLLPVLIKDQLE EPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTT

DAGRYEITAANSSGTTKTFINIIVLDRPGPPTGPVAISDITEESVTLKWEPPKYDGGSHVTNYIVLKRETSTAVWSEVSATVARTMIKVMKLTTGEEYQF

RIKAENRFGISDHIDSVCVVVKLPYT TTPGPPSTPWVSNVTRESITVGWHEPVSNGGSAVTGYHLEMKDRNSILWQKANKMIIRTTHFKVTTISAGLIY

EFRVYAENAAGIGKPSHPSEPVLAIDACE EPPRNVRITDISKNSVNLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVIETQFTVSGLTQNSQY

EFRVFARNAVGSVSNPSEVVGPITCIDSYG GGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWYKDDKELQTNALVCVENSTDLASILIKDAN

RLNSGSYELKLRNAMGSASATIRVQILD DKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVAENLEECIVTTTKIIKGN

EYVFRVRAVNKYGIGEPLESEPVVAKNAFV VTPGPPSIPEVTKITKNSMTVVWDRPTVDGGSEINGYFLERRDKKSLAWLKVLKETIRDTRQKVTGLTE

NSDYQYRVCAVNAAGVGPFSEPSDFYKAADPID DPPGPPAKIRIADSTKSSITLGWSKPVYDGGSDVTGYVVEMKQGDEEEWTIVSTRGEVRTTEYVVS

NLKPGVNYYFQVSAVNCAGQGEPITMTEPAQAKDVLE EEPEIDLDVALRTSVIAKAGEDVQLLIPFKGRPPPTVTWRKDEKNLGSDTRYSIQNTDSSSL

LVIPQVTRNDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQKLQVKHVSLGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSGTSFKVTD

LSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVVLSWTKPDFDGGSIITDYLVERKGKGEQAWSHAGISKTCEIEIGQLKEQ

SVLEFRVSARNEKGQSDPVTIGPLTVKELVITPEVDLSEIPGAQISVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEYVRFSKTENKITLSIKNSKK

EHGGKYTVILDNAVCRNSFPITIITLGPPSKPKGPIRFDEIKADSAIMSWDIPEDDGGGEITCYSIEKREASQTNWKMVCSSVARTTFKVSNLVKDSEYQ

FRVRAENRYGVSEPLASNIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQRVNTSPISGREYRATGLIEGLDYQ

FRVYAENSAGLSSPSDPSKFTLAVSPVD DPPGTPDYIDVTRETITLKWNPPLRDGGSKIVAYSIEKRQGSDRWVRCNFTDVSECQYTVTGLSPGDRYEF

RIIARNAVGTISPPSQSSGLIMTRDENV VPPTVEFGPEYFDGLVIKSGDSLRIKALVQGRPVPRVTWFKDGVEIERRMNMEITDVLGSTSLFVRDATRD

HRGVYTVEAKNVSGSTKAEVTVKVQD DTPGKVVGPIRFTNITGEKMTLWWEAPLNDGCAPVTHYIIEKRETSRLAWALIEDNCEALSYTAIKLITGNEY

QFRISAVNKFGVGRPLESDPVVAQIQYT TIPDAPGVPEPSNVTGNSITLTWTRPESDGGSEIQHYILERREKKSTRWVKVISKRPISETRFKVTGLVEG

NEYEFHVMAENAAGIGPASGISRLIKCREPVNPPSAPSVVKVTDTSKTTVSLEWARPVFDGGMEIIGYIIEMCKADLGDWHKVNTEPCVKTRYTVTDLQA

GEEYKFRVSAVNGAGKGDSCEVTGTIKAVDRLSAPELDIDANFKQTHIVRAGVSIRLFIAYQGRPTPTAVWSKPDSNLSIRADIHTTDSFSTLTVENCNR

NDAGKYTLTVENNSGKKSITFTVKVLDSPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVIEKREASRRSWQVVSEKCTRQILKVSELTEGVPYYF

RVSAENEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITSYLLEMRQKGSDFWVEAGHTKQLTFTVERLVENTEYEFRVKA

KNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPISGRPAPKVTWKLEEMRLKETDRMSIATTKDRTTLTVKDSMRGDSGRYFL

TLENTAGVKTFTITVVVIGRPGPVTGPIEVSSVSAESCVLSWTEPKDDGGTEITNYIVEKRESGTTAWQLINSSVKRTQIKVTHLTKYKEYCFRVSSENR

FGVSKPLESVPIVAEHPFV VPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKIVGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYAL

NAAGVSKASEASRPIMAQNPVD DPPGRPEVTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRV

LAKNAAGVISKGSESTGPVTCRDEYA APPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKISLQYTGKRATAVIKYCDRSD

SGKYTLTVKNASGTKSVSVMVKVLD DSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECLTASYVVTRLIKNNEYTF

RVRAVNKYGLGVPVESEPIVARNSFT TIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCD

YQFRVTAVNAAGNSEPSEASNFISCREPSY YTPGPPSAPRVVDTTKRSISLAWTKPMYDGGTDIIGYVLEMQEKDTDQWCRVHTNATIRNNEFTVPDLK

MGQKYSFRVAAVNAKGMSDYSETTAEIEPVERLE EIPDLELADDLKKTVIVRAGASLRLMVSVSGRPSPVITWSKKGIDLANRAIIDNTESYSLLIVDK

VNRYDAGKYTIEAENQSGKKSATVLVKVYD DTPGPCPSVSVKEVSRDSVTITWEIPTIDGGAPVNNYIIEKREAAMRAFKTVTTKCSKTLYRISGLVEG

TMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVISLNEGEQ

YLFRVRAQNEKGVSEPREIVTPVTVQDLRV VLPTIDLSTMPQKTIHVPAGRPIELVIPITGRPPPTASWFFAGSKLRESERVTVETHTKVTKLTIRETT

IRDTGEYTLELKNVTGTTSETIKVIILD DKPGPPTGPIKIDEIDATSVTISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRPTFKFTRLTEGN

EYVFRVAATNRFGIGSYLQSEVIECRSSIS SIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLIE

GLEYEHRVTAINARGTGKPSRPSKPTVAMDPIA APPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQREWTKCNTTPTKIREYTLTH

LPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLE EYPDYELDERYQEGVFVRQGGVIRLTIPIKGKPFPVCKWTKEGQDISKRAMIATSETHTELVI

KEADRNDSGTYDLVLENKCGKKTVYIKVKVIGSPNTPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKE

NVEYHFRVSAENQFGISKPLKSEEPVIPKTPLN NPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVT

GLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFD DKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDRQF

TIGGLLEATEYEFRVFAENETGLSRPRRTAMSVKTKLTS SGEAPGVRKEMADVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTH

TLTVMTDEQEDEGVYTCVATNEVGEVESSSKLLLQAAPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSEKITIENTEHYTHLVM

KNVQRKTHAGKYKVQLSNAFGTVDATLDVEIQD DKPDKPTGPIVIEALLKNSVVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIV

NLTENAGYYFRVSAQNTFGISEPLEVASIVIIKSPFE EKPGVPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLERREKKQNKWIAVTTEEIRETVF

SVQNLIEGLEYEFRVKCENLGGESEWSEISEPVTPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGY

HQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEV VPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSF

TSLVFSNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKVTNYIVEKCATTAERWLRVGQARETRYTVI

NLFGKTSYQFRVIAENKFGLSKPSEPSEPTVTKEDKTRAMNYDDEVDETREVTTTKASHSKTKELYEKYMIAEDLGRGEFGIVHRCVETSSKRTFMAKFV

KVKGTDQVLVKKEISILNIARHRNILYLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVRQVCEALEFLHSQNIGHFDIRPENIIYQTR

KNSTIKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQMIENIMNAEYTFDEEAFKEISLEAMDFV

DRLLVKERKSRMTASEALQHPWLKQRIDRVSTKVIRTLKHRRYYHTLIKKDLNMVVSAARISCGGAIRSQRGVSVAKVKVASIEIGPVSGQIMHAIGEEG

GYVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVATMYVKDITKFDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTKKVKRRTDAM

RLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDEKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVT

LHPPPTETTLRPMFKRLLANAECHEGQSVCFEIRVSGIPAPTLKWEKDGQPLSLGPHIEIVHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHL

QVERLRYVKQEFQSKEERERHVQKQIDKTLRMAEILSGTETVPLTPVAQEALREAAILYKPAVSTKTVKGEYRLQTEEKKEERKLRMPYEVPEPRRFKQA

TVEEDQRIKQFVPMSDMKWYKKIRDQYEMPGKLDRVVQKRPKRIRLSRWEQFYVMPLPRITDQYRPKWRIPKLTQDDLEMVRPARRRTPSPDYDLYYYRR

RRRSLGDMSDEELLLPIDDYLAMKRTEEERLRLEEELELGFSASPPSRSPPRFELSSLRYSSPPAHVKVEDRRRDFRYSTYHVPTKEETSTSYAELRERH

AQASYRQPKLRQRIMAEKEEEELLRPVTTTQRLSEYKSELDYMSKEEKSKKKSKRQRQVTEITEIEEEYEISRRAQRESSSSVSRLLRRRRSLSPTYIEL

MRPVSELIRSHPRPAEEYEDDAERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKTSERKYEVLSQQPFTLDHAPRITLRMRS

HRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCQTEDGGTYRAVCTNYKGEASDYATLDVTGGAYTTYASQRRDEEVPK

SVFPELTKTEAYAVSSFKRTSELEAASSVREVKSQMTETRESLSTYEHYASAEMKSATSEEKSLEEKATVRKIKTTLAARILTKPRSITVHEGESARFSC

DTDGEPVPTVTWLREGQVVSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSDGKQEAQFTLTVQKARVIEKAVTSPPRVKSPEPRVKSPETVKSP

KRVKSPEPVTSHPKAVSPTETKPTEKGQHLPVSAPPKITQSLKAEASKDIAKLTCAVESSALCAKEVAWYKDGKKLKENGHFQFHYSADGTYELKIHNLS

ESDCGEYVCEVSGEGGTSKTSFQFTGQSFKSIHEQVSSISETTKSVQKTAE ESPEAKKQEPIAPESISSKPVIVTGLRDTTVSSDSVAKFTIKVTGEPQ

PTITWTKDGK AIAQGSKYKLSSNKEEFILEILKTETSDGGLYACTVTNSAGSVSSSCKLTIKA AVKDTEAQKVSTQKTSEVTSQKKASAQEEISQKAL

TSEEIKMSEVKSHETLAIKEEASKVLIAEEVKRSAAASLEKSIVHEEVTKTSQASEEVKTHAEIKTLSTQMNITKGQRATLKANIAGATDVKWVLNGTEL

PNSEEYRYGVSGSDQTLTIKQASHREEGILSCIGKTSQGVVKCQFDLTLSEELSDAPSFITQPRSQNINEGQNVLFSCEVSGEPSPEIEWFKNNLP ISI

SSNISVSRSRNVYTLEIRNAAVSDSGKYTIKAKNFHGQCSATASLTVLP PLVEEPPREVVLKTSSDVSLHGSVSSQSVQMSASKQEASFSSFSSSSASS

MTEMKFASMSAQSMSSMQESFVEMSSSSFMGKSSMTQLESSTSRMLKAGGRG GIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEITWSCGGRKIQNQ

EQQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNINIRSM
Transcript ENSMUST00000099981
Sequence
TTAGAGGCTCACCGATTCATGTCGGAGATGGTTGGAAAAACCAACTCTACGTAGGACGTCGTTTCAGAAGCAAACTTGGGCTTGGTCCCACCCTTTTTGG

GCACTCCTGAGAAATCAG AGTGCCTGAAAAGATGACTACTCAAGCACCGATGTTTACGCAGCCGTTACAAAGCGTTGTGGTACTGGAGGGTAGTACCGC

AACCTTTGAGGCTCACGTTAGTG GTTCCCCAGTTCCTGAGGTGAGCTGGTTTCGGGATGGCCAGGTGATTTCAACTTCCACTCTGCCCGGCGTGCAGAT

CTCCTTTAGCGATGGCCGCGCTAGATTGATGATCCCCGCCGTGACTAAAGCCAACAGTGGACGATACTCCCTGAGAGCCACCAATGGATCTGGACAAGCG

ACTAGTACTGCTGAGCTTCTTGTGACAG CCGAGACAGCACCACCCAACTTCAGTCAGCGGCTGCAGAGCATGACTGTGAGACAAGGAAGCCAAGTGAGA

CTCCAAGTGAGAGTGACTGGAATCCCTACACCTGTGGTGAAGTTCTACCGGGATGGAGCCGAAATCCAGAGCTCCCTTGATTTCCAAATTTCTCAAGAAG

GAGACCTCTACAGCTTACTGATTGCCGAAGCATACCCTGAAGACTCCGGGACCTATTCTGTAAATGCCACCAACAGCGTTGGAAGAGCTACTTCCACTGC

AGAATTGGTGGTTCAAG GTGAAGAAGTAGTACCTGCTAAAAAGACAAAGACGATCGTGTCGACTGCTCAGATTTCAGAAACAAGACAAACCCGGATTGA

AAAA AAGATTGAAGCCCACTTTGATGCCAGATCAATCGCAACAGTTGAGATGGTCATAGATGGTGCCACTGGACAGCTGCCACATAAAACACCTCCCAG

GATACCTCCTAAGCCCAAGTCCAGGTCTCCGACACCACCTTCCATTGCTGCCAAAGCACAGCTGGCCAGACAACAGTCCCCATCACCAATAAGACACTCT

CCCTCCCCAGTCAGACACGTGCGGGCACCAACCCCATCTCCAGTCAG GTCCGTGTCTCCAGCGGGGAGGATCTCCACTTCCCCGATCAGATCCGTGAAG

TCGCCACTGCTCATTCGCAAGACTCAGACCACCACCATGGCCACAGGCCCCGAGGTGCCTCCCCCTTGGAAGCAAGAGGGCTACGTGGCCTCCTCGACTG

AGGCTGAGATGAGAGAGACGACAATGACAAGCTCTACCCAGATCAGAAGAGAAGAGAGGTGGGAAGGGAGATACGGGGTCCAGGAGCAAGTGACCATCAG

TGGAGCCGCGGCTGCTGCGGCCAGTGCGTCGGTCAGCTCGTCATTCACGGCAGGAGCCATCACCACTGGGACTAAGGAG GTGAAACAAGAGACAGACAA

GAGTGCAGCTGTTGCGACTGTCGTTGCTGCTGTTGATATGGCCAGAGTGAGAGAACCAGCCATCAGTGCTGTAGAGCAAACTGCTCAGAGGACAACCACG

ACTGCTGTGCATATACAACCTGCTCAAGAACAG GCGAGAAAAGAGGCGGAGAAGACCGCAGTAACCAAGGTTGTAGTTGCTGCCGATAAAGCCAAGGAA

CAGGAACTAAAATCACGAACCAGAGAAGTGATGGTGACAACGCAAGAGCAGACTCACATATCTCATGAGCAG ATAAGAAAAGAAACTGAAAAAGCATTT

GTACCAAAGGTAGTGATCTCCGCAACCAAAGCCAAAGAGCAAGAAACTAGAATCACGGGAGAAATTACTACAAAACAAGAGCAAAAGCGAATAACTCAAG

AAACA ATAAGACAGGAAACTGAGGAAATTGCTGCATCCATGGTAGTGGTTGCCACCGCCAAGTCCACAAAACTAGAGGCAGCTGTGGGAGTTCAAGAAG

AGACTGCCATACAACAGGATCAAATGCACCTCACTCATGAACAG ATGATGAAGGAAACTAGGAAAACAGTGGTACCCAAAGTCATAGTTGCCACGCCCA

AGATTAAAGAGCAAGATTTAGTATCAAGAAGTAGAGAAGCCATCACTACCAAAAGAGATCAAGTTCAAATAACTCAGGAAAAG AAGAGAAAGGAAGTGG

AAACAACTGCCTTGTCTACAATAGCAGTTGCTACTGCTAAAGCCAAAGAGCAAGAAACAGTTCTGAGGTCTAGAGAAGCCATGGCCACTAGACAAGAACA

CATCCAAGTTACCCATGGACAG GTGGGCGTTGGGAAGAAGGCAGAAGCCGTGGCAACAGTTGTAGCTGCTGTGGACCAGGCCCGAGTGAGGGAACCCAG

AGAGCCTACGCATGTGGAGGAATCGCATTCTCAGCAGACTACGTTAGAGTATGGCTACAAAGAACACATTTCCACCACAAAGGTCCCAGAGCAGCCCCGG

CGCCCAGCCTCAGAGCCCCACGTTGTCCCTCAAGCAGTCAAGCCTGCTGTGATTCAGGCTCCTTCTGAGACTCATATCAAAACTACTGACCAAATGGGAA

TGCATATATCGTCACAG GTCAAGAAAACTACAGATATCTCAACAGAAAGATTAGTTCATGTGGATAAACGCCCCCGCACAGCGAGCCCTCACTTTACTG

TTTCAAAAATTTCTGTACCTAAGACAGAACATGGATATGAG GCATCGATAGCTGGTAGCGCTATCGCCACACTACAAAAAGAATTGTCAGCCACATCTT

CAACTCAGAAGATCACCAAATCCGTGAAGGCACCCACCGTGAAGCCTGGGGAGACGAGAGTAAGGGCGGAGCCCACCCCTTCCCCACAGTTCCCCTTTGC

TGACATGCCGCCGCCAGACACTTACAAGAGTCAGGCTGGCATTGAGGTGAAGAAGGAAGTCGGGGTGAGCATCAGTGGCAGCACCGTTCGTGAGGAGCAC

TTCGAAGTACTGCGCGGACGTGAAGCCAAG GTAACAGAGACAGCACGAGTGCCTGCTCCTGCTGAAGTGCCTGTTACTCCGCCTACCTTGGTCTCG GG

CTTAAAAAACGTGACTGTCATAGAAGGCGAATCTGTCACCTTGGAGTGCCACATCTCTGGATACCCATCCCCCAAGGTGACATGGTACAGAGAAGACTAC

CAAATCGAAAGTTCCATTGATTTCCAGATAACCTTCCAGGGTGGAATTGCTCGTCTCATGATCCGCGAAGCCTTTGCGGAAGACAGCGGACGGTTTACCT

GCAGCGCCGTGAATGAGGCCGGGACCGTCAGCACTTCCTGCTATCTTGCTGTGCAAG TGTCAGAAGAGTTTGACAAGGAAACAACTCTGACTGAGAAAT

TTGCCACCGAAGAGAAACG CTTCGTGGAGTCAAGAGATGTAGTCATGACCGACACCAGCATCACAGAGGAGCAGGCAGGGCCTGGAGAGCCTGCTGCGC

CTTTCTTCATTTCAAAGCCGGTGGTCCAGAAACTGGTGGAGGGTGGGAGTGTTGTGTTTGAATGCCAGATCGGCGGCAACCCAAAGCCCCACGTCTACTG

GAAAAAATCTGGCGTTCCTCTCACCACTGGATACAG ATACAAAGTGAGTTATAACAAGCAGACTGGGGAATGCAGACTGGTGATTTCTATGACGTTCGC

TGATGATGCTGGAGAATACACTATTGTCATCCGAAACAAGCACGGGGAGACGTCTGCATCTGCCTCCTTGCTGGAGGAAG CTGATTACGAGGCATTGGT

GAAGACTCAGCAAGAAATGCTTTACCAGACACAAATGAGCACATTTATTCAAGAACCCAAAGTGGGGGAAATAGCACCTGGATTTGCATATTCTGAATAT

GAGAAGGAATATGAAAAGGAACAGGCCTTAATTAGGAAGAAAATGGCCAAAGATACTGTGATGGTCAGGACTTTTGTAGAAGACCAA GAATTCCACATC

TCTTCTTTTGAAGAGAGGCTCATTAAAGAGATTGAATACAGAATAATAAAGACTACGCTGGAAGAACTTCTTGAGGAGGATGGAGAAGAGAAGATGGCAG

TCGACATTTCTGAATCTGAAGCTATCGAGTCAGGATTTGATATAAGGATAAAAAATTATAGAATTCTTGAGGGGATGGGTGTCACTTTTCATTGCAAGAT

GTCTGGATATCCGTTACCCAAG ATTGCGTGGTATAAGGATGGCAAGCGCATCAGACATGGGGAAAGATATCAAATGGACTTTCTACAAGATGGCAGAGC

CAGCCTGCGTATACCTGTTGTCCTTCCAGAGGACGAGGGCATCTATACTGCATTTGCCAGCAATATCAAAGGAAATGCGATTTGCTCTGGGAAGCTGTAC

GTGGAGCCTGCTGCACCATTTAGCGCTCCAACTTACATGCCCACACCAGAAGCAGTGAGCAGAATCAG GTCTGTCTCTCCACGTTCACTGAGCAGGTCA

CCTATACGTATGTCTCCTGCGATGTCCCCTGCACGAATGTCCCCCGCACGGATGTCCCCTGCACGGATGTCCCCCGCACGGATGTCTCCTGGACGCAGGC

TGGAGGAGACAGATGAATCACAGCTGGAGAGACTGTATAAGCCAGTCTTTGTATTAAAACCTGCTTCTTTCAAATGTTTAGAAGGACAGACTGCCAGATT

TGACTTGAAGGTTGTGGGCAGACCCATGCCAGAGACATTCTGGTTTCACAATG GACAGCAAATTGTCAATGATTATACGCACAAAGTCGTCATTAAAGA

AGATGGAACTCAGTCACTGATCATTGTCCCTGCGTCACCCAGCGATTCAGGAGAATGGACAGTGGTGGCCCAAAACAGAGCAGGAAAATCCACAATATCT

GTGACTTTAACTGTAGAAG CTGTGGAACACCAGATCAAGCCAGCATTTGTGGAAAAACTGAAAAATGTCAACATAAAGGAAGGTTCCAGGCTCGAAATG

AAAGTCAGAGCTACAGGCAACCCCAACCCTGACATTGTGTGGCTGAAAAACAGTGACATCATTGTTCCTCATAAATACCCAAGGATCAG GATTGAAGGA

ACCAGAGGAGAAGCCGCCCTTAAGATTGATTCCATTATCAGCCAAGATTCAGCCTGGTATACAGCCACGGCTATTAACAAGGCAGGCCGAGACACCACAA

GGTGCAAAGTCAATGTTGAGGTTGAGTTTGCAGAACCTGAACCGGAAAGAAAGCTGATTATTCCACGAGGAACGTACAGAGCAAAGGAGATTGCTGCCCC

AGAACTGGAGCCTCTCCATTTGAGATACGGTCAAGAACAGTGGGAGGAGGGTGACCTCTATGACAAGGAGAAACAACAGAAACCGTTTTTCAAGAAAAAA

CTCACTTCCCTCAGACTGAAGCGCTTTGGACCTGCCCACTTTGAGTGCAGACTCACACCAATTGGTGACCCAACCATGGTGGTGGAGTGGCTTCACGATG

GGAAGCCCCTGGAGGCGGCCAACAGGCTTCGGATGATTAATGAATTCGGCTACTGCAGCCTTGATTATGGAGCAGCGTATTCCAGAGACAGTGGTGTCAT

CACCTGCAGAGCTACTAACAAATATGGGACAGATCACACCTCTGCTACTCTTATTGTCAAAGATGAGAAAAGCCTAGTGGAAGAATCTCAACTGCCTGAT

GGGAAAAAAGGCTTACAGAGGATAGAAGAACTAGAGAGAATGGCTCACGAAGGTGCGCTGACAGGTGTGACAACAGATCAAAAAGAAAAACAAAAGCCAG

ACATTGTCTTGTTCCCAGAGCCAGTGAGAGTGCTGGAAGGGGAGACAGCCAGATTCCGCTGCCGAGTGACAGGCTACCCTCAGCCCAAGGTCAACTGGTA

CCTCAATGGACAGCTCATCCGGAAAAGCAAAAGGTTCAGAGTTCGCTATGATGGCATTCACTATCTGGATATTGTGGACTGCAAATCCTATGACACAGGT

GAAGTCAAGGTCACTGCGGAAAATCCTGAAGGTGTGACGGAACACAAAGTAAAACTTGAAATCCAACAGAGGGAGGATTTCAGATCTGTCCTTAGGCGTG

CTCCCGAGCCAAAGCCCGAGTTTCATGTACACGAACCGGGGAAACTTCAGTTCGAAGTGCAGAAGGTAGACAGACCCGTGGACACCAGCGAAACCAAAGA

AGTGGTGAAGCTGAAAAGGGCTGAAAGGATTACCCATGAGAAGGTGTCCGAGGAGTCTGAAGAACTGCGCAGTAAATTTAAGCGCCGGACGGAAGAGGGA

TACTATGAAGCCATCACAGCCGTGGAGCTGAAGTCTCGCAAGAAGGATGAGTCTTACGAAGAGCTCCTCAAGAAAACTAAAGATGAGCTTCTGCACTGGA

CCAAAGAGTTAACTGAAGAGGAGAAGAAAGCCTTGGCTGAAGAAGGCAAAATCACGATTCCAACCTTTAAACCTGAGCGAATCGAACTTAGCCCTAGTAT

GGAGGCACCCAAAATCTTTGAACGAATCCAGAGCCAGACCGTTGGCCAAGGATCTGATGCTCACTTTAGAGTCAGGGTTGTGGGAAAACCAGACCCTGAG

TGTGAATGGTATAAAAATGGTGTAAAAATTGAGCGATCTGACCGAATCTACTGGTACTGGCCAGAAGACAATGTTTGTGAACTGGTCATAAGAGATGTAA

CTGCAGAGGACTCTGCCAGCATCATGGTAAAGGCCATCAACATAGCTGGGGAAACCTCAAGCCACGCATTCCTGCTCGTCCAAG CCAAGCAACTGATCA

CTTTTACACAAGAATTGCAAGATGTTGTTGCTAAGGAAAAGGACACCATGGCAACATTTGAATGTGAAACTTCAGAACCATTTATCAAAGTAAAATGGTA

TAAAGATGGTATCGAAGTTCATGCAGGGGATAAGTATAGGATGCACTCTGACCGAAAAGTTCACTTCCTGTCTGTGCTGACCATCGACACATCTGATGCT

GAAGACTACAGCTGTGTACTTGTGGAAGATGAAAATATCAAGACGACAGCGAAACTTATTGTGGAAG GTGCAGTAGTTGAATTTGTGAAAGAACTTCAG

GACATAGAAGTCCCAGAGTCATACTCAGGAGAGTTAGAGTGCATCATATCTCCAGAAAACATAGAAGGCAAATGGTATCACAATGATGTGGAGTTGAAGT

CCAATGGCAAATACTCAATTACATCCCGCCGTGGGCGCCAGAACCTCACAGTCAAGGATGTAACCAAAGAGGACCAGGGAGAGTACAGCTTTGTTGTTGA

TGGGAAAAAGACAACCTGTAAACTGAAGATGAAAC CCCGACCTATTGCTATTCTCCAAGGACTTAGCGATCAAAAGGTCTGCGAGGGTGACATTGTTCA

ACTTGAAGTCAAAGTCTCCTTAGAAAATGTAGAAGGTGTCTGGATGAAAGATGGTCAAGAAGTACAACACAGTGACAGAGTTCACATTGTAATAGACAAG

CAGTCCCACATGCTACTTATTGAAGACATGACCAAAGAAGATGCTGGGAATTACTCCTTCACTATTCCTGCCCTTGGACTCTCCACCAGTGGGAATGTCT

CTGTCTATA GTGTTGATGTGATAACACCTCTCAAAGATGTCAATGTGATTGAAGGTACCAAGGCTGTACTTGAATGCAAGGTCTCAGTTCCCGATGTAA

CTTCTGTTAAATGGTACCTAAATGATGAACAAATCAAGCCTGATGATCGTGTGCAATCCATTGTCAAAGGCACCAAACAGCGACTTGTGATTAACCGAAC

CCATGCTTCTGATGAAGGACCTTACAAGCTGATGGTTGGCAGGGTGGAAACCAGCTGTAACCTGTCTGTAGAGA AAATTAAAATTATCAGAGGTCTCCG

TGACCTTACCTGCACAGAAACACAAAATGTGGTCTTTGAGGTTGAGCTATCCCACTCAGGAATTGATGTTGTATGGAATTTTAAGGGCAAGGAAATTAAG

CCCAGTTCTAAATATAAAATTGAAGCTCATGGGAAAATATACAAACTGACAGTCCTCAATATGATGAAAGATGATGAAGGGGAGTATGCATTCTATGCAG

GAGAAAATACAACATCTGGAAAGCTAACTGTGGCAG GAGGAGCCATCTCCACACCACTCACAGACCAGACTGTGGCTGAATCCCAGGAGGCTGTGTTTG

AATGTGAAGTTGCCAACCCTGAGTCTGAGGGGGAATGGCTGAAGGATGGAAAGCACTTGGCTCTGAGTAACAACTTCAGAGGTGAATCCGATGGCCACAA

AAGGAGGCTTGTCATCGCTGCCGCCAAGTTAGATGACGCTGGAGAATATACCTACAAGGTGGCTACCTCCAAAACATCTGCCAAGCTGAAAGTTGAAG C

TGTCAAAATTAAGAAGACCCTGAGGAACCTCACTGTGACAGAGACACAGGATGCAGTCTTCTCTGTTGAACTCACACACCCAGATGTCAAAGGGGTCCAG

TGGATCAAAAACGGAGTTGTCTTAGATTCCAACGACAAGTATGAGATCTCAGTCAAAGGGACACTTTATTCACTGAAGATTAAAAACTGTGCCATGGCAG

ATGAATCTGTCTACGGCTTCAAACTGGGGAGGCTAGGAGCTAGCGCCCGGCTGCACGTTGAGA CTGTCAAGATTATTAAGAAACCAAAGGACGTGACCG

CCTTGGAAAACGCCACTGTTACCTTCGAAGTCAGTGTTTCCCATGACACGGTGCCAGTAAAATGGTTCCATAAGAACGTGGAGATTAAGCCAAGTGACAA

GCACAGACTGGTCTCAGAGAGAAAAGTCCACAAACTCATGCTTCAGAGCATCTCCCCCTCGGATGCCGGCGAGTACACAGCCATGGTGGGCCAGCTGGAG

TGCAAAGCCAAGCTGTTTGTGGAGA CACTCCATATCACAAAGACTATGAAAAGTATCGAGGTTCCTGAAACCAAAGCTGCCTCTTTCGAGTGTGAGGTG

TCCCACTTCAATGTCCCCTCCATGTGGCTAAAGAACGGAGTGGAAATTGAGATGAGTGAAAAATTCAAGATCGTCGTGCAGGGGAAACTGCACCAGCTGA

TCATCATGAACACGAGCACGGAGGACTCAGCGGAATACACATTTGTTTGTGGCAATGACCAAGTCAGTGCTACCCTGACAGTGACCC CAATCATGATTA

CATCCATGCTGAAAGACATCAATGCTGAAGAAAAAGATACCATAACTTTTGAGGTGACAGTAAACTATGAAGGCATCTCTTACAAATGGTTAAAGAACGG

TGTGGAGATCAAGTCGACTGACAGGTGCCAGATGAGAACCAAGAAGCTCACGCACTCGCTGAACATCAGGAATGTTCACTTTGGAGATGCTGCTGATTAT

ACTTTTGTGGCTGGAAAAGCCACATCGACGGCCACCCTTTATGTGGAAG CTCGTCATATAGAATTTAGGAAACACATTAAGGATATTAAGGTTCTGGAG

AAGAAACGAGCCATGTTTGAATGTGAAGTTTCTGAGCCCGACATAACTGTTCAGTGGATGAAAGATGGCCAAGAGCTTCAGATAGCAGACAG GATAAAG

ATCCAGAAGGAGAAATATGTCCACCGCCTTCTGATCCCATCCACACGCATGTCTGATGCCGGGAAATATACAGTGGTGGCAGGAGGCAACATGTCAACTG

CTAACCTCTTTGTCGAAGGCAGGGATGTCCGCATCCGGAGCATTAAGAAGGAGGTCCAG GTCATTGAGAAGCAGCGTGCTGTCGTGGAGTTCGAAGTCA

ATGAGGATGACGTAGACGCCCACTGGTATAAAGATGGCATTGAAATCAACTTCCAAGTTCAAGAGCGACACCAGTATGTGGTGGAGAGAAGAATTCACCG

GATGTTTATATCAGAAACAAGACACAGTGACGCAGGCGAATACACCTTTGTGGCAGGCAGAAACAGGAGTTCTGTGACTCTTTATGTCAATG CTCCAGA

ACCACCCCAAGTCCTGCAGGAACTCCAGCCTGTCACTGTACAGTCCGGCAAGCCGGCTCGCTTCTGCGCCGTGATATCAGGCAGACCGCAGCCCAAAATT

TCCTGGTACAAGGAGGAGCAGCTGCTTTCCACTGGCTTCAAGTGCAAATTTCTGCACGACGGGCAGGAGTACACACTTCTGCTCATTGAGGCTTTCCCAG

AGGATGCGGCAGTCTACACCTGTGAAGCCAAGAATGACTACGGAGTAGCCACAACGTCGGCTTCTCTGTCCGTGGAAG TTCCAGAAGTTGTATCTCCGG

ATCAGGAAATGCCAGTCTACCCGCCTGCCATAGTCACTCCACTTCAGGACACAGTTACTTCTGAGGGGCGCCCAGCGCGTTTCCAGTGCCAAGTTTCAGG

GACAG ATTTGAAGGTGTCTTGGTACTGCAAAGACAAGAAAATCAAACCATCTCGGTTCTTCAGGATGACCCAGTTTGAAGACACCTACCAGCTGGAGAT

CGCTGAAGCCTACCCCGAGGACGAGGGAACGTATGCCTTTGTTGCTAATAATGCTGTGGGCCAAGTGTCCAGCACTGCCACCCTGAGGCTGGAAG CCCC

CGAGTCGATTCTGCATGAGAGGATCGGCCAGCAAATCGAAATGGAGATGAAAG AAATTGCTAGCCTTCTGTCCGCCGAGGAAGATTTTCAAACCTATAG

TTCTGATCTACGTTTACCTAATGCGAATGAAACACTTGAACTTCTGTCTGAGCCTCCAGCTCGTTCCACCCAGTTTGATTCCAGACAGGAAGGCGCTGCC

CCAGTTTTCATCAGAGAAATATCAGACGTTGAAATAAGCGTCGAAGATGTAGCTAAATTGTCTGTTACTGTCACTGGCTGCCCCAAGCCTAAAATTCAAT

GGTTCTTTAATGGGATGCTGTTAACCCCTTCTGCTGACTACAAATTTGTCTTTGATGGGGATACCCACAGCCTAATCATTCTGTTCACCAGATTTCAGGA

TGAGGGGGAGTACACGTGCCTGGCCAGTAATGAATATGGAAAGGCAGTGTGTAGCGCTCACCTAAGAATAAGTCCCAGAGGAGAGAGGAGCACGGAGATG

GAGTCAGGAGAGAAAAAGGCTCTGGAAAAGCCCAAAGGGCCTTGTCCTCCTTATTTTTTCAAGGAATTAAAACCAGTGCACTGTGGCCCAGGAATCCCTG

CTGTCTTTGAGTACTCGGTGCACGGAGAGCCTGCCCCCACTGTCTTGTGGTTCAAAGAAGACATGCCACTTTATACCAGTGTTTGCTACACCATCATTCA

CAGTCCTGACGGATCCGGGACCTTCATCGTTAATGACCCACAGAGGGGAGATAGTGGCCTGTACCTCTGTAAAGCCCAGAACCTCTGGGGGGAGTCCACC

TGTGCCGCAGAGCTTCTTGTGCTTCCAGAAGACACAGATGTGCCCGATGCCTCCTGCAAGGAAGAGTCCACCTTAGGAGTTCCTGGTGATTTTCTGGAAA

CATCTGCCAGGGGCCCTTTAGTTCAGGGAGTTGACTCACGGCAGGAAATTACAGCTTTTGCCGAGGGTACCATTTCGAAAGCTGCTTTAATTGCAGAGGA

AACGCTGCAGCTTTCTTACGAGCGTAGTGTTGATGACAGTGAAGTGGGTACTGGGGTGACCATAGGGGCCCAGAAGCTGCCGCCTGTTGTATTGTCCACT

CCCCAGGGCACTGGGGAGCTGCCTTCCATTGATGGTGCAGTTCACACACAGCCAGGCAGAGGACCACCCCCCACTTTAAACCTGCAGGCAGTCCAGGCTC

AGACAACCCTCCCCAAGGAAGCTACTCTACAGTTTGAAGAGCCTGAGGGAGTCTTCCCAGGTGCCTCATCTGCAGCACAAGTGAGTCCGGTCACCATCAA

ACCTCTGATAACCTTAACAGCTGAACCCAAAGGGAATTATCCACAGTCTTCCACAGCAGCTCCTGATCATGCACTTCTGTCCTCTGTGGCTGCAGAAACA

CTTCAGCTAGGAGAAAAGAAAATCCCAGAAGTGGACAAAGCACAAAGAGCTCTCCTCCTGAGTCAGAGCTTAGCTGAGGGATGTGTAGAAAGTTTAGAGG

TTCCTGATGTTGCAGTCTCTAACATGCGCTCTGAGCCCCAAGTCCCTTTCCAACATACATGCACAGAAGGCAAGATCCTGATGGCTAGTGCAGACACTCT

AAAAAGCACAGGGCAAGATGTTGCACTGAGGACCGAGGAAGGCAAGTCCCTAAGCTTCCCACTAGCACTTGAGGAAAAGCAGGTCCTACTTAAGGAAGAG

CAATCAGAGGTCGTGGCAGTGCCCACTAGCCAAACCTCTAAGTCTGAGAAAGAGCCAGAGGCCATAAAGGGAGTGAAGGAGGTACGAGAACAGGAGCTGC

TTTCTAAGGAAACATTGTTTCCTAGTATGCCTGAAGAGCAGCGATTACATCTGAAAACTCAGGTCCGCAGGGCTTTGCAAGCTGCCGTGGCCAGGGAACA

AGCAAATCTTTTCTCTGAGTGGCTAAGAAACATTGACAAGGTGGAGGTCACAGCCGTAAACTTCACTCAAGAGCCCAAGCGTATCCTGTGCACCTACCTT

ATTACCTCAGTGAGCTCACTAACCGAAGAGTTAACCGTCACTATTGAAGACATAGATCCTCAAATGGCTAACCTGGAAACTGGACTGAAGGATGCCTTGT

GCTCCATTGTCTGTGAAGAAAGAAACATCTTAATGGCTGAGGATCCGAGGATTCACGAAGAAGACAAAATAGACGTGCAAGGCGGAAGAGATCACCTTTC

AGATGCACAGAAAGTTGAAACCGTCATAGAGGCAGAAGCTGACTCTAAGTACCTTGTCTCCAAAGAAGAGGTCAGTTGGTCGAAAGTGGAAAGTCAACTC

AAAGATGGAGATACCAATGAGGTTCCGCAGGCTGAGACTCTGAAATTAGCAGAAGAGAGTGGTACCCAGAAGACCAGTACAGAGATGTCACAAGAAGAAG

CTGAGGGTACCTTAGCTGACCTTTGCCCTGCTGTCCTTAAACACTTAGTGGATACCATTTCTGAGGAAGGAGATACTGTCCACCTTACATCATCCATATC

AAATGCTAAGGAGGTGCACTGGTATTTCAAGGGTAACCTGGTGCCCTCAGACGGAAAGTTCAAGTGTTTAAAGGAGCAGAATGCCTACACTCTGGTAATT

GAGGCAGTAAAGACGGAGGATGAAGGGGAGTATGTCTGCGAAGCCTCAAATGACAGTGGGAAAGCAAAGACATCAGCAAAGCTCACTGTGGGAGAAAGAG

 CTGCCCCTGTGATCAAAAGGAGAATTGAGCCCCTGGAAGTAGCTCTGGGCCACCTGGCCAAATTCACCTGTGAGATCCAAGGAGCCCCCAACGTCCGGT

TCCAGTGGTTCAAAGCTGGCAGAGAGATCTATGAGAGCGACAAGTGTTCCATTCGATCTTCGAACTATGTCTCCAGCCTGGAGATCCTGAGAACCCAGGT

CGTTGACTGCGGGGAGTACACCTGCAAAGCCTCCAATGAGTATGGCAGTGTCAGCTGCACAGCCACACTAACTGTGACAG AGGCGTATCCACCAACCTT

TCTCTCCAGGCCCAAGGCCCTTACGACTTTCGTGGGTAAGGCAGCCAAGTTTCTCTGCACAGTGTCAGGGACTCCGGTGATTGAGATCATCTGGCAGAAA

GATGGCGCTGCCCTGTCACCGTCACCTGACTGCAGGGTCACAGACGCAGACAACAAACACAGTTTAGAACTCTCAAATCTTACTGTTCAGGACAGGGGTA

TTTACTCTTGTAAGGCTTCCAACAAATTTGGAGCAGATATCTGCCAGGCCGAGTTGACCATCATTGACAAACCCCACTTCATTAAAGAGTTAGAGGCTGT

ACAGTCAGCCATCAATAAGAAGATCCACCTTGAATGCCAAGTCGATGAGGATAGGAAAGTCACAATCACATGGAGCAAAGATGGGCAGAAACTTCCTGCT

GGGAAAGATTACAAGATCTATTTTGAAGATAAAATAGCATCGCTTGAGATTCCCCTGGCCAAACTAAAAGATTCTGGAACCTATACATGTACAGCGTCCA

ACGAGGCTGGGAGCAGTTCTTCGTCTGCTGCGGTCGCTGTCAGAG AACCGCCGTCCTTTGTGAAGAAGGTGGATCCCTCTTATTTAATGCTCCCGGGTG

AATCAGCACGCCTCCATTGCAAGCTGAAAGGCTCACCTGTGATCCAGGTCACTTGGTTCAAAAATAACAAAGAACTCAGTGAGAGTAACACAGTCCGCAT

GTCTTTTGTCAATTCTGAGGCTATCCTCGACATCACTGATGTAAAGGTCGATGACAGTGGTACTTACTCCTGTGAAGCCACCAATGACGTGGGCAGCGAC

AGCTGCAGCACTGAAGTGGTGATCAAAG AGCCGCCTTCCTTCATCAAAACTCTTGAGCCCGCAGACATAGTGCGAGGGGCCAATGCACTGCTCCAGTGT

GAGATCGCAGGCACGGGACCCTTTGAAGTTAACTGGTTTAAAGACAAGAAGCAGATCCGAAGTAGCAAAAAGTACAGGTTGTTTACTCAGAAGACTTTTG

TGTACCTGGAAATCTCATCTTTCAATAGTGCCGACGTTGGCGATTACGAATGTGTAGTTGCTAACGAAGTCGGAAAGTGTGGCTGTGTCGCGACACACTT

ATTAAAAG AACCACCAACCTTTGTCAAGAAAGTAGATGATTTTACAGCCCTAGCAGGACAGACCGTTACCTTACAAGCTGCCGTGAGAGGGTCAGAACC

CATTTCTGTCATGTGGATGAAAGGCCAAGAAGTCATTAAAGAAGATGGAAAAATCAAAATGAGCTTTTCCAATGGAGTTGCCGTCTTGACCATCCCTGAT

GTTCAGATTAGTTTGGGTGGCAAATATACATGCCTGGCTGAAAACGAAGCTGGGAGCCAAACATCTGTCGGGGAATTGATAGTTAAAG AACCTGCCAAA

ATCATTGAGCGAGCAGAACTAATCCAGGTGACCGCAGGAGACCCAGCCACTCTGGAGTACACAGTCTCAGGCACCCCAGAACTCAAGCCCAAGTGGTACA

AAGATGGGAGACCCTTGGTTGCTAGTAAAAAGTACCGAATCAGTTTTAAAAACAACATTGCCCAACTGAAATTTTATTCTGCTGAACTGCACGACAGTGG

CCAGTACACGTTTGAGATTTCCAACGAAGTGGGCAGCAGCTCCTGTGAGACCACATTTACCGTGTTAG ATCGAGACATTGCTCCGCTTTTCACCAAACC

CTTACGTAACGTGGACAGTGTCGTTGGCGGTGCCTGCAGGTTAGACTGCAAAATTGCTGGCTCCCTCCCCATGAGGGTTTCCTGGTTTAAGGATGGCAAA

GAGCTCACTGCTTCCGACAGATACCAGATAGCATTTGTGGAAGGCACAGCCTCTTTGGAGATCAGCAGAGTAGACATGAATGATGCAGGGAATTTCACCT

GCCGGGCCACCAATTCCGTGGGAAGCAAAGACAGCAGCGGAGCCCTGATTGTGCAAG AACCACCCAGTTTTGTAACTAAGCCAGGGTCCAGGGATGTCC

TGCCCGGCTCGGCAGTCTGTCTGAAGAGTGCTTTCCAGGGCTCCGCCCCTCTCACCATCAAGTGGTTTAAGGGCGACAAAGAGTTGGTTTCCGGTGGAAG

CTGCTATATTACCAAAGAAACTTCAGAGAGTTCCCTGGAGCTCTACGCAGTGAAAACCTCGGATTCGGGCACTTACACGTGCAAAGTCAGCAACGTAGCC

GGGAGTGTGGAATGCAGTGCAGACTTGTTTGTGAAAG AGCCTGCTACCTTTATTGAAAAGTTAGAGCCATCCCAACTGTTAAAGAAAGGAGATGGCACT

CAGCTAGCCTGCAAGGTCACGGGTACCCCTCCAATTAAGATAACATGGTTTGCAAATGACCGAGAACTGAGAGAGAGCAGCAAACACAAAATGTCTTTTG

CGGAGTCCACCGCAGTTTTAAGGCTTACGGATGTGGCCATTGAAGACAGTGGAGAATATATGTGCGAGGCACAAAACGAGGCCGGCAGTGACCACTGTAC

TGGCATTGTCATAGTCAAAG AGTCACCTTACTTTACCAAGGAATTTAAGTCCATTGAAGTATTAAAGGAGTATGACGTCATGCTGCTGGCTGAGGTGGC

AGGCACCCCTCCCTTTGAGATCACTTGGTTCAAGGACAACACAACCCTGAGAAGTGGTAGAAAGTATAAAACCTTCCTTCAGGATCAGCTGGTCAGCCTG

CAGGTCCTCAAGTTTGTAGCTGCAGATGCAGGTGAATACCAATGCCGGGTGACCAACGAGGTCGGCAGCAGCACCTGCAGTGCCAGGGTGACATTAAGAG

 AACCCCCGTCCTTCATTAAGAAGATTGAAGCCACCAGCTCCCTCCGTGGGGGCACAGCCGCCTTCCAGGCCACTCTGAAAGGCTCCTTGCCAATCACTG

TGACCTGGTTGAAAGACAATGATGAGATCACTGAAGATGACAATATAAGAATGACTTTTGAGAACAACGTGGCTAGTCTATACCTCAGTGGTATTGAAGT

CAAGCATGATGGGAAATATGTCTGTCAAGCCAAAAATGATGCAGGCATACAAAGGTGTTCTGCATTACTCTCAGTCAAAG AACCTGCAACAATAATGGA

GGAGGCTGTGTCCATAGATGTCACTCAAGGAGACCCAGCCACTTTGCAAGTTAAATTTTCAGGGACTAAGGAGATTTCAGCTAAATGGTTTAAAGATGGC

CAAGAACTTACCCTGGGTCCAAAATACAAAATCAGTGTCACTGACACAGTCTCAATACTAAAGATTATTTCCACAGAGAAGAAGGATAGTGGAGAATATA

CTTTTGAGGTCCAAAACGATGTTGGGAGAAGCAGCTGCAAGGCTAGCATTAATGTTTTAG ATCTTATTATACCTCCTTCATTCACCAAAAAATTGAGAA

AAATGGACAGCATTAAAGGATCTTTTATTGACTTAGAGTGTATAGTGGCTGGATCCCATCCAATAAGCATCCAATGGTTCAAAGACGACCAAGAAATCTC

AGCTAGTGACAAGCACAAATTCTCTTTTCATGACAATACCGCCTTCTTAGAGATCAGTCAGCTGGAAGGCACAGACAGTGGTACATATACCTGTTCTGCC

ACCAACAAGGCAGGCCACAGCCAGTGCAGTGGTCACCTGACAGTCAAAG AACCCCCTTACTTCGTGGAAAAGCCACAGTCACAAGATGTGAATCCCGGT

ACGAGGGTTCAATTGAAGGCTCTTGTGGGTGGCACTGCACCCATGACAATAAAGTGGTTTAAAGATAACAAGGAGCTGCACCCTGGGGCAGCTCGCTCGG

TTTGGAAGGATGACACCTCCACCATTCTTGAACTCTTCTCAGCCAAGGCTGCCGACTCCGGGACCTACATTTGCCAGCTAAGCAATGATGTTGGCACAAC

AAGCAGCAAGGCCACCATCTTTGTGAAAG AACCTCCTCAATTTATTAAGAAGCCCAGTCCAGTGTTAGTGCTGAGGAATGGACAGTCAACAACATTTGA

ATGCCAAGTCACAGGCACCCCTGAAATCAGAGTTTCTTGGTATCTGGATGGGAATGAAATAACAGATCTTAGGAAATATGGCATTTCTTTTGTGGATGGT

TTAGCCACTTTCCAGATTTCTAATGCCAGGGTTGAAAACAGTGGAACTTACGTCTGTGAAGCTCGAAATGATGCAGGCACCGCGAGCTGCAGCATTGAAC

TAAAAGTAAAAG AGCCTCCCATCTTTATCCGGGAGCTGGAGCCTGTGGAAGTGGTAAAAGACAGTGATGTGGAACTGGAGTGTGAAGTCATGGGGACAA

CTCCATTTGAAGTCACTTGGCTGAAGAATAACAAGGAAATCAGAAGTGGCAAAAAATACACAATGTCTGAGAAAATGTCAGTGTTTTACCTGCATATAAC

CAAGTGTGACCCTTCAGACGTTGGTGAATATCAGTGCATCATAGCCAACGAAGGAGGCAGCTGTGCTTGTAGTGCTCGGGTTGCCTTGAAAG AACCACC

ATCGTTTATCAAGAAGATAGAAAATGTCACCACTGTCTTGAAGAGTTCCGCCACCTTTCAGAGCACCGTGGCAGGCTCACCGCCCATTTCTATAACCTGG

CTAAAAGATGACCAGATTCTTGAGGAAAATGACAATGTCCATATTTCTTTTGAGGACAGTGTGGCCACACTTCAAGTCCGGAGTGTGGACAATGGGCACA

GTGGGCGATACACATGTCAAGCCAAGAATGAGTCAGGAATTGAGAGGTGTTATGCTTTCCTCTTAGTACAAG AACCTGCTCAAATCATAGAGAAAGCTA

AGTCGGTTGATGTTACTGAGAAAGACCCAGTCACCCTGGAGTGCGTAGTGGCTGGAACACCAGAACTCAAAGTCAAATGGCTTAAAGATGGGAAACAAAT

TGTACCCAGTAGATATTTTTCAATGAGTTTTGAAAATAACGTGGCCAGTTTTAGGATTCAGTCAGTCATGAAGCAAGACAGTGGACAGTACACGTTCAAG

GTGGAAAATGACTTTGGAAGCAGTAGCTGTGATGCCTACCTGAGAGTGCTAG ACCAAGATATTCCCCCATCGTTCACCAAAAAGTTAACCAAAATGGAT

AAAGTTCTGGGTTCTTCTATCCACATGGAGTGCAAGGTTTCTGGGTCACTTCCTATCAGTGCTCAGTGGTTTAAAGATGGAAAAGAGATATCTACAAGTG

CAAAATACAGACTGGTGTGTCACGAAAACACCGTGTCACTGGAAGTTAGTAATCTGGAATTAGAAGACACTGCAAATTACACCTGCAAGGTGTCCAATGT

AGCAGGGGACAACGCCTGTAGTGGCATCTTAACTGTGAAAG AACCACCAAGCTTCCTAGTGAAACCCGAGAGGCAGCAAGCTATACCGGATTCTACCGT

GGAATTTAAGGCTGTGCTGAAAGGAACACCACCGTTCAAAATTAAATGGCTTAAAGATGATGTGGAACTTGTCTCAGGACCTAAGTGTTTCATTGGCTTG

GAAGGGTCAACCAGCTTCTTAAACCTCTACTCAGTGGATTCTTCCAAGACTGGACAGTATACTTGCCAAGTTACCAATGACGTTGGTAGCGACTCTTGCA

CTACAATGTTGCTTGTGACAG AACCACCGAAATTTGTAAAGAAATTAGAAGCTTCCAAAATTATAAAAGCAGGTGACTCTGCACGATTGGAATGCAAGA

TTACTGGATCTCCAGAAATACAAGTTGTGTGGTATAGAAACGAACACGAGCTCACAGCCAGCGATAAATACCAGATGACTTTCATTGACTCGGTGGCGGT

CATACAGATGAACAGCCTTGGGACAGAAGACAGTGGAGATTTTATCTGTGAGGCTCAGAATCCTGCCGGCAGCACCAGCTGCAGTACCAAGGTTATAGTA

AAAG AACCACCTGTTTTTAGCAGCTTTCCGCCTATAGTAGAAACCCTTAAGAACACTGAAGTTAGCCTTGAATGTGAGCTTTCAGGAACACCGCCATTT

GAGGTGGTGTGGTACAAAGACAAGCGCCAGCTCCGAAGCAGCAAGAAGTACAAGGTCGCATCTAAGAATTTCCATGCGAGCATTCACATCCTCAACGTGG

AATCTACAGACATTGGCGAATACCACTGCAAAGCACAGAATGAAGTGGGCAGTGACGCTTGCGTTTGCGCTGTAAAGTTAAAAG AACCACCAAAATTCA

TTTCCAAGCTGAACAGCCTTACGGTGGTAGCTGGCGAGCCTGCTGAGCTGCAAGCATCCATAGAAGGTGCCCAGCCCATTTCTGTCCAGTGGCTTAAAGA

GAAAGAAGAAGTGATCAGAGAGAGCGAGAACATTAGAATTTCTTTCGTCAACAACGTTGCAACTCTGCAGTTTGCTAAAGTGGAGCCAGCTAATGCTGGG

AAGTACATTTGCCAAGTCAAGAATGATGGCGGAGTGAGGGAAAACATGGCCACGTTGACCGTCTTAG AGCCTGCGGTCATTATAGAGAAGGCAGGGTCC

ATGACGGTGACTGTGGGAGAAACGTGTGCCCTGGAGTGTAAGGTGGCTGGCACTCCGGAGCTCTCTGTTGAATGGTATAAGGACGGAAAGCTCTTGACCA

GCAGCCAAAAACACAAATTTAGCTTCTACAACAAAATCTCTTCCTTAAAAATCCTCTCAGTTGAAAAGGAAGATGCAGGCACCTACACATTCCAGGTTCA

GAACAACGTTGGAAAAAGCAGTTGCACAGCTGTGGTCGATGTGTCAG ACCGAATGGTCCCTCCCTCTTTCACACGAAGACTGAAGGATACTGGTGGTGT

CCTGGGCACCTCTTGCATCTTAGAATGTAAAGTAGCTGGATCGTCTCCCATCTCTATTGCCTGGTTTCATGAGAAAACTAAGATTGTCAGTGGAGCAAAG

TACCAAACAACATTTTCAGATAATGTCTGCACATTGCAGTTGAATTCTCTGGACTCATCAGATATGGGCAGTTACACATGTGTGGCTGCTAACGTGGCTG

GGTCGGATGAATGTCGCGCACTGTTGACTGTACAAG AGCCACCCTCTTTTGTGAAAGAACCTGAACCCCTGGAAGTCCTTCCGGGCAAAAACATAACCT

TCACAAGTGTTATCAGAGGAACCCCTCCATTCAAGGTTGGCTGGTTTAGGGGAGCCAGAGAACTGGTGAAAGGTAACAGATGCAATATCTATTTTGAAGA

CACTGTGGCAGAACTGGAATTATTTAATATCGACATATCCCAGAGTGGGGAATACACCTGCGTGGTTTCTAACAATGCCGGCCAAGCATCCTGCACTACA

CGTCTCTTTGTGAAAG AACCAGCCACGTTTGTAAAGAAGTTAAGTGATCACTCTGTAGAACCAGGGAAGTCTATAATTCTAGAGGGCACCTATACTGGA

ACACTTCCAATTTCGGTCACCTGGAAAAAAGACGGTGTTAGCATAACTCCATCTGAAAGATGTAACATTGTCACCACGGAGAAAACGTGCATCCTGGAGA

TTCTGAGCAGCACCAAGGGAGATGCAGGGCATTACTCCTGTGAGATTGAAAACGAGGCAGGAAGAGATGCTTGCGACGCTCTTGTATCTACATTAG AAC

CACCTTATTTTGTTACGGAGTTAGAACCTCTGGAGGCATCTGTTGGAGATTCAGTTTCCTTGCAATGCCAAGTTGCTGGGACACCAGAAATTACAGTGTC

TTGGTTCAAAGGAGACACCAAATTAAGGTCAACTCCGGAATACAGGACCTACTTTACAAACAACGTGGCCACACTTGTGTTTAATAAAGTGAGCATCAAT

GACAGCGGGGAGTACACGTGCATGGCGGAGAATAGCATAGGAACAGCAGCCTCTAAGACCATCTTCAGAATCCAAG AGCGCCAGCTCCCGCCTTCCTTT

GCAAGACAGTTAAAGGACATTGAGCAAACTGTTGGATTACCAGTTACCCTCACTTGTCGACTAAATGGCTCTGCACCCATCCAAGTGTGCTGGTATAGAG

ATGGGGTGCTTTTAAGAGATGATGAAAATCTACAGATGTCATTTGTGGATAATGTGGCAACATTAAAAATTTTGCAAACTGACCTGAGTCACTCTGGCCA

GTATTCTTGCTCAGCTTCCAATCCACTTGGCACAGCATCTTCTACTGCTAGACTAACAGCAAGAG AACCTAAGAAATCACCCTTCTTTGATATCAAGCC

AGTATCAATAGATGTTATCGCTGGAGAAAGTGCAGATTTTGAGTGTCATGTGACTGGTGCTCAGCCAATGAGAGTCACTTGGTCAAAAGATAACAAGGAA

ATCCGACCTGGAGGAAACTATACTATCACGTGTGTGGGTAACACTCCCCATCTGAGGATTCTTAAAGTGGGCAAAGGAGACTCTGGCCAATACACGTGTC

AAGCCACCAATGACGTTGGCAAGGACATGTGCTCTGCTCAGCTCAGTGTGAAAG AACCTCCTAAGTTTATTAAGAAATTAGATGCTTCAAAAGTTGCGA

AGCAGGGAGAATCCATCCAACTGGAATGTAAGATAAGTGGCTCCCCAGAGATCAAAGTTGTGTGGTTCCGGAATGACAGCGAACTTCACGAAAGCTGGAA

ATACAACATGTCCTTCGTGAATTCTGTGGCCCTGCTAACCATCAATGAAGCCAGTGCTGAGGACACTGGGGACTACATCTGTGAAGCCCACAATGGCGTT

GGTGATGCCAGCTGCAGCACAGCCCTGAAAGTTAAAG CACCTCCTGTCTTTACCCAGAAGCCTCCTCCAGTTGGAGCCCTGAAAGGTTCTGATGTGATC

CTGCAGTGTGAAATTTCAGGAACACCCCCCTTTGAGGTGGTGTGGGTTAAAGATCGGAAGCAAGTGCGAAGCAGCAAGAAATTTAAAATCACCTCCAAAA

ATTTTGACACGAGTCTTCATATCTTTAATCTGGAAGCCCCTGACATAGGGGAATATCACTGCAAAGCCACGAATGAGGTGGGAAGTGACACGTGCGCTTG

CACGGTCAAGTTCAAAG AACCACCACGATTTGTGAAAAAACTCAGTGATGCGTCCACCCTTATTGGGGATCCCGTGGAGTTACAAGCCGTGGTAGAAGG

TTTCCAGCCGATTTCCGTTGTCTGGCTGAAAGATAAAGGTGAAGTCATCAGAGAGAGCGAAAACGTTAGGATTTCCTTTGTTGATAACATCGCAACTCTC

CAACTGGGAAGTCCAGAAGCATCACAGTCTGGAAAATATGTGTGCCAAATCAAAAACGATGCCGGGATGCGAGAGTGTTCAGCAGTCCTGACTGTCCTAG

 AACCAGCCACAATTGTAGAGAAACCAGAACCCATGACTGTCACAACTGGAAACCCCTTCACATTGGAGTGTGTAGTAGCTGGGACTCCAGAACTTTCAG

CCAAGTGGTTCAAAGATGGTAGAGAACTATCTTCAGGCAGCAGACATCACATTACATTTGTCAGAAACCTGGCTTCCCTTAAGATCCCTTCTGCAGAAAT

GAATGACAAGGGCTTATATACCTTCGAGGTGGAAAACAGAGTTGGCAAAAGCAGCTGCACTGTGTCTGTCCATGTCTCAG ACCGAGTTGTTCCACCGTC

CTTCGTCCGAAGGCTTAAGGACACAAGTGCCACGCTCGGAGCTTCTGTGGTTTTGGAGTGTCGAGTGTCGGGCTCAGCCCCCATATCAGTCGGCTGGTTT

CTTGATGGAAATGAGATCATTAGCAGTCCCAAATGCCAGTCCAGCTTTGCAGATAACGTCTGCACTCTGACTCTGAGCTCCCTGGAGCCCTCTGACACTG

GCGCATACACCTGTGTGGCTGCCAATGTAGCCGGCCAGGATGAAAGCTCTGCAGTTCTGACTGTCCAAG AACCACCATCTTTTGAACAAACCCCTGACT

CTGTGGAAGTTTTGCCTGGAATGAGCCTGACATTCACCAGTGTCATTAGAGGCACCCCTCCCTTCAAGGTCAAGTGGTTTAAGGGCAGCAGGGAGCTGGT

GTCCGGGGAGGCTTGTACCATTTCTTTAGAAGACTTTGTCACTGAGTTGGAGCTCCTGGAGGTGGAGCCGGGGCAGAGTGGAGATTATTCTTGCCTGGTG

ACCAATGATGCCGGCAGTGCTTCCTGTACCACGCATCTCTTTGTGAAAG AACCAGCCACTTTTGTGAAAAGGTTGGCTGATACCAGTGTGGAGACAGGT

AGCCCCATCGTTCTGGAGGCTACTTACTCTGGCACACCACCTATCTCTGTGAGCTGGATGAAGAACGAATATCCTCTTTCACAGTCTCCCAACTGTGGCA

TCACCACAACAGAAAAATCTAGCATCCTGGAAATTCTTGAGAGCACAATAGAGGATTATGCACAGTACGCTTGCCTGATAGAAAATGAAGCCGGACAGGA

TATCTGCGAAGCTCTTGTGTCCGTCTTGG AACCACCTTACTTTATCGAACCCCTGGAACATGTGGAAGCAGCTATTGGAGAGCCCATAACTTTACAGTG

TAAAGTGGATGGAACCCCTGAGATCAGGATTTCTTGGTATAAGGAACATACAAAGCTACGGTCAGCTCCTGCATATAAGATGCAATTCAAAAACAACGTG

GCCTCCTTAGTCATCAACAAGGTGGACCACAGTGATGTGGGAGAGTACACCTGCAAGGCAGAAAACAGCGTGGGGGCTGTTGCTTCTTCTGCCGTGCTGG

TTATCAAAG AGCGTAAACTTCCACCTTCCTTTGCGAGAAAGCTGAAAGATGTCCACGAGACTCTTGGCTTCCCAGTTGCTTTTGAATGTCGAATCAATG

GCTCAGAACCTCTTCAGGTGTCTTGGTACAAGGATGGTGAACTTTTGAAAGACGATGCTAATTTGCAGATGTCTTTTGTTCATCATGTTGCCACTCTTCA

GATTTTGCAAACTGACCAGAGCCACGTTGGTCAGTATAACTGTTCAGCTTCTAATCCGCTTGGGACTGCTTCGTCCAGTGCTAAGCTCATTCTCTCAG A

ACATGAAGTGCCTCCCTTCTTTGACTTAAAGCCTGTGTCAGTAGACCTTGCTCTTGGTGAAAGTGGTTCTTTTAAATGTCATGTCACTGGAACAGCACCG

ATCAAAATCACCTGGGCTAAAGATAACCGTGAGATTCGCCCTGGAGGCAACTACAAGATGACTCTGGTGGAAAATACTGCCACTCTGACGGTGCTCAAAG

TAGCCAAAGGTGATGCTGGACAGTATACCTGCTACGCGAGCAACGTGGCTGGAAAGGACTCTTGTTCTGCTCAACTTGGTGTACAAG AACCCCCCAGGT

TCATTAAAAAGCTAGACCAATCACGGATCGTGAAGCAGGATGAGTATACAAGATACGAGTGCAAAATAGGCGGGTCTCCAGAAATCAAGGTTTTGTGGTA

TAAGGATGAGGTGGAGATTCAAGAAAGCAGTAAATTCCGGATGTCATTCGAGGACTCGGTGGCCATCCTGGAGATGCACAGTCTCAGTGTGGAAGACAGC

GGGGACTACACCTGTGAGGCTCGCAACGCAGCAGGGAGCGCCAGCAGCAGCACCTCCCTGAAGGTTAAAG AACCACCCGTGTTCCGCAAAAAGCCTTTT

CCGGTTGAGACACTTAAAGGAGCCGATGTTCACCTTGAGTGTGAGCTTCAGGGGACACCTCCCTTTCAAGTTTCTTGGCACAAAGACAAGCGAGAACTTA

GGAGTGGGAAGAAGTACAAGATTATGTCTGAGAATTTGCTCACGAGCATCCACATCCTGAACGTAGACACGGCAGACATTGGGGAATACCAGTGCAAAGC

CACAAACGATGTTGGGAGTGATACCTGTGTGGGCTCTGTCACTATGAAAG CACCACCACAATTTGTGAAGAAGCTCACCGACATTTCTACCATCATTGG

CAAAGAAGTCCAGCTGCAGACAACAATTGAAGGCGCTGAGCCAATTTCAGTGGCGTGGTTCAAAGACAAAGGGGAAATTGTTAGAGAGAGTGACAACATA

TGGATTTCTTACTCTGAAAACATCGCCACCCTCCAGTTTTCAAGAGCAGAACCAGCCAATGCTGGGAAATACACCTGCCAGATCAAAAACGATGCTGGGA

TGCAGGAGTGCTACGCCACGCTATCAGTGCTCG AGCCTGCTGCAATTGTGGAAAAGCCAGAATCTATTAAGGTGACCACAGGAGACACCTGTACCTTGG

AGTGCACGGTATCAGGAACACCTGAGCTTAGTACCAAGTGGTTTAAGGACGGAAAGGAGCTCACGAGTGACAACAAATATAAAATAAGCTTCTTCAACAA

GGTGTCTGGCCTCAAGATCATCAATGTGGTGCCTGGCGACAGTGGGGTGTACAGCTTTGAAGTGCAAAACCCTGTCGGCAAAGACAGCTGCAAAGTCTCC

ATTCAAGTCTCAG ATCGAATCATCCCTCCCTCGTTCACAAGAAAACTGAAAGAGACGAACGGTCTGTCGGGCTCCTCCGTGGTGATGGAGTGCAAAGTG

TACGGATCACCCCCAATCTCTGTCCTGTGGTTCCATGACGGGAATGAGATCAGCAGTGGCCGGAAGTACCAGACCACACTGACAGACAACACGTGTGCCC

TGACGGTGAACATGCTGGAGGAAGCTGACGCCGGCGACTATACATGTATAGCTACCAATGTGGCAGGCTCCGACGAGTGTAGTGCCCCTCTGACTGTACG

AG AGCCACCATCTTTTGTTCAGAAACCTGACCCGATGGATGTCTTAACTGGCAGTAATGTCACGTTCACAAGCATTGTCAAAGGCTCACCTCCTTTCAC

TGTCAGCTGGTTCAAAGGTAGCACTGAGCTTGTGCCTGGGGCCAGGTGCAACGTGTCTCTGCAGGACTCGGTGGGTGAACTGGAGCTGTTTGACGTGGAT

ACGTCCCAGAGCGGAGAATACACCTGCATAGTTAGTAACGAGGCTGGCAGGGCTTCCTGCACAACACGTCTCTTCGTAAAAG CCCCAGCCATATTTGTG

AAGCGACTCAATGACTACAGCATAGAGAAAGGCAAGCCTCTGATCCTTGAAGGGACCTTCTCTGGAACTCCTCCGATCTCTGTTACATGGAAGAAAAATG

GCATAAATGTCATAGCTTCCCAACGGTGTAATATTACCACAACTGAAAAATCAGCCATCCTAGAAATTCTGAGCAGCACTGTCGAAGATTCAGGGCAGTA

CAACTGCTACATTGAAAACGCTTCTGGCAAGGACTCCTGCTCGGCCCAGATCCTGATTCTAG AACCACCGTATTTTGTCAAGCAGTTGGAGCCTGTGAA

GGTGACGGTTGGTGACTCTGCCTCTCTACAATGCCAGCTTGCTGGAACTCCCGAGATTGGGGTCTCCTGGTATAAAGGAGACACAAAGCTCAGGCCCACT

GCCACCTGCAAAATGCATTTTAAGAACAACGTTGCGACACTGGTTTTCACCCAGGTTGATAGCAGCGACAGCGGAGAATATATCTGCAGGGCTGAGAACA

GTGTAGGCGAGGTTTCTTCATCAACTTTCCTGACTGTTCAAG AGCAAAAACTTCCACCATCCTTTTCTCGACAACTAAGAGATGTGCAAGAGACCGTGG

GATTGCCAGTGGTTTTTGAATGTGCTGTAAGTGGGTCCGAGCCCATCTCTGTGTCTTGGTACAAAGATGGCAAGCCGTTGAAAGACAGCCCAAATATACA

AACATCATTTTTAGACAACATCGCCACTCTGAACATCTTTAAGACAGACAGGAGTCTCTCGGGCCAGTACTCTTGCACTGCTACAAACCCCATTGGCTCT

GCTTCTTCAGGCGCCAAACTCATCCTCACAG AGGGGAAGAACCCACCCTTCTTTGATATCCCTCTGGCCCCTATGGATGCTGTTGTGGGAGAAAGTGCT

GACCTGGAATGCCATGTCACGGGAACACAGCCCATTAAGGTAACCTGGGCCAAGGACAACAGAGAGATACGAAGTGGTGGAAACTACCAGATCAGCTATC

TGGAAAACAGTGCCCACCTGACCATCGTGAAAGTGGACAAAGGTGACTCTGGCCAGTACACCTGCTACGCCGTCAATGAAGTGGGAAAAGACTCCTGCAC

AGCCCAACTCAATATAAAAG AGCGCCTCATCCCACCGAGTTTCACCAAAAAACTATCTGAGACGGTAGAAGAGACAGAAGGGAACTCATTCAAACTGGA

AGGGCGTGTGGCAGGGTCCCAGCCCATCACCGTTGCTTGGTACAAAAATAATGTAGAGATCCACCCGACCTCCAACTGTGAGATCATGTTCAAGAACAAC

GCACTGCTGCTGCAGGTGAAGAGGGCCAGCATGGCCGATGCAGGCTTATACACCTGCAAGGCGACAAATGACGCAGGCTCTGCCCTGTGCACATCGTCCA

TTGTCATCAAAG AGCCTAAGAAGCCGCCTGTGTTTGACCAGCACCTTGCCCCGGTCACGGCCAGCGAAGGTGACTCTGTACAGCTCAGCTGCCACGTGC

AGGGCTCCGAGCCCATTCGGATCCAGTGGTTGAAAGCTGGTAGGGAGGTAAAGCCTTCGGACAGGTGCAGCTTCAGCTTTGCTAGCGGAACCGCCATGCT

GGAACTCAAGGAGACAGCTAAAGCAGATTCAGGAGACTACGTGTGTAAGGCTTCCAACGTGGCTGGAAGTGACACTTCAAAGTGCAAAGTGACCATTAAA

G AGAAACCAGCCGCAGCCCCAGCAGCCAAGAAAGCAGCCGTGGATGGAAAACTCTTCTTCGTGTCAGAGCCTCAGAGCATCAGAGTAGTGGAAA AAAC

CACTGCCACGTTTATTGCAAAAGTTGGAGGTGACCCGATCCCGAATGTCAAATGGACAAAAGGGAAGTGGAGACAGCTGAACCAAGGGGGTCGCATTCTT

ATCCATCAAAAGGGCGACGAAGCGAAGCTGGAGATTCGTGACACCACAAAAACCGATTCTGGCTTATACCGTTGCGTTGCCTTTAACAAGCACGGTGAAA

TTGAAAGCAATGTCAACCTACAGGTGGATGAAAGAAAGAAACAAGAGAAGATTGAAGGTGATCTTCGCGCGATGCTGAAAAA GACTCCAGCCCTCAAGA

AAGGATCTGGGGAAGAAGAGGAAATTGATATCATGGAACTTCTCAAAAATGTGGATCCTAAAGAGTATGAGAAGTATGCGCGCATGTACGGAATCACCGA

CTTCCGGGGCCTCCTCCAAGCGTTTGAGCTGCTGAAACAGAGCCAGGAAGAAGAGACTCACAGACTG GAAATCGAGGAACTAGAGAAGTCAGAAAGAGA

TGAAAAGGAATTCGAAGAACTTGTAGCATTTATTCAGCAAAGGCTGACACAGACAGAG CCTGTCACTTTGATCAAGGATATTGAAAATCAGACAGTTCT

GAAAGATAATGACGCCATCTTTGAAATTGACATTAAGATTAATTATCCAGAAATCAAGCTTTCCTGGTACAAAGGGACTGAAAAGCTGGAGCCCAGTAAC

AAATATGAAATAAGCATCGATGGTGACCGGCACACACTCAGAGTCAAAAACTGTCAGCCTAAAGATCAGGGCAATTACCGTCTGGTCTGTGGTCCCCACA

TCGCTAGTGCCAAGCTAACTGTGATTG AGCCCGCCTGGGAGCGGCATCTCCAGGACGTTACTCTGAAGGAAGGCCAGACTTGTACCATGACGTGTCAGT

TTTCTGTACCAAATGTGAAATCTGAGTGGTTCAGAAATGGCAGAGTCCTTAAACCTCAAGGCAGAGTGAAAACGGAAGTGGAACACAAAGTCCACAAGCT

GACCATTGCCGATGTCCGTGCAGAGGACCAGGGTCAGTACACCTGCAAGCACGAAGACCTCGAAACTTCAGCAGAGCTCAGAATCGAAG CCGAACCCAT

TCAGTTTACAAAGCGCATACAGAACATCGTGGTGAGCGAGCATCAGTCTGCTACTTTCGAGTGCGAAGTGTCCTTTGACGACGCCATAGTTACCTGGTAC

AAAGGACCAACAGAGCTGACTGAGAGCCAGAAATACAACTTTAGAAACGACGGCCGCTGCCATTACATGACAATCCACAATGTGACCCCAGATGACGAAG

 GTGTCTATTCAGTAATTGCTCGGCTGGAGCCAAGAGGCGAAGCAAGAAGCACAGCGGAACTGTACTTAACAACCAAAG AAATAAAACTTGAGATGAAG

CCTCCTG ATATTCCCGATTCCAGAGTTCCAATCCCAACCATGCCCATCAGAGCTGTCCCACCGGAAG AAATCCCTCCTGCGGTTGCTCCTTCCATCCC

TCTTTTGCTGCCATTACCTGAAGAGAAGAAGCCGCCAGCAAAACGAATTGAAG TGACCAAAAAGGGTGTGAAAAAAGATACCAAAAAAGTTGTCACAAA

GCCCAAAGAAGAGGCCCCACCACCACCAG TTGCCAAGAAGCCTCCACCTCCTACTCCCATGATTCCAGCAAAAG CTTCTGAGATTATTGACGTGTCCT

CTAAGGCTGAAGAGGTAAAAATAACAACCATCACCAGAAAGAAAGAGGTTCACAAAGAGAAAGAGGCTGTGTATGAACGAGAGGAAGCAGTCTACGAAAA

GAAAGTTCACATAGAGCCTTGGGAAGAGCCCTATGAGGAATTGGAAACGGAACCATACACAGAGCCATATGAAGAACCCTATTATGAAGAACCAGATGAA

GACTATGAAGAGATCAAGGTGGAAGCTAAAAAGCAAGTCCACGAGGAATGGGAGGAGGACTTTGAAGAAGGACAGGAGTACTATGAGAGAGAAGAGGGCT

ACGATGAAGGGGAGGAAGAGTGGGAAGAGATTTACCATGAAAGAGAAATAATTCAGGTTCAGAAGGAGGTTCATGAAG AATTACATGAGAAGAAAATCC

CAGCCAAAGTGCCTGAAAAGAAAGTACCACCTCCCAAAG TTGTAAAGAAGCCAGTAGTTGAAAAAGTTGAAAAGACTACTCGGAGAATGGAGGAAGAAA

AAGTTCAAGTCATCAAAG TACCTGAAGTTTCTAAGAAGATTGTTCCACAAAAACCTTCCCGGACTCCAGTGCAGGAAGAAATAATTGAAGTGAAAG TA

CCAGCTGTGCACACAAAGAAGATGGTTATCTCTGAAGAAAAGATGTTCTTTGCTTCTCACACAGAGGAAGAGGTGTCTGTCTCAG TCCCCGAGGTGCAA

AAGAAAACTGTCACTGAAGAGAAAATTCACGTTGCAGTTTCCAAAAAGATTGAACCACCACCCAAAG TCCCTGAACCACCTAAAAAGCCAGTTCCAGAA

GAAGTGGTCCCTGTTCCCATTCCTAAGAAGGTGGAACCCCCAGCAGCCAAAG TTCCTGAGGCTCCCAAGAAACCTGTGCCAGAGGAGAAAAAGCCAGTT

CCTATTCCCAAGAAGAAAGAGCCAGCTGCCCCTCCACAAG TCCCAGAGGCTCCAAAGAAACCTGCTCCCGAAGAAAAGATTCCTGTTCCTGTGACAAAG

AAGAAGGAAGCCCCTCCAGCTAAAG TTCCTGAAGTGCAGAAGAAGGTTGTCACAGAAGAAAAAATAGCCATCATTACTCAAAGAGAGGAGTCCCCTCCA

CCAGCAG TACCAGAAATACCAAAGAAGAAAGTTCCCGAAGAAAAAAGACCTGTTCCTAGAAAAGAGGAAGTCCCCCCACCAAAAG TGCCAGTGCCACC

TAAGAAAGCTGTTCCTGAGGCGGTTGTTCCAGCTCCCATCCCTAAGAAAGCTCCTCCCCGAG CTGAAGTTTCTAAGAAAACTGTTGTAGAAGAGAAAAG

ATTTGCTGCTGAAGAAAAACTATCGGTGGCAGTTCCTCAGAGAGTGGAACTCATGCGGCACGAAG AGGAGGAATGGACTTACTCTGAAGAAGAGGAAAG

AGTGTCTGTTTCGGTGTATAGGGAAGAGGAAAGAGATGAGGAGGAAGCAGAAATCACAGAGTATGAAG TGTTGGAAGAGCCCGAGGAATATGTTGTGGA

AGAAAAGATGCACTTTATCTCTAAGAAAGTGGAAGTTGAACCAGCCAAAG TGCCTGAGAAGAAAATTATACCAAAACCAAAAGTTCCTGCTAAAATTGA

GGAGCCTCCACCCACTAAAG TTCCCGAACCACCAAAGAAAATTGTACCAGAGAAGAAAGTTCCTGCACCAGCTCCCAAAAAGGTGCCGCCAGCCAAAG 

CCCCTGAAGAATCAAAGAGACCAGTTCCCGAGAAGAGGGCTCCTGCAGAAGAGGTTGGGATAGAAGAACCTCCCCCAACCAAAG TGGCCGAAAGGCACA

TGAAAATTACCCAGGAAGAAAAAGTTCTTGTGGCTGTAACTAAAAAGGAGGCGCCTCCGAGAGCGAGAG TGCCAGAGGAACCTAAGAAAGTTGCCCCTG

AAGAAAGATTTCCCAAGCTCAAACCTCGAAGAGAGGAGGAGCCACCAGCTAAAG TGACCGAAGTTAGAAAAAGAGCTGTTAAAGAAGAAAAGGTGTCCA

TTGAAGTTCCAAAGAGAGAACCCCGACCCACTAAAG AAGTGACTGTGACAGAAGAGAAGAAATGGTCTTACACCCGAGAAGAAGAAACTGTTTCAGAAC

ATCGGGAGGAGGAGTATGAGGATTACGAAGACTATGAGGAGTATAAAGAGTTTGAGGAGTACGAACCCACCGAAGAATATGACCAGTATGACGAGTATGC

AGAGCGTGAGGTGGAGCACTATGAAGAGCATGAGGAATACGTCACAG AACCCAAGAAGCCTGTCCCAGTGAAACCTGCCCAAGAACCGGTGCCTGCTAA

ACCCAAGGCTCCCCCACCAAAAG TGCTAAAGAAAGCTGTCCCTGAAGAAAAAGCACCCCTGCCCATTCAAAAGAAACTCAAACCTCTGCCACCCAAAG 

CTCCCGAAGAACCAAAGAAAGTTGTTGAAGAAAAAATACAGATTTCAATTACCAAACGTGAAAAGCAGCAGGTGACTGAACCGGTCGCCAAAG TGCCTA

TGAAGCCCAAGAGAGTTGTCCCAGAGGCAAAAATACCTGCCCCTACAAAGGAAGTGGCAGTGCCTGTTAGAG TGCCAGGGGTACCCAAAAAACGAGAAC

TGGAAGAGGTTGTTGTCTTCAAAGAGGAGGTGGAAGCCCATGAAGAATACATTGTAGAGGAAGAAGAGGAATATGTCCATGAAGAGGAGTATGTCCACAA

AGAAGAATATGTCCATGAAGAAGAGTACGTCCATAAAGAGGAATATATCCACGAAGAGGAAGAACACCTTCATGAAGAGGAGGAGACCATAGCTGAGGAA

GAGGTGGTGCCTGTGGCCCCAGTCAAAG TGCCTGTGGTACCCAAGAAACCTGTTCCAGAAGAGAAAAAACCTGTTCCTGTTCCCAAAAAGAAGGAAGCA

CCACCAGCCAAAG TGCCTGAGATTCCCAAGAAGCCAGAGGAAAAAGTTCCTGTGCCTATTCCTAAAAAGGAGAAGGCTCCACCTGCCAAAG TCCCGGA

AGTGCCCAAGAAGCCTGTACCAGAGGAGAAGCCACCAGTACCTGTTCCCAAAAAGGTGGAACCACCACCAGCCAAAG TGCCAGAAGTGCCGAAGAAACC

TGTGCCTGAGAAGAAGGTACCAGCGCCTACTCCTAAGAAAGTAGAGGCTCCTCCTGCAAAAG TGCCAGAGGTGCCCAAGAAACCCATTCCAGAAGAAAA

GAAACCAACAGCTCTTCTGAAAAAAATGGAAGCCCCACCCCCGAAAG CGCCAAAGAAACGGGAGGTAGTCCCAGTTCCTGTGGCTCTACCTCGGGAAGA

AGAAGAAGAAGAAGTGCCATTTGAGGAAGTTCCTGAAGAGGAAATTCTACCTGAGGAAGAAGTTCCATCTGAGGAGGAAGCTCCACCTGAAGAAGTTCCA

CCAGAGGAAGAGGAAGTTCTTCCTGAAGAAGAGGAAGTTCTTCCTGAAGAAGAGGAAGTTCTTCCTGAGGAAGAGGAAGTTCAACCTGAGGAAGAAGCTC

TTCCAGAGATTAAACCTAAGGTGCCAAAACCTGCACCAG TGCCAAAGAAAACTGTCCCTGAGAAGAAAGTCCCCGTTCCTGTTCCTAAAAAAGTGGAGC

CTCCACCACCTCCCAAAG TGCCTGAGATCAAGAAGAAAGTGCCAGAGAAGAAAGTAGTTGTTCCCAAGAAAGAGGAGGCTCCTCCCACCAAAG TTCCT

GAGGTGTCTAAGAAGGTGGAAGAAAGACGGATCATCCCCCCTAAAGAAGAGGAAGTTCCACCAGCTGAAG TATATGAGGAGGCTGAAGAACCCACTCCA

GAAGAGATTCCAGAAGAGCCGCCTAGCATAGAAGAAGAAGAGATAGTGGAGGAAGAGGAGGAGGAGGAGGAGGTGCTGCCACCTAGAG CACCTGAAGTG

GTGAAGAAAGCAGTACCCGAAGCTCCCACTCCTGTCCCTAAGAAAGCGGAGGCACCCCCCGCAAAAG TGCCAAAGAAAATCCCTGAGGAAAAGGTTCCC

GTGCCGGTCCAGAAAAAAGAGGCCCCACCAGCCAAAG TCCCAGAAAAGAAGAAAATCCCTGAAAAGAAAGTCCCTGTGCCCAAAAAGGAAGCTGTTCCA

CCGGCTAAAG GGAAAGCTGTTTTTGAAGAAAAAATATCAGTTGCCTACCAGCAAGAAGAACTAGTCCAAGAAAGAATAGAGCTAGAACTCGTGGAAGCC

AAAGTGGAAGAGGCTTTCGAAGAAGAGGAGTTCCACGAGGTGCAGGAATACTTTGAGGAAGAGGAGTTCCACGAGGTGGAGGAGTTCATCAGGGTGGAAG

AGCGCAGGTTCCAAGAAGAGCACAAAGTGGAAGAAGTCCACAGGGTCATTGAGTTCCTAGAGGCTGAAGAAGTGGAAGTATACGAAAAGCCCAAAATTCC

ACCTAAAAAAG GACCTGAGGTATCTGAGAAAGTCATCCCTCCAAAAAAGCCACCCACTAAAGTCATTCCTCGAAAAGAGCCACCAGCTAAAG TACCTG

AGGTGACCAAGAAAACGGTGGTTGAAGAAAAAATCCGTGCTCCTGAAGAACCGAAGGTGCCGGCACCTAAAG CACCCGAAGTACCAAAGAAAATCACTC

CAGAAGAAAAAGTCCGTGAAGCTGTTCCTAAAAAGCCTGAAGTTCCACCACCTAAAG TTCCTGAGGTGCCTAAGAAAATTATTCAAGAAGAAAAATTAC

CCGTTGTTCTTCCTGAAGACACAGAGATATACA TGTATGAAGCATCTGAAGAGACAGTCATAGAAGAAGAGCATGTCACTCTTCCGCAGAAGGCAAGAC

TCAAAGTGGCAAAAG TGCCTGCACCACCCCAAACAGTTGTTACAGAAGAGAAAACTTATGTGACCATTCGTAAAACGAGGGAAACCCTGGCACTCAAAG

 AGTCTGAAACAACCCGGGAAGCGTTTCCAGAGCTGAAGTCATATAAGGCTGTCCCTGAAATTCCTGAGCCTCCTTCACCTGAAG ACCTTGAAATCATT

GAAGATGTGCTTCCGGAGAAGCGACCTCCTGCATCCAAAAGAAGAAAAACTCAACTCCCGACAG CACCAGAAGCTCCGAGAGAGATGCCTCCTGAAATG

AACACCTTTGAAGAAATTTCTGTAGAGCCAGAAATGCTGCCCACCCAAG TGCTGGACACTTACCAAGAAGCCACGGTGGAGAAGAAAACACTTCGGATT

TCTCGCAAAAAGCCTGAGCTTCCTTCAGATGAAGAAG TGCCCGAGGCTCCCAGAGAAGTTGTGGCCAAAAAGAAAGTGCTCCCTCCCCAAGTGCCGGAA

GTTGTACCTGTGAAAG TGCCTGGGGCTCCTAAAGAGGTTGTCTCTGAAAGGAAATCGCTTGAGGAACCACCTAAAAAGCCAGCAGTCCGGCCAGTCACA

G TGCCCGAGGAGCCCAAAGAGGTCATCCCTGAAAAGAAAGTGTCCCTGGTGCCTCCTAAAAAGCCAGCAGCCCCACCTGTCACAG TGCCTGAGGCACC

TGAAGAGGTCTTCTCTGAAGACGAAGAGACCCTGGCACCCCCTCAAGAGCCAGAGGCCCCACCTGCCAAAG TGCCAGAGGCTCCCAAAGAAGTTGTTCC

TGAAAAGAAAGTCTCCGTGGTGCCTCCCAAAAAGCCAGAAGCCCCACCTGCCAAAG TGCCAGAGGCACCCAAGGAAGCTGCCCCTGAGAAGAAAGTGCC

AGTGGCACCTAAGAAAAAGCCAGAAGCCCCACCCGTGAAAG TGCCAGAGGCACCCAAGAAAGTTGTCCCTGAGAAGAAACTGCCAGTAGCAGCTCCTAA

AAAGCCTGAAGCCCCAGCTGCTGAAG TACCCGAGGTGCCAAAGACAGCTGTTCCCCAAAAGAAGATCCCTGAGGCCATTCCCCCCAAACCGGAAAGTCC

TCCCCTTGAAG TGCCTGAAGTACCACCCAAGGAAGTCACTCCTGAAAAGAAAGTTCCAGCAGCACCTCCCACGAAGCCAGAAATTCCACCTCCCAAAG 

TACCTGAAGCTCCTCAGGCAGCTGTTGTTGAAGAGAAAACCCCTGAGGCACTGCCCAAAAAGGCGGAAGCCGCCCCTGTCCCAG TGCCTCAAGTCCAAG

AGACTGTCCCTGAAAAGACAAGACCAGTGGGACCTCCTAAAAAGCCAGAAGCCACAACTGTCCCAG TGCCCAAAGTCCAGAAAACTATCCCTGAAAAGA

CAAGACCAGAGGCCCCTCCTAAAAGGCCAGAAGCCAGGACTGTCCCAG AGACTGTCCCAGAAAAGACAAGACCGATGGCTCCTCCTAAAAAGCCAGAAG

CCACAACTCTCCCAG TGCCTGAAGTCCAAGAGACTGTCCCTGAAAAGACAAGACCAGTGGGACCTCCTAAGAAGCCAGAAGCCACAACTGTCCCAG TG

CCTGAAGTCCAAGAAACTATCCCAGAAAAGACAAGACCTCCTAAAAAGCCAGAAGCCACACCTGTCCCAG TGCCTGAAGTCCAAGAGACTGTCCCTGAA

AAGACAAGACCAGTAGGACCTCCTAAGAAGCCAGAAGCCACAACTGTCTCAG TACCTGAAGTCCAAGAAACTATCCCTGAAAAGACAAGACCAGCGGCC

CCTCCTAAAAAGCCAGAAGCCACAGCTGTCCCAG AAACTATCCCTGAAAAGACAAGACCAGAGGCCCCTCCTAAAAGGCCAGAAGCCACAACTGTCCCA

G TGCCTGAAGCTGATCAAGCAGTTGTCCCAGAAAAGAAAGTCCCCAGGGTCCCGCCCAAAAAAGTTGAAGCCCCACCTATTACAG TGCCTGAGGAACC

TAAAGAGGTCATCCCTGAAAAGAAAGTGTCCCTGGTGCCTCCTAAAAAGCCAGCAGCCCCACCTGTCACAG TGCCTGAGGCACCTGAAGAGGTCTTCTC

TGAAGACGAAGAGACCCTGGCACCCCCTCAAGAGCCAGAGGCCCCACCTGCCAAAG TGCCAGAGGCTCCCAAAGAAGTTGTTCCTGAAAAGAAAGTCTC

CGTGGTGCCTCCCAAAAAGCCAGAAGCCCCACCTGCCAAAG TGCCAGAGGCACCCAAGGAAGCTGCCCCTGAGAAGAAAGTGCCAGTGGCACCTAAGAA

AAAGCCAGAAGCCCCACCCGTGAAAG TGCCAGAGGCACCCAAGAAAGTTGTCCCTGAGAAGAAACTGCCAGTAGCAGCTCCTAAAAAGCCTGAAGCCCC

AGCTGCTGAAG TACCCGAGGTGCCAAAGGCAGCTGTTCCCCAAAAGAAGATCCCTGAGGCCATTCCTCCCAAACCAGAGAGTCCTCCCCCTGAAG TGT

ATGAGGAACCTGAAGAGGAGATTGTCCCAGAAGAGCCTCCAGAGGAGGCTGTGGAAGAACCAGTGCCAGCTCCCCCTCCAAAAG TGACAGAGCCACCTA

AGAAGCCTGTCCCTGAGAAGAAAGCGCCTCCTGCTGTTGTCAAGAAACCTGAACCCCCACCAGCGAAAG TGCCTGAAGTGCCTAAGGAAGCTCCCCCTG

AAAAGAAAGTGCCTCCCAAAAAGCCAGAAGCCCCACCTGCTAAAG TGCCAGAAGTTCCGAAAGAAGTTGTCACAGAAAAGAAAGTGGCTGTTCCCAAAA

AGCCAGAAGTCCCGCCAGCCAAAG TGCCAGAGGTGCCAAAGAAACCTGTCATTGAAGAGAAGCCAGCCATTCCTGTTGTTGAGAAAGTGGCGTCCCCTC

CTGCTGAAG TATATGAAGAACCGGAAGAAGTCACTGCTGAGGAAGAGGAGCCAGCCCCTGCTGTAGAAGAGGAGGAATACGAAGCTCCCCCTCCCCCTG

CACCAG TGCCTGAAGAGCCTAAGAAGGTTGTCCCAGAGAAGAAATTTCCTGTCATCAAAAAACCAGAGGCTCCCCCTCCTAAAG TACCTGAGGTGCCA

AAGAAAGCTGTGCCCGTGAAGAAAGTTCCGGTTGTTAAGAAGCCAGAACCACCAGAAGCTGAAG TCCCCGAGGTGCCGAAGAAACTTGTTCCAGTCAAG

AAGGAACCTGTGCCTGTTACCAAAAAAACAGAAGTCCTGCCAGAAAAAG TACCGGAAGCACCCAAGAAAATTACCCCAGAAAAGAAAGAGTCTGTTCCC

GTGCCTGAAGAGCCAGAGGCCCCTCCTGCCTCAG TGGAAGAGACTCCTGAGGAGACAATCTATGAAGAGAAAGCAACCATTACCATTGGTAGAAAAGAG

ACGCCCCCTGTTGAAG AACGCGAAATTGAAAAGTTTATTCAACCTGAAGAACCCGAACTGGAACCAGAGCCAGAAGAAATCCCAGTACAAG AACCTGA

GCCAGAGAAGAAGGTTATCGAGAAACCAAAACTCAAACCAAGACCCCCTGCACGTCCTCCTTCTCCACCTAAGGAAGATGTGAAGGAGAAAATGTTCCAA

CTTAAAG - UNI36362 - CTGTTTCAAAGAAGAAAGTTCCTGAAAAACCCGAGGTTGTGGAAAAAGTGGAGCCTGCACCACTAAAAG - UNI3636

2 - TGCCTACAGCTGAAAAGAAAGTTCGTAAATTACTTCCTGAACCTAAGCCGCAGCCAAAGGAAGAGGTGGTGCTGAAAAGCG - UNI36362 - T

TCTAAGAAAGAAACCCGAGGAAGAAGAACCTAAAGTAGAACCTAAAAAAGTAGAAAAAGCTAAAAAACCGGAAG AGCCACAGCCACCTCCAAAAGCCGT

TGAAGTTGAAGCTCCTCCAGAGCCTACACCAAAGGAAAGGAAAGTTCCAGAACCGGCCAAAG - UNI17655 - TTCCTGAAATTAAGCCAGCGATAC

CTCTCCCTGGACCTGAACCAAAGCCAAAGCCTGAGCCAG - UNI17655 - AGGTGAAAACCATGAAAGCTCCACCCATCGAGCCGGCACCCACTCCC

ATCGCTGCCCCCGTGACAGCGCCTGTGGTTGGGAAGAAAGCAG AAGCCAAACCTAAGGATGAGGCTGCCAAGCCAAAAGGTCCCATCAAAG GTGTAGC

CAAAAAGACTCCTTCACCAATAGAAGCTGAAAGGAAAAAGCTCAGACCAGGAAGCGGTGGAGAGAAACCTCCAGACGAAGCTCCGTTCACTTACCAACTC

AAGGCCGTGCCACTGAAATTCGTGAAAGAAATCAAAGACATCGTTTTGACAGAGGCAGAGTCTGTGGGCTCTTCTGCCATCTTCGAATGTTTGGTCTCCC

CATCCACTGCCATTACAACCTGGATGAAGGACGGCAGCAACATCCGTGAGAGCCCAAAGCACAGATTCATTGCAGACGGCAAAGACAGGAAGCTGCACAT

TATCGACGTTCAGCTGTCTGATGCTGGTGAATACACCTGTGTGCTACGCTTGGGAAATAAAGAGAAGACGTCCACTGCTAAGCTCATCGTAGAAG AACT

TCCTGTGCGCTTTGTGAAAACACTGGAGGAGGAAGTCACGGTGGTCAAGGGGCAGCCGTTGTACTTGAGCTGTGAGTTGAACAAAGAACGCGATGTGGTC

TGGAGGAAGGATGGTAAGATTGTGGTGGAGAAACCTGGCAGGATCGTGCCTGGTGTCATTGGCCTGATGCGGGCCCTGACCATCAATGATGCTGATGACA

CTGATGCCGGAACATACACTGTGACTGTGGAAAATGCCAACAACCTGGAATGTTCTTCTTGTGTAAAAGTAGTAG AAATCATTAGAGAATGGCTTGTGA

AACCTATCCGAGATCAGCATGTGAAGCCCAAGGGAACAGCTGTTTTCACCTGTGACATAGCCAAGGACACGCCAAACATTAAGTGGTTCAAAGGCTATGA

CGAGATCCCCTTGGAACCAAACGACAAGACTGAGATACTGAAAGAGGGAAACCACCTCTTTCTCAAGGTTAAGAATGCTATGCCAGAAGATATTGATGAG

TATGCAGTGGAAATTGAAGGGAAAAGATACCCAGCAAAGCTGACACTTGGAG AGCGCGAAGTTGAGCTACTTAAGCCGATAGAAGATGTCACCATTTAT

GAGAAGGAAAGTGCCAGCTTTGATGCAGAAATCTCAGAGGAAGACATTCCTGGGGAGTGGAAGCTGAAGGGCGAGCTTCTGCGGCCCTCGCCT ACTTGT

GAAATCAAAGCTGAAGGTGGGAAGCGCTTCTTAACTTTGCACAAAGTGAAACTGGACCAAGCTGGCGAAGTCCTCTACCAGGCTTGCAATGCGATCACAA

CTGCCATTCTGACAGTCAAAG AAATCGAGCTTGACTTTGCTGTACCCCTGAAGGATGTGACTGTCCCAGAGAAGAGACAGGCTCGGTTTGAATGTGTCC

TCACCAGAGAGGCAAATGTCATATGGTCTAAAGGGCCTGATATAATCAAGGCATCTGACAAATTTGATATTATTGCTGATGGAAAGAAACACATTCTTGT

TATCAACGACTCTCAGTTTGACGATGAAGGAGTCTATACTGCAGAGGTGGAGGGCAAGAAGACGTCAGCACAATTATTTGTGACAG GCATAAGACTTAA

GTTCATATCACCACTGGAAGATCAAACAGTAAAAGAAGGCCAAACAGCAACTTTTGTCTGTGAGCTCTCTCATGAAAAAATGCACGTGGTCTGGTTCAAA

AACGATGTCAAGCTACACACAACCAGGACAGTGCTCATGTCTTCTGAGGGAAAGACTTATAAGCTGGAGATAAGGGAGACCACACTGGATGATATCTCAC

AGATCAAAGCTCAAGTGAAGAACCTCAGCTCTACAGCCAACCTGAAGGTCTTGG AGGCCGATCCCTACTTCACCGTGAAATTACACGACAAGACTGGCG

TGGAGAAGGACGAGATCATTCTTAAGTGTGAAGTGAGCAAAGATGTTCCGGTCAAATGGTTCAAAGACGGGGAAGAGATTGTGCCTTCGCCCAAACATTC

TGTCAAGACCGACGGCCTGCGCCGCATCTTAAAGATCAAGAAGGCAGAGCTCAAAGACAAAGGGGAATATGTGTGCGACTGCGGTACAGACACCACCAAG

GCCAACGTCACTGTTGAGG CTCGACTCATAAAAGTGGAGAAACCCCTGTACGGCGTGGAAGTGTTTGTGGGTGAAACCGCCCGCTTTGAAATTGAACTG

TCTGAACCTGACGTGCATGGCCAGTGGAAGTTAAAGGGAGAGCCTTTGACTGCTTCTCCT GACTGCGAAATCATCGAAGATGGGAAGAAACATGTCTTG

GTTCTGTATAACTGTCAGCTGGATATGACCGGGGAGATATCCTTCCAGGCCGCCAACGCTAAATCAGCAGCCAACCTGAAAGTGAAAG AACTGCCGCTC

ATTTTCATCACCCCTCTGAGTGACGTCAAAGTCTTTGAGAAAGATGAGGCGAAGTTTGAGTGTGAAGTATCCAGGGAGCCCAAAACATTCCGCTGGCTGA

AAGGAACCCAGGAAATCACTGGTGATGACAGATTTGAGCTCATCAAGGATGGCACCAGGCATTCATTGGTGATCAAGTCAGCAGCTTTTGAAGATGAGGC

CAAATACATGTTTGAAGCTGAAGATAAACGCACAAGCGGCAAACTGATCATTGAAG - UNI35827 - GAATCCGTCTCAAATTCCTGACCCCACTCA

AGGATGTGACAGCCAAAGAAAGGGAAAATGCCGTGTTTACTGTGGAGCTGTCCCATGACAACATCCCAGTGAGCTGGTTCAAGAACGACCAGCGCCTGCA

CACCAGCAAGCGGGTCTCCATGCATGATGAAGGGAAAACACACTCCATCACGTTCAAAGACCTGTCTATTGACGACACCTCCCAAATTAGAGTGGAGGCC

ATGGGGATAAGTTCAGAGGCTAAGCTCACTGTGCTGG - UNI35827 - - UNI35899 - AGGGAGACCCATACTTCACAGGAAAGCTTCAAGATT

ACACAGGCGTGGAGAAGGATGAAGTGATTCTTCAGTGTGAAATCAGCAAAGCAGACGCACCCGTGAAATGGTTTAAGGACGGGAAGGAAATTAAGCCGTC

TAAAAACGTTGTTATCAAGGCTGACGGCAAGAAACGCATGCTGATCCTGAAGAAGGCCTTGAAATCAGATATCGGCCAATATACCTGTGACTGTGGGACA

GACCAGACCTCTGGGAAGCTGGACATTGAAG - UNI32138 - - UNI35827 - - UNI35899 - ATCGGGAAATTAAACTGGTGCGACCCCTG

TACAGCGTGGAGGTGATGGAGACCGAGACGGCCCGCTTTGAAACTGAGATCTCTGAAGATGATATACATGCCAACTGGAAACTGAAGGGAGAGGCACTGC

TCCAAACACCT - UNI32138 - - UNI33036 - - UNI35899 - GAATGTGAAATTAAAGAAGAAGGCAAGATCCACGTCCTTATCTTACACA

ACTGCCGCCTAGACCAGACTGGAGGTGTAGATTTCCAAGCTGCCAATGTCAAATCTAGTGCCCACCTCCGAGTTAAAC - UNI32138 - - UNI325

41 - - UNI33036 - CACGGGTAATTGGTCTGCTGAGGCCTCTAAAGGATGTTACAGTGACCGCAGGGGAAACGGCCACCTTTGACTGCGAGCTCTC

CTATGAGGATATCCCAGTGGAATGGTACCTCAAAGGGAAGAAGCTGGAGCCTAACGATAAG - UNI14991 - - UNI16643 - - UNI32541 -

 - UNI33036 - GTGGTGACACGTTCAGAAGGAAGAGTTCACACGCTCACCCTGAGGGATGTGAAGCTAGAAGATGCTGGCGAAGTCCAACTAACTGC

AAAGGATTTCAAAACTCAGGCCAATCTCTTTGTGAAAG - UNI14991 - - UNI16643 - - UNI32541 - AACCCCCGGTTGAGTTCACTAA

GCCTCTTGAGGACCAGACGGTCGAAGAGGAGGCCACTGCAGTACTGGAGTGTGAAGTATCCAGAGAAAATGCCAAAGTGAAATGGTTCAAAAATGGGACA

GAAATCCTCAAAAGCAAGAAGTATGAAATCGTTGCTGATGGCAGGGTCAGGAAGCTCATTATTCATGGTTGTACCCCAGAGGATATCAAAACGTACACTT

GTGATGCTAAAGATTTTAAGACCTCCTGTAACCTGAATGTTGTTC - UNI14991 - CTCCTCATGTGGAATTCTTAAGACCACTCACAGACCTCCAA

GTCAAAGAAAAAGAAACTGCTCGGTTCGAGTGCGAAATTTCCAAAGAAAATGAGAAG GTTCAGTGGTTTAAAGATGGTGCTGAAATTAAAAAGGGCAAA

AAGTATGACATCATTTCTAAGGGAGCAGTACGAATTCTTGTCATCAACAAATGTCTACTGAATGATGAAGCAGAATATTCCTGTGAAGTGAGGACAGCAA

GAACTTCCGGCATGCTGACAGTCCTAG AAGAAGAAGCTGTCTTCACAAAAAATCTTGCCAACCTTGAAGTTAGTGAAGGAGACACTATCAAACTGGTGT

GTGAAGTCTCCAAGCCTGGGGCAGAAGTGATTTGGTACAAAGGGGATGAGGAGATCATCGAAACAGGGAGATTTGAAATACTTACTGATGGAAGGAAGAG

AATCTTGATCATTCAGAATGCGCAGCTTGAGGATGCAGGCAGCTACAACTGTCGACTCCCAAGTTCTCGAACGGACAGCAAAGTCAAAGTACACG AACT

TGCTGCTGAGTTCATCTCGAAGCCTCAAAACCTTGAAATTCTTGAAGGAGAAAAGGCTGAGTTTGTCTGCACTATCTCAAAGGAAAGCTTCGAAGTTCAG

TGGAAGAGGGATGATCAGACACTTGAATCTGGAGATAAATATGACATCATTGCTGATGGCAAAAAGAGAGTCCTAGTTGTAAAGGATGCCACATTACAAG

ACATGGGCACTTACGTAGTCATGGTTGGGGCTGCCAGAGCCGCAGCTCACCTGACAGTCATTG AAAAACTCAGGATCATAGTTCCTCTTAAGGACACCA

AGGTGAAGGAACAACAAGAGGTTGTCTTCAACTGCGAAGTCAATACTGAAGGTGCCAAAGCCAAATGGTTCAGAAATGAAGAAGCCATATTTGATAGTTC

AAAATACATCATTCTCCAAAAAGACCTGGTCTACACCCTCAGAATCAGAGATGCACGGTTAGATGACCAAGCCAACTTTAATGTGTCTTTGACCAATCAC

AGAGGTGAAAATGTTAAAAGTGCAGCCAATCTAATAGTGGAAG AGGAAGATCTTAGGATTGTTGAACCTCTTAAAGATATTGAAACAATGGAGAAGAAG

TCAGTCACATTCTGGTGCAAGGTGAATCGTCTCAATGTGACACTGAAGTGGACCAAAAATGGAGAAGAAGTGGCTTTTGACAACCGTATATCATACCGAA

TTGATAAGTACAAACACTCTCTAATCATCAAGGACTGTGGCTTCCCAGATGAAGGTGAATACGTCGTCACTGCTGGGCAAGATAAATCCGTGGCAGAGCT

GCTCATCATAGAAGCCCCAACAGAATTCGTGGAGCACCTGGAAGACCAGACGGTCACAGAGTTTGATGACGCTGTCTTCTCCTGCCAGCTCTCCAGAGAG

AAAGCGAATGTAAAATGGTACAGAAATGGAAGAGAAATCAAGGAAGGCAAAAA ATACAAGTTTGAGAAGGATGGGAGCATCCACAGGCTCATCATAAAA

GACTGCAGGCTGGAGGATGAGTGTGAATACGCTTGTGGTGTAGAGGACCGCAAGTCCCGAGCTAGACTTTTTGTAGAAG AAATTCCAGTTGAGATTATC

AGGCCTCCTCAAGACATTCTTGAAGCCCCTGGTGCAGACGTTATCTTCTTGGCTGAGCTCAACAAAGATAAAGTGGAGGTCCAATGGCTTAGAAATAACA

TGATCGTCGTCCAGGGTGACAAGCACCAGATGATGAGTGAAGGAAAGATACACAGGCTACAGATTTGTGATATTAAGCCACGTGACCAGGGCGAATACAG

ATTCATTGCCAAAGATAAAGAAGCCAGGGCTAAACTTGAATTAGCAG CTGCACCTAAAATCAAGACAGCTGATCAAGATCTCGTCGTTGATGCTGGCCA

GCCTCTGACAATGGTGGTACCCTATGATGCCTACCCCAAAGCAGAAGCTGAATGGTTTAAAGAGAACGAACCTCTATCTACAAAAACCGTTGACACTACG

GCTGAGCAGACTTCTTTCAGAATCTCAGAAGCCAAGAAGGACGACAAGGGGAGGTATAAAATCGTGCTTCAGAACAAGCATGGGAAAGCAGAGGGCTTCA

TCAATTTACAAGTTATTG ATGTTCCCGGGCCAGTTCGTAACTTAGAAGTGACAGAAACATTTGATGGTGAAGTAAGCCTCGCCTGGGAGGAACCACTAA

CGGATGGTGGGAGCAAAATCATAGGCTATGTTGTTGAAAGGCGTGATATCAAGAGAAAGACCTGGGTTCTGGTCACTGACCGAGCGGACAGCTGTGAGTT

CACTGTCACTGGACTACAGAAAGGAGGAGTGGAGTACCTGTTCCGTGTGAGTGCAAGGAACAGAGTTGGCACTGGAGAACCCGTAGAAACTGACAGTCCT

GTAGAAGCAAGGAGTAAATATG ATGTTCCAGGCCCTCCTTTGAATGTAACCATCACCGATGTGAATAGATTTGGTGTCTCACTAACATGGGAGCCACCA

GAGTACGATGGAGGTGCTGAAATCACAAACTATGTGATTGAGCTGAGAGACAAGACTTCTATCAGATGGGACACTGCCATGACCGTAAGAGCTGAAGACC

TGTCAGCAACTGTCACTGATGTGGTTGAAGGACAGGAGTATAGTTTCCGTGTCAGAGCCCAGAACCGAATCGGAGTTGGGAAACCAAGTGCAGCCACACC

CTTTGTCAAAGTTGCTGATCCAATAG AGAGACCAAGTCCTCCTGTGAACCTAAACGCCTCAGAACAGACACAGTCATCAGTTCAGCTCACCTGGGAGCC

TCCTCTGAAAGATGGAGGCAGCCCCATACTGGGCTACATAATTGAAAGACGTGAAGAGGGAAAAGACAATTGGATTCGCTGCAATATGAAACCTGTCCCT

GAACTGACTTACAAG GTCACTGGATTGCAAAAAGGGAACAAATATTTATATAGAGTGTCTGCAGAAAATGCAGCTGGTGTTTCAGATCCATCTGAGATC

CTCGGTCCTCTCACTGCTGATGATGCGTTTG TTGAACCAACGATGGATTTAAGTGCATTCAAAGATGGTTTGGAAGTCATAGTTCCCAATCCCATCAAG

ATCCTGGTCCCAAGCACAGGCTATCCAAGACCAAAAGCAACCTGGACTTTTGGAGATCAAGTACTTGAAGAGGGGGATCGTGTGAAAATGAAGACCATAT

CAGCCTATGCCGAGCTTGTCATTTCTCCAAGCGAACGAACAGACAAAGGCATTTACACACTCACGTTAGAAAATCCTGTGAAGTCAATTTCTGGAGAAAT

CAATGTCAATGTAATTG CTCCTCCAAGTGCGCCCAAAGAACTGAAATTTAGTGATATAACAAAGGATTCTGTACATTTGACTTGGGAACCACCAGATGA

TGATGGAGGGAGTCCACTAACTGGATATGTTGTTGAAAAGAGAGACATGAGCCGGAAAACATGGACTAAA GTTATGGACTTTGTTACTGATCTAGAATT

CACAGTTCCTGATCTTGTTCAAGGAAAGGAGTATCTATTCAAAGTCTGTGCCCGAAATAAGTGTGGCCCTGGAGAACCTGCATATACTGATGAACCTGTA

AATATGTCTGCCCCTGCAA CGGTACCTGACCCACCAGAGAATGTTAAATGGAGAGACAGGACAGCCAACAGCATCTTCCTAACATGGGATCCTCCTAAA

AATGATGGTGGCTCTCGTATCAAAGGATATATAGTTGAAAAATGTCCACGTGGTTCTGATAAATGGGTTGCCTGTGGAGAACCTGTTCCAGATACAAA A

ATGGAAGTGACAGGTCTTGAGGAAGGCAAATGGTATGCCTACCGTGTGAAGGCCTTGAACAGGCAAGGTGCTAGCAAGCCAAGCAAACCCACTGAAGAGA

TCCAGGCGGTGGACACACAGG AGGCCCCTGAGATCTTCCTGGATGTGAAGCTCCTGGCTGGGATCACTGTGAAAGCTGGAACGAAGATCGAACTTCCCG

CCACGGTGACTGGAAAACCGGAACCGAAAATAACTTGGACCAAGGCTGACACCCTTCTGAAGCCAGACCAGAGAATCACCATTGAAAACGTTCCTAAAAA

ATCCACAGTGACAATCACAGACAGTAAGAGAAGTGACACAGGCACATATATCATAGAAGCCGTGAACGTCTGTGGCCGGGCCACTGCTGTGGTAGAAGTG

AATGTCTTAG ATAAACCTGGACCACCAGCTGCCTTTGACATCACAGATGTAACCAATGAGTCGTGTCTTCTGACCTGGAACCCACCAAGAGACGATGGC

GGGTCTAAGATCACAAACTATGTGGTGGAGAGAAAAGCAACAGACAGTGATGTGTGGCATAAGCTCTCATCAACCGTTAAGGACACAAACTTCAAGGCAA

CCAAATTAACACCCAACAAAGAGTACATCTTCAGAGTTGCTGCAGAAAATATGTATGGTGTTGGTGAGCCGGTTCAAGCTGCTCCAATAATAGCCAAATA

CCAGTTTG ATCCACCCGGACCTCCAACTCGCCTAGAACCTTCCGACATCACTAAAGATGCGGTGACGCTCACATGGTGTGAGCCAGATGATGATGGTGG

CAGTCCCATCACTGGATACTGGGTTGAAAGATTAGATCCTGACACTGATAAATGGGTTCGATGCAATAAGATGCCAGTGAAGGACACAACATACAG GGT

AAAAGGTCTCACCAATAAGAAAAAGTACAGATTCCGCGTGCTTGCTGAAAATTTGGCAGGGCCAGGAAAACCAAGTAGATCAACTGAACCAATCTTAATA

AAGGATCCCATAG ATCCTCCATGGCCCCCTGGAAAACCAACTGTAAAGGATATAGGCAAAACCTCCTTAGTATTGAACTGGACCAAGCCAGAACACGAT

GGAGGGGCAAAGATTGAGTCTTACGTCATTGAGATGCTAAAGACCGGAACAGACGAGTGGGTCAGGGTGGCTGAGGGAGTTCCGACCACTGAGCATTTGC

TCACAGGGCTAATGGAAGGCCAGGAATACTCATTCCGAGTGAGAGCCGTGAACAAGGCTGGAGAGAGTGAGCCCAGTGAACCCAGCGACCCTGTGCTTTG

CCGGGAGAAACTAT ATCCTCCATCACCACCTCGCTGGCTCGAAGTGATTAATATCACAAAAAATACAGCTGACCTAAAATGGACAGTTCCAGAGAAAGA

TGGAGGGTCACCCATCACCAACTACATTGTGGAAAAGAGAGATGTGAGACGGAAAGGCTGGCAAACAGTGGACACCACTGTCAAGGACACCAAGTGCACG

GTCACCCCACTGACAGAGGGGTCTCTGTATGTGTTCCGAGTTGCTGCAGAAAATGCCATAGGACAAAGTGACTACACAGAAATCGGAGATTCTGTCCTGG

CCAAAGACACCTTCA CCACCCCTGGACCACCCTATGCCCTGACAGTGGTTGATGTGACAAAACGACATGTTGACCTAAAGTGGGAGCCACCTAAAAATG

ATGGCGGAAGACCAATACAGAG ATACATCATTGAGAAGAAAGAAAAATTAGGTACCCGTTGGGTGAAAGCCGGGAAGACCTCAGGCCCTGACTGTAACT

TCAGAGTAACTGATGTCATTGAAGGAACAGAAGTCCAGTTTCAAGTTCGGGCAGAAAATGAAGCAGGAGTTGGTCACCCAAGTGAGCCCACAGAAATTCT

GTCAATCGAAGACCCAACAA GTCCTCCTTCACCTCCGCTTGATCTACATGTGACTGATGCTGGGAGAAAACACATTGCCATTGCTTGGAAACCACCAGA

GAAAAATGGCGGAAGTCCTATCATAGGCTACCATGTTGAAATGTGTCCAGTAGGCACAGAGAAATGGATGCGAGTTAATTCTCGCCCAATAAAAGATCTG

AAGTTCAAGGTTGAAGAGGGTATTGTTCCGGACAAAGAATATGTTCTGAGAGTGAGAGCTGTCAATGCTGTCGGTGTCAGTGAGCCATCTGAAATCTCCG

AAAACGTGGTCGCCAAAGACCCAGACT GCAAACCAACTATTGATCTAGAGACTCACGACATTGTTGTTATCGAAGGAGAAAAGTTAAACATCCCTGTGC

CCTTCAGGGCTGTCCCAGTGCCAACCGTGAGCTGGCATAAAGATGGCAAAGAAGTTAAAGCAAGTGACAGATTGACAATGAAGAACGACCACATCTCTGC

ACACCTCGAGGTTCCCAAGAGTGTCCATGCAGATGCTGGAGTGTACACCATCACCCTGGAGAATAAGCTCGGCTCAGCAACGGCTTCAATCAATGTCAAA

GTCATAG GTCTACCTGGTCCATGCAAAGATATTAAAGCAAGTGACATAACCAAAAGTTCTTGTAAGTTAACATGGGAACCTCCAGAGTTTGATGGTGGA

AGCCCGATTCTTCATTATGTCCTGGAACGGAGAGAAGCAGGGAGGAGGACATATATCCCAGTCATGTCTGGTGAGAACAAACTGTCTTGGACCGTAAAAG

ATCTCATACCAAATGGTGAATACTTCTTCCGAGTAAAAGCAGTCAACAAGATTGGCGGAGGAGAATACATTGAACTCAAGAATCCTGTCATTGCTCAAGA

TCCAAAGC AACCACCTGATCCACCTGTAGATGTTGAGGTTCATAATCCTACAGCTAAGGCAATGACTATCACGTGGAAGCCACCCTTGTATGATGGAGG

AAGCAAGATAATGGGTTACATCATAGAAAAGATCACTAAGGGTGAGGATAGATGGAAGAGATGCAATGAACATCTGGTCCCTGTCCTGACCTACACAGCG

AAAGGACTCGAGGAGGGGAAAGAGTACCAATTCCGTGTGCGAGCGGAGAACGCTGCTGGTATTGGTGAACCTTCCCGGGCCACTCCCCCAACCAAAGCTG

TCGACCCTATTG ATGCCCCAAAAGTCATCCTCAGAACAAGCCTGGAAGTAAAGCGGGGTGATGAAATAGCACTTGATGCAACCATCTCTGGCTCACCAT

ACCCAACAATCACATGGATAAAAGATGAAAATGTCATTGTTCCAGAGGAAATTAAGAAGCGAGCGGCACCCCCAGTTAGGAGGAAGAAGGGCGAGGCTGA

AGAGGAGGAGCCCTTTTCCCTCCCTCTGACAGAACGTCTGAGCATCAACAATAGCAAACAGGGAGAATCTCAGCTGCGCATCCGTGACTCTCTGCGGCCT

GACCATGGCCAGTACATGATCAAAGTTGAGAATGATCACGGTGTTGCAAAAGCTCCTTGCTCCGTCAGTGTGTTAG ATACACCAGGACCACCAATCAAC

TTTGTATTTGAGGATATTAGAAAGGACTCTGTCCTGTGTAAGTGGGAACCACCGCTTGACGATGGTGGCAGTGAAATCATTAACTATACCTTGGAAAAGA

AAGACAAGACCAAGCCCGACTCAGACTGGATTGTTATCACATCAACACTCAGAAACTGCAAATATTCAGTAACAAAACTGATTGAAGGAAAAGAGTACCT

CTTCCGTGTAAGAGCTGAAAATAGGTTTGGACCTGGGCCACCATGTGTTTCAAAGCCACTTTTAGCCAAAGATCCATTTG AACCACCTGATGCACCAGA

TAAACCCATTGTGGAAGATGTCACCAGCAACAGTATGCTAGTAAAATGGAATGAACCGAAAGATAATGGAAGCCCCATCTTGGGTTACTGGCTTGAAAAA

CGTGAGGTCAATAGTACACACTGGTCTCGTGTCAACAAAACCCTTCTCAGTTCTTTGAAAACCAAGGTAGATGGCTTGCTGGAAGGACTCACCTATGTCT

TCCGAGTTTGTGCTGAAAACGCTGCTGGACCTGGAAAGTTCAGCCCACCTTCGGATCCTAAAACAGCTCGCGATCCAATCT CTCCACCTGGGCCGCCTG

TCCCGAGAGTTGCTGATACAAGCTCTACAACCATTGAGCTGGAGTGGGAACCCCCAGCTTTCAATGGTGGTGGGGAAATTATGGGCTACTTTGTTGATAA

GCAGCTGGTTGGCACAAATGAGTGGTCACGCTGCACAGAGAAGATGATCAAAGTCCGTCAGTTCACTGTCAAAGAAATCCGAGAGGGTGCCGACTACAAA

CTTCGAGTGAGTGCTGTCAATGCAGCAGGCGAAGGACCACCTGGAGAAACAGAACCTGTTACTGTGGCTGAGCCACAAG AGCCTCCAACTGTGGAACTA

GATGTTTCTGTCAAGGGTGGAATACAAATCATGGCTGGGAAGACTCTCAGAATCCCAGCGGAGGTGACTGGCCGTCCTGTGCCCACAAAAGTATGGACCA

TCGAAGAAGGGGAGCTAGATAAAGAGCGTGTTATAATAGAGAATGTCGGAACCAAATCTGAACTAATTATCAAGAACGCATTGAGAAAAGACCATGGCAG

ATACGTGATCACGGCAACAAACAGCTGTGGTTCCAAATTTGCCGCAGTCCGGGTTGAAGTGTTCG ATGTCCCTGGCCCAGTTCTTGACCTCAAACCGGT

TGTAACAAACAGAAAGATGTGTCTGCTTAATTGGTCCGATCCAGCAGATGATGGCGGAAGTGACATCACAGGGTTTATAATTGAAAGGAAGGATGCTAAG

ATGCACACTTGGAGACAGCCCATCGAGACTGAGAGATCCAAGTGTGACATCACAGGCCTTATAGAGGGACAAGAATACAAGTTCCGTGTCATTGCCAAGA

ACAAGTTTGGCTGTGGGCCTCCTGTTGAAATAGGACCAATTCTTGCAGTTGATCCACTAG GCCCTCCAACATCTCCTGAAAGGCTCACATACACAGAAA

GAACAAAATCCACCATCACACTTGACTGGAAAGAGCCACGCAGCGATGGTGGCAGTCCCATTCAAGGATATATCATTGAAAAACGCCGCCATGACAAACC

CGACTTTGAAAGAGTTAACAAGAGACTCTGCCCAACCACATCATTTCTGGTTGAAAATCTTGATGAACACCAAATGTATGAGTTCCGTGTCAAAGCCGTC

AATGACGTTGGTGAAAGTGAACCATCTCTGCCTCTTAACGTAGTCATACAGGATGATGAAG TCCCTCCCACTATTAAGTTGCGCCTGGCTGTTCGAGGA

GACACTATCAAAGTTAAGGCAGGGGAGCCAGTTAACATCCCTGCAGACGTGACCGGCCTCCCCATGCCTAAGATTGAGTGGTCCAAGAATGAAAAGGTGA

TTGATAAACCTACGGATACACTGAATATAACCAAAGAAGAAGTCTCCCGAAGTGAGGCAAAGACTGAGCTTAGCATCCCTAAAGCAGCCCGAGAGGACAA

GGGCACGTACACAATCACAGCTTCCAATCGTCTTGGCTCCGTATTCCGCAACGTTCATGTGGAGGTTTATG ATCGTCCATCTCCACCCAGAAACCTCGC

TGTTACTGACATCAAAGCTGAGTCTTGCTATTTGACGTGGGATGCCCCTCTAGACAATGGAGGCAGTGAAATTACTCATTACATCATTGACAAGCGTGAT

GCCAGCAGGAAGAAGTCCGAATGGGAAGAAGTCACTAACACTGCTGTTGAGAGAAGATACGGG ATCTGGAAGCTTATCCCCAATGGTCAGTACGAGTTC

CGAGTGAGGGCAGTGAATAAATATGGAATCAGTGATGAATGCAAATCAGACAAGGTCGTCATTCAAGATCCCTACCGCCTCCCCGGGCCTCCTGGAAAAC

CGAAAGTCTTAGAACGTACCAAAGGATCTATGCTTGTGAGCTGGACCCCTCCTCTGGACAACGGAGGGTCTCCAATTACTGGCTACTGGCTAGAGAAGAG

AGAGGAAGGTGGTACCTACTGGTCACGTGTTAGCAGAGCACCAATAACCAAAGTAGGACTGAAGGGTGTGGAATTCAATGTTCCGCGGTTGATTGAAGGC

GTCAAATATCAATTTAGAGCCATGGCAATAAATGCTGCAGGAATTGGCCCTCCCAGTGAACCATCAGACCCAGCTGTTGCAGGAGATCCTATAT ACCCT

CCTGGGCCACCTTCTTGCCCAGAGGTCAAAGATAAAACAAAATCAAGCATCTCACTAGCATGGAAACCTCCAGCCAAAGACGGTGGCAGCCCAATCAAAG

GCTACATTGTAGAGATGCAAGAGGAGGGAACCACGGACTGGAAGCCAGTCAATGAACCCGATAAACTTCTCACTGCCTGTGAATGTGTGGTGCCTAATCT

GAAAGAGCTCAGGAAGTACAGGTTCAGAGTGAAAGCTGTCAATGAAGCTGGAGAGTCTGAACCAAGTGACACGACCGGAGAGATCCCTGCCACTGATATC

CAAG AAGTTCCAGAGGTTTTCATTGACATTGGCGCACAAGACTGCCTGGTTTGCAAAGCTGGCTCACAGGTCAAAATTCCTGCTGTGATCAAGGGACGC

CCCACACCAAAATCATCTTGGGAATTTGATGGAAAAGCAAAGAAGGCAATGAAG GATGGAGTTCATGATATACCTGAAGATGCACAG CTGGAGACGGC

CGAAAACTCATCGGTCATCATTATCCCAGAGTGTACTCGAGCTCACTCGGGCAAATACAGCATCACAGCCAAGAACAAAGCAGGACAGAAAACTGCCAAC

TGCAGAGTTAAAGTCATGG ACGCACCAGGCCCTCCCAAAGATTTGAAGGTCAGTGACATCACAAGGGGTAGTTGCCGCCTCTCATGGAAGATGCCAGAT

GATGATGGAGGTGATAGGATCAAAGGCTACGTCATTGAGAAGAAGACCATCGACGGGAAAGCCTGGACGAAAGTCAATCCAAATTGTGGAAGCACCACAT

TTGTGGTACCAGATCTTATCTCTGAGCAGCAATACTTCTTCCGTGTTCGAGCAGAAAACCGTTTTGGAATTGGCCCACCTGCAGAAACCATCCAGAGGAC

CACTGCCAGAGACCCAATAT ATCCTCCTGATCCCCCTATCAAACTCAAGATTGGTCTCATAACAAAGAACACAGTGCACCTGTCGTGGAAACCTCCAAA

GAATGATGGTGGCTCTCCTGTCACCCATTATATTGTTGAGTGTTTGGCTTGGGACCCTACCGGGAAAAAGAAAGAAGCCTGGAGGCAGTGCAATAGGCGT

GATGTGGAAGAACTGGAGTTCACCGTGGAAGACCTCATAGAGGGAGGGGAATATGAATTCAGAGTCAAAGCCGTCAACGAGGCCGGGGTCAGCAAGCCTT

CAGCCACTGTTGGTCCTGTGATTGTCAAAGACCAGACAT GCCCACCAGCCATTGAGCTAAAAGAATTCATGGAAGTTGAAGAAGGAACTGATGTTAACA

TTGTGGCCAAAATCAAAGGTGTGCCGTTCCCAACTCTCACCTGGTTCAAGGCTCCGCCAAAGAAACCCGACAGCAAAGAGCCTGTTGTTTATGACACCCA

TGTCAACAAACAGGTGGTGGATGACACTTGCACTTTAGTCATTCCTCAGTCTCGCCGGAGTGACACTGGCTTATATTCTATCACAGCCGTAAACAACCTG

GGGACAGCATCAAAGGAGATGAGACTCAATGTCCTTG GTCGTCCTGGCCCCCCTGTGGGACCCATAAAGTTTGAATCTATTTCAGCGGATCAGATGACA

TTATCTTGGCTTCCACCTAAAGATGACGGTGGGTCTAAGATTACAAACTATGTCATTGAGAAAAGAGAAGCCAACAGAAAGACATGGGTACGTGTCTCCA

GTGAACCTAAAGAATGCATGTACACAATTCCCAAATTGCTAGAAGGCCATGAATACGTCTTCCGAATCATGGCCCAGAATAAGTACGGCATTGGAGAGCC

ACTTGACAGTGAACCTGAGACAGCACGGAACCTCTTCT CTGTCCCTGGAGCTCCAGATAAACCAACAGTGAGCAGCGTCACTCGCAACTCCATGACTGT

CAACTGGGAAGAGCCGGAATATGATGGAGGCTCTCCTGTGACAGGGTACTGGTTAGAAATGAAAGACACCACTTCAAAGAGATGGAAGAGAGTTAACCGA

GATCCCATCAAAGCCATGACTCTAGGTGTTTCTTACAAAGTGACTGGCCTTATTGAAGGATCAGACTATCAGTTCCGGGTATATGCAATCAATGCCGCTG

GTGTGGGTCCAGCAAGTCTTCCCTCAGATCCAGTGACTGCTAGAGATCCAGTTG CTCCCCCTGGTCCTCCATTCCCCAAAGTGACAGACTGGACAAAAT

CATCTGTGGACTTAGAATGGTCTCCTCCACTAAAAGATGGCGGATCCAAAATCACTGGCTACATTGTTGAGTATAAGGAAGAAGGAAAAGAAGAATGGGA

AAAG GGTAAAGATAAAGAAGTGAGGGGGACAAAACTGGTTGTTACTGGATTAAAAGAAGGAGCCTTCTACAAATTCCGTGTGAGAGCAGTCAATGTTGC

TGGTGTTGGGGAACCTGGAGAAGTCACGGACGTTATTGAAATGAAGGACAGAATTG TGTCGCCTGACCTTCAGCTTGATGCCAGTGTCAGAGACAGAAT

AGTGGTCCACGCCGGAGGGGTGATCCGTATCATTGCCTATGTATCTGGGAAGCCACCTCCCACTGTCACCTGGAGTATGAATGAAAGAGCCTTGCCTCAA

GAGGCCGCCATTGAGACCACAGCAATTAGCTCATCCATGGTCATCAAGAACTGCCAGAGGAGCCACCAAGGCGTCTACTCTCTTCTTGCCAAAAATGAAG

GCGGAGAAAGAAAGAAGACAATTATTGTTGATGTACTAG ATGTCCCAGGACCTGTTGGAATACCATTCCTCTCTGACAACCTAACCAATGACTCCTGCA

AACTGACATGGTTCTCTCCAGAAGATGATGGTGGCTCTCCAATCACCAATTATGTCATTCAGAAGCGGGAAGCTGACCGCAGGGCATGGACCCCTGTGAC

ATACACAGTCACTCGACAAAATGCTACTGTTCAGGGCCTTATTCAAGGAAAATCCTACTTTTTCCGAATTGCAGCTGAGAATAGCATTGGCATGGGCCCA

TTTGTTGAGACACCAAATGCACTTGTCATTAGAGACCCAATAA CTGTGCCAGAGAGACCTGAGGACCTGGAAGTCAAAGAAGTCACTAAAAATACTGTG

TCTTTGACTTGGAACCCTCCCAAGTATGATGGCGGGTCAGAAATTATAAACTATGTCCTAGAAAGCCGCCTCATTGGTACTGAGAAGTTCCACAAAGTTA

CAAATGACAACCTGCTTAGCAGGAAATACACTGTGAAAGGCTTAAAAGAAGGCGATACATATGAGTACCGCGTCAGTGCCGTCAATATCGTTGGACAAGG

CAAGCCATCATTTTGCACCAAGCCAATCACTTGCAAGGATGAACTGG CTCCACCTACACTTGACCTCGACTTCAGAGATAAGCTTACCGTCCGAGTTGG

TGAATCTTTCGCCCTCACTGGCCGATACTCAGGCAAACCAAAGCCTAAGATTGATTGGTTCAAAGATGAAGCTGATGTACTGGAAGATGATCGTACTCAC

ATAAAGACCACTCCCACGACACTTGCTCTTGAGAAGACAAAGGCCAAACGCTCAGATTCTGGGAAATACTGTGTAGTTGTGGAGAACAGTACAGGCTCCA

GGAAAGGTTTCTGTCAAGTCAATGTTGTTG ATCGTCCTGGACCACCAGTAGGACCTGTCATTTTTGATGAGGTGACCAAAGAATACATGGTTATTTCTT

GGAAGCCACCTCTAGATGATGGAGGAAGTGAAATTACCAATTATATTATTGAGAAGAAGGAGCTCGGTAAAGACATCTGGATGCCTGTGACATCTGCCAG

TGCCAAAACTACATGCAAGGTCCCTAAACTGCTTGAAGGAAAAGATTACATCTTCCGGATTCATGCGGAAAATCTATATGGAATAAGTGACCCTCTGGTG

TCTGATTCAATGAAAGCCAAAGATCGATTCA GAGTCCCTGATGCACCTGAGCAGCCAGTTGTCACAGAGGTCACCAAAGACTCGGCATTAGTAACCTGG

AACAAGCCAAATGACGGAGGAAAGCCCATCACAAACTACATCCTGGAAAAGAGGGAAACTATGTCTAAAAGATGGGTTCGAGTTACCAAAGAGCCTATTC

ATCCATACACTAAGTATAGGGTTCCTGATCTTCTAGAAGGATGCCAGTATGAATTCCGTGTTTCTGCAGAGAATGAAATTGGTATTGGAGATCCAAGTCC

ACCATCCAAACCAGTCTTTGCTAGAGACCCAATTG CTAAACCAAGTCCACCTATTAATCCTGAGGCAATAGATACAACATGTAATTCAGTTGAGCTAAC

TTGGCAGCCACCACGTCACGACGGTGGTAGCAAGATCCTGGGTTATATCGTGGAGTACCAGAAAGTTGGGGATGAAGAGTGGAGACGAGCCAATCACACT

CCTGAATCATGCCCTGAAACTAAATATAAAGTCACTGGCCTCAGGGATGGTCAGAGCTACAAGTTCCGAGTACTGGCAGTCAACGAGGCTGGTGAATCGG

ACCCAGCCCACGTTCCTGAACCAGTTCTAGTAAAGGACCGACTTG AACCTCCTGAGCTTATACTTGATGCTAACATGGCAAGAGAACAACACATTAGAG

TTGGTGACACCCTAAGACTTAGTGCCATCATCAAAGGTGTGCCATTCCCCAAAGTAACCTGGAAAAAAGAAGACAGAGAGGCTCCAACAAAAGCCCAAAT

TGATGTTACTCCAGTTGGGAGCAAGCTTGAAATCCGTAATGCTGCCCACGAAGATGGTGGTATTTATTCCCTAACTGTGGAGAATCCGGCGGGTACAAAG

ACAGTCTCAGTCAAAGTATTGGTCTTAG ATAAACCTGGGCCACCTAGAGATCTGGAAGTCAGTGAAATTAGGAAAGATTCTTGTTACCTGACTTGGAAG

GAACCACTGGACGACGGTGGTTCTGTTGTAACCAATTATGTGGTTGAGAGGAAAGATGTTGCCACTGCCCAGTGGTCCCCTCTTTCCACCACGTCAAAGA

AGAAGAGCCATATGGCTAAACATCTGACTGAGGGCAATCAGTACCTCTTCCGAGTAGCTGCTGAGAACCAATACGGACGTGGTCCTTTTGTTGAAACACC

TAAGCCCATCAAGGCTCTGGATCCTCTCC ATCCCCCAGGGCCACCCAAGGATCTGCACCACGTAGATGTCGACAAGACTGAAGTCTCTCTCGTTTGGAA

TAAGCCAGATCGTGATGGTGGTTCTCCAATCACAGGATACTTAGTGGAATATCAAGAAGAGGGTGACAAGGACTGGATCAAGTTCAAGACTGTGAAAAAT

TTAGACTGTGTTGTTACAGGCTTACAACAAGGAAAGACCTATAGATTCCGTGTAAAAGCTGAAAATATCATAGGTCTTGGTCTTCCTGATACAACTATCC

CAATAGAATGTCAAGAGAAACTAG TGCCTCCATCTGTGGAATTAGATGTGAAGTTAATTGAAGGGCTTGTGGTGAAGGCTGGTACCACAGTTAGATTCC

CTGCCATCATAAGAGGTGTACCTGTTCCTACTGCAAAATGGACAACTGATGGGACTGAGATTAAAACAGATGACCACTACACAGTTGAGACTGACAGCTT

CTCATCCGTGCTGACCATTAAGAATTGTTTAAGGAAGGATACTGGGGAATACCAACTCACAGTTTCCAATGCAGCGGGTACCAAAACAGTAGCTGTCCAT

CTTACTGTTCTTGATGTACCTGGTCCACCAACAGGTCCTATTAATATCCTGGATGTCACACCTGAATACATGACTATCTCATGGCAACCGCCTAAGGATG

ATGGAGGAAGCCCAGTGATAAATTACATTGTTGAGAAACAAGATACAAGGAAAGGTACATGGGGTGTCGTCTCTGCAGGAAGCAGTAAGCTGAAGCTGAA

GGTCCCACATCTCCAAAAAGGCTGTGAATACGTTTTCAGAGTCAAAGCAGAGAACAAGATGGGTGTCGGTCCTCCCCTTGACTCCATACCTACTGTTGCT

AAGCACAAGTTCAGTCCTCCATCTCCTCCTGGTAAACCAGTGGTAACTGACATTACTGAGAATGCTGCAACGGTGTCTTGGACACTGCCAAAATCTGATG

GTGGCAGTCCAATAACTGGCTATTATGTAGAGCGCAGAGAAATAACCGGCAAATGGGTGAGGGTCAACAAAACGCCTATTGCTGACCTGAAGTTCAGGGT

GACTGGACTCTATGAGGGAAATACATACGAGTTTAGAGTTTTTGCTGAAAATCTTGCAGGTTTAAGCAATCCATCACCCAGTTCTGACCCAATCAAAGCT

TGCCGGCCCATCAAACCACCAGGGCCACCTATAAATCCTAAGCTGAAAGACAAGAGCAAAGAATCTGCTGACTTGGTGTGGACAAAGCCCCTCAGTGATG

GTGGCAGCCCCATTTTGGGGTATGTAGTAGAGTATCAGAAACCTGGCACAGCGCAGTGGGATAGGATTAATAAAGACGAACTCATCAGGCAATGTGCCTT

CCGGGTCCCCGGACTGATTGAAGGAAATGAGTACAGATTTCGCATTAGAGCAGCTAACATTGTGGGTGAGGGAGAGCCAAGGGAGCTTGCAGAATCTGTG

ATTGCAAAAGACATCCTTCATCCCCCGGAAGTGGAACTTGACGTTACATGCCGTGATGTCATTACCGTCCGGGTGGGTCAAACTATCCGCATTCTTGCCC

GAGTCAAAGGCAGACCTGAGCCAGACATAACTTGGTCCAAGGAAGGAAAAGTACTGGTCAAAGACAAGCGGGTTGACCTAATTCATGATCTGCCTCGTGT

TGAGCTACAAATTAAAGAAGCTGTCAGAGCTGACCATGGCAAGTATATCATCTCTGCTAAGAACAGCAGTGGGCATGCCCAAGGGTCAGCCATTGTTAAT

GTCCTTGACAGACCTGGGCCTTGCCAGAATCTGAAGGTTAGCAACGTAACCAAGGAAAACTGCACCATTTCTTGGGAAAACCCACTAGATAATGGTGGCT

CAGAAATTACAAATTTCATAGTGGAATATCGTAAACCAAATCAGAAAGGCTGGTCAATCGTTGCCTCAGATGTCACCAAGAGACTGGTCAAGGCCAACCT

GTTAGCCAATAATGAATACTATTTCCGTGTTTGTGCAGAGAATAAAGTAGGTGTTGGGCCAACCATTGAAACAAAGACTCCAATTTTGGCCATCAATCCT

ATTGACAGGCCAGGGGAGCCTGAAAACCTTCATATTGCAGATAAAGGAAAGACCTTTGTCTATCTAAAGTGGCGACGGCCTGATTATGATGGTGGTAGCC

CGAATCTATCATATCATGTTGAGAGGAGACTGAAGGGCTCTGCAGACTGGGAAAGAGTGCACAAAGGAAGCATTAAGGAAACCCACTACATGGTTGACAA

GTGTGTTGAAAACCAGATTTATGAGTTCAGAGTACAAACTAAGAATGAAGGTGGAGAAAGTGATTGGGTGAGGACAGAGGAAGTTGTTGTGAAGGAAGAT

TTACAGAAGCCAGTACTTGATCTAAAATTAAGTGGGGTGCTAACTGTCAAAGCAGGGGACACCATTAGACTCGAGGCAGGTGTGAGAGGCAAACCATTCC

CAGAGGTTGCCTGGACCAAAGACAAAGATGCTACAGATTTAACAAGATCACCAAGGGTCAAGATTGATACCAGTGCCGAATCATCGAAATTCTCTCTTAC

CAAAGCCAAGCGAAGCGATGGCGGTAAATACGTAATCACCGCAACTAACCCAGCTGGCAGTTTTGTGGCCTATGCGACTGTCAATGTTTTAGATAAACCT

GGTCCTGTAAGAAACCTGAAAATCACTGATGTGTCCAGTGACAGGTGTACTATCCGCTGGGATCCACCAGAAGATGATGGCGGCTGTGAAATCCAAAATT

ATATCCTAGAAAAATGTGAGAGCAAGAGAATGGTATGGTCTACCTATTCTGCTAATGTCTTGACACCCAGTGCTACAGTGACTCGTCTCATAGAAGGAAA

TGAGTATATTTTCAGAGTTCGTGCAGAAAACAAAATAGGCACAGGGCCTCCAACAGAAAGTAAACCAGTCATTGCAAAAACCAAGTATGACAGACCTGGC

CGCCCTGATCCTCCAGAAGTCACTAAAGTAAGCAAAGAAGAGATGACCGTGGTTTGGAACGCCCCTGAATATGATGGTGGGAAGTCTATCACAGGATACT

ATTTAGAGAAAAAAGAAAAGCATGCAGTCCGCTGGGTCCCTGTTAACAAGAGTGCCATCCCTGAGCGACGCTTGAAAGTACAGAATCTCCTCCCAGGGCA

CGAGTACCAGTTCCGTGTCAAAGCAGAAAATGAAGTTGGCATTGGAGAACCAAGCTTACCATCAAGACCAGTGGTGGCAAAAGATCCCATAG AACCACC

TGGGCCACCAACCAATTTCAAAGTGGTTGATACAACCAAAAGTTCCATAACTCTCGCATGGGGAAAACCAGTCTATGATGGTGGTGCACCGATAATTGGA

TATGTCGTAGAGATGAGACCCAAAATAGCAGACGCATCACCTGACGAAGGCTGGAAAAGGTGCAACGCTGCAGCTCAACTTATTCGCATGGAATTCACAG

TCACCAGCTTGGATGAGAACCAGGAGTACGAGTTCAGGGTGTGTGCCCAGAATCAAGTTGGCATTGGGCGCCCTGCAGAGCTAAAGGAAGCCATCAAACC

TAAAGAAATCCTAG AGCCTCCAGAGATTGACTTGGATGCCAGCATGAGAAAACTGGTCGTAGTGAGAGCTGGCTGCCCTATTCGACTATTCGCAATAGT

GAGAGGACGACCTGCCCCCAAAGTCACATGGCGCAAAGTGGGCATTGATAATGTGGTCAGAAAAGGACAAGTCGATCTAGTTGACACTATGGCCTTCCTT

GTCATCCCCAACTCTACCCGTGATGACTCTGGAAAATACTCCCTGACCCTTGTGAACCCAGCAGGAGAAAAGGCTGTTTTTGTGAATGTCAAAGTACTAG

 ATACTCCTGGACCTGTGGCTGATTTAAAAGTTTCAGATGTCACTAAAACATCATGTCACGTGTCCTGGGCACCTCCTGAAAATGATGGTGGAAGCCAAG

TGACACATTATATTGTGGAGAAACGTGAGGCAGAAAGAAAAACATGGTCAACAGTTACCCCTGAAGTGAAGAAAACAAGCTTCAATGTAACCAACCTTGT

CCCTGGGAACGAGTATTTCTTCCGAGTAACTGCTGTCAATGAATATGGCCCTGGTGTCCCGACAGACATCCCCAAACCTGTGCTTGCATCAGATCCTCTC

A GTGAGCCAGATCCTCCAAGAAAACTGGAGGTGACCGAAATGACAAAGAACAGTGCTACACTGGCCTGGTTACCTCCGTTGCGTGATGGAGGCGCTAAA

ATCGATGGCTATATCATTAGTTACAGAGAAGAAGACCAACCTGCAGATCGCTGGACAGAGTACTCAGTGGTCAAAGACCTCAGCCTTATTGTTACTGGCC

TAAAGGAAGGAAAGAAATATAAATTTAGAGTTGCAGCTAGAAATGCTGTTGGAGTCAGCATGCCAAGAGAGGCCGAAGGCGTCTACGAAGCAAAAGAACA

GCTAT TGCCACCAAAGATCCTCATGCCTGAGCAAATCACTATCAAAGCCGGGAAGAAACTTCGAGTTGAGGCGCATGTGTATGGAAAGCCTAACCCCAT

CTGCAAATGGAAGAAAGGAGACGACGAAGTTGTTACATCCAGCCACCTGGCCATCCACAAGGCAGACGGCTCCTCAGTTCTGATCATAAAAGACGTTACT

AGAAAAGACAGTGGTTACTATAGCCTCACGGCAGAGAATAGCTCCGGGTCAGACACTCAGAAAATCAAAGTTACAGTCATGG ATGCTCCTGGGCCCCCT

CAGCCTCCATTTGACATTTCTGAAATAGATGCTGATGCTTGCTCCCTGTCTTGGCACATCCCTCTGGAGGATGGAGGCAGCAACATTACCAATTACATAG

TAGAGAAATGTGATGTAAGCCGTGGCGATTGGGTCACAGCTCTAGCATCAGTCACCAAGACTTCCTGCAGGGTTGGAAAGCTGATCCCAGGCCAGGAGTA

TATCTTCCGGGTCCGAGCTGAAAACAGATTTGGCATTTCAGAGCCTCTCACATCTCCAAAGATGCTTGCTAAGTTCCCATTTG ATGTTCCTAGTGAGCC

AAAGAATGCACGTGTCACTAAAGTCAACAAAGACTGCATATTTGTCGCGTGGGACAGACCAGACAGTGATGGAGGAAGCCCCATCACTGGTTACCTGATT

GAACGCAAAGAAAGAAACAGTTTGCTCTGGGTGAAAGCTAATGACACTATTGTCCGGTCAACTGAGTATCCTTGTGCTGGCCTCGTAGAAGGTCTAGAAT

ATTCATTCAGAATCTATGCTCTAAACAAAGCTGGGTCCAGCCCACCTAGCAAACCAACTGAGTATGTGACTGCAAGGATGCCGGTTG ATCCACCAGGGA

AACCTGAAGTTGTTGACGTCACCAAGAACAGCGCATCGCTTATCTGGGCCCGGCCAAAGCATGATGGAGGCAGCAGAATTATCGGCTATTTTGTAGAGGC

TTGCAAACTTCCTGGTGATAAATGGGTTCGGTGCAATACCACACCTCACCAGATTCCCCAGGAAGAGTACACAGCTACTGGGTTAGAAGAGAATGCTCAG

TATCAGTTCAGAGCGATTGCCAAGACTGCTGTGAACATCAGCCAGCCTTCCGAGCCTTCTGATCCAGTGACCATTCTTGCAGAAAATG TTCCTCCACGG

ATAGAACTCAGTGTTGAGATGAAGTCTTTGCTTACCGTGAAGGCTGGGACTAATGTCTGCTTGGATGCTACTGTCTTCGGGAAACCGATGCCAACGGTTT

CTTGGAAGAAAGACACCACACCAATAAAACAAGCCGAAGGCATAAAGATGGCAATGAAGCGGAACTTGTGTACCTTGGAGCTGTTCAGTGTGAACCGGAA

AGACTCAGGAGACTATACCATTACTGCCGAAAATTCCAGTGGTTCCAAATCAGCCACCATTAAGCTGAAAGTACTAG ATAAGCCAGGTCCTCCAGCATC

TGTGAAAATCAACAAGATGTATGCAGACCGTGCAATGCTGTCCTGGGAACCTCCTCTCGAGGATGGAGGCTCAGAAATCACCAACTACATCATTGACAAG

CGTGAAACAAGCAGGCCCAACTGGGCCCAGGTCTCTGCTACTGTGCCCATCACCAGCTGCACTGTGGAGAAACTTATAGAGGGCCATGAATACCAGTTCC

GTATCTGTGCCGAAAACAAATACGGAGTCGGCGATCCCATCCTCACTGAGCCAGCGATTGCCAAAAACCCATATG ACCCGCCTGGACGCTGTGACCCTC

CTGTCATTAGCAACATCACTAAAGATCACATGACCGTCAGCTGGAAAGCCCCAGCGGATGATGGTGGCTCACCTATCACCGGATACTTGGTTGAAAAGCG

GGAAACTCAGGCAGTCAACTGGACTAAAGTCAACAGAAAACCTGTTATAGAAAGGACATTAAAAGCAACGGGTCTCCAGGAAGGCACGGAGTATGAATTC

CGAGTTACGGCTATCAATAAAGCTGGACCCGGCAAACCCAGTGATGCATCCAAAGCCGTGTATGCTCAAGACCCACTGT ATCCTCCTGGCCCGCCAGCT

TTCCCTAAAGTCTATGATACCACCCGTAGTTCTGTGAGTCTATCATGGGGCAAGCCGGCCTATGATGGCGGCAGCCCTATCATTGGTTATCTTGTGGAAG

TAAAGCGAGCTGATTCTGATCACTGGGTGAGGTGCAATTTGCCAGAGAAGCTCCAGAAGACCCGCTTCGAGGTGACTGGCCTGATGGAAAACACCGAGTA

TCAGTTCCGAGTGTATGCCGTTAACAAGATTGGGTACAGCGACCCCAGCGATGTGCCAGATAAACACTGCCCCAAGGACATCCTAA TTCCACCTGAGGG

AGAACTTGATGCTGAACTAAGGAAAACACTTATCTTACGTGCTGGAGTTACAATGAGACTCTACGTGCCAGTAAAAGGACGGCCACCTCCAAAGATTACT

TGGTCTAAACCGAACGTCAATCTAAGAGAAAGGATTGGCCTGGATATAAAGTCGACAGACTTTGACACCTTCTTGCGCTGCGAAAATGTGAACAAATATG

ATGCAGGAAAATATATCTTAACCTTGGAGAACAGCTGCGGCAAGAAGGAGTACACTATTGTGGTGAAAGTGCTGG ACACTCCTGGTCCACCTGTCAATG

TGACTGTTAAGGAGGTATCCAAGGACTCTGCATATGTTACCTGGGATCCTCCCATTATTGATGGTGGGAGCCCCATCATAAACTATGTGGTTGAGAAACG

GGATGCAGAGAGGAAGTCCTGGTCGACAGTGACAACCGAGTGCTCGAAGACAAGCTTCAGAGTCTCTAACTTGGAGGAGGGGAAATCCTACTTCTTCAGA

GTGTTTGCCGAAAATGAATACGGCATCGGGGATCCGGGGGAGACACGTGATGCTGTCAAAGCTTCTG AAACCCCGGGACCTGTGGTCGACCTGAAAGCA

CTGGCTATAACTAAGTCATCTTGTACCATCGGCTGGAAGAAGCCTCGAAGTGATGGCGGAAGCAGAATTACTGGCTATGTGGTGGATTTCCTGACAGAAG

AAAATAAGTGGCAACGGGTCATGAAATCACTGAGCCTTCAGTACTCCACAAAGGATCTGAAGGAGGGGAAGGAGTACACCTTCAGAGTGAGTGCAGAGAA

TGAAAACGGAGAAGGAACCCCAAGTGAAATTGTGGTTGTGGCCAAGGACGATGTTG TGGCTCCCGATCTTGACTTGAAGGATCTACCTGATCTGTGCTA

CTTGGCTAAAGAAAACAGCAACTTCCGTCTCAAGATCCCCATAAAAGGCAAACCAGCACCATCGGTGTCTTGGAAGAAGGGGGAAGATCCCCTAGCAACA

GACACAAGAGTCAGTGTCGAATCAACTGCAGTTAACACAACCCTTGTAGTATATGACTGCCAAAAATCCGATGCTGGAAAATACACAATCACACTCAAGA

ATGTTGCTGGCACCAAGGAAGGAACTCTTTCTATAAAGGTTGTTGGCAAGCCTGGCATCCCCACCGGACCAATCAAATTTGATGAAGTCACAGCAGAAGC

CATGACCTTGAAGTGGGGTCCTCCAAAGGATGATGGAGGTTCTGAAATCACCAACTATGTACTAGAGAAGAGAGACTCTGTGAATAACAAGTGGGTGACA

TGTGCTTCCGCTGTCCAGAAAACCACCTTTAGAGTAACCAGACTTCACGAGGGCATAGAATACACCTTCAGGGTCAGTGCTGAAAATAAATATGGTGTAG

GAGAAGGCCTAAAGTCAGAGCCAATTGTTGCCAAACATCCATTTG ATGTGCCTGATGCTCCCCCACCTCCCAATATTGTGGATGTCAGACATGATTCAG

TATCTCTAACATGGACTGATCCCAAAAAGACTGGTGGCTCACCAATTACAG GGTATCATATTGAATTCAAGGAAAGAAACAGCCTTCTGTGGAAGAGAG

CTAACAAGACTCCTATAAGGATGAAAGATTTTAAAGTGACAGGATTAACTGAAGGTCTTGAATATGAATTCAGAGTTATGGCTATCAATCTAGCTGGAGT

GGGCAAGCCAAGCCTGCCATCAGAGCCAGTTGTGGCACTTGATCCAATTG ATCCTCCTGGAAAACCTGAGGTTATCAGCGTAACAAGGAATTCAGTGAC

TCTCATCTGGACAGAACCTAAATACGATGGTGGCCATAAATTAACAGGATATATCGTGGAGAAGCGGGATCTACCCTCTAAGTCTTGGATGAAAGCCAAC

CATGTTAATGTCCCAGACTGTGCCTTTACTGTAACTGATCTTGTTGAAGGTGGAAAATATGAATTCCGAATCAGAGCAAAGAATACAGCGGGTGCTATTA

GTGCTCCATCAGAGAGCACAGGAACCATTATTTGCAAGGATGAATACG AGGCACCAACCATTGTCCTTGATCCAACAATTAAAGATGGGCTAACAGTCA

AGGCAGGGGATAGCATTGTTTTAAGTGCCATTAGCATTCTCGGCAAACCCCTTCCAAAGTCAAGCTGGTCCAGGGCAGGAAAAGATATCAGACCATCAGA

CATAGCTCAAATAACTTCAACCCCAACATCTTCTATGCTGACAGTTAAGTATGCCACAAGAAAGGATGCTGGCGAGTATACCATCACCGCTACCAATCCT

TTTGGCACAAAGGAGGAACATGTGAAGGTATCAGTCCTTGATGTACCTGGTCCCCCAGGTCCCATTGAAATCAGTAATGTTTCAGCTGAAAAAGCAACAC

TTACTTGGACACCTCCCTTAGAAGATGGGGGCTCACCGATTAAAGCTTATGTTCTTGAGAAGAGAGAAACCAGCCGGCTTTTGTGGACAGTGGTTTCTGA

AGATATTCAGGCATGCAGACATGTGGTAACCAAACTCATCCAAGGAAATGAATACCTCTTCCGTGTGTCAGCAGTAAACCATTACGGCAAAGGAGAACCC

GTTCAGTCTGAGCCTGTCAAAATGGTGGACAGATTTG GTCCTCCTGGCCCTCCTGGAAAACCCGAGATCTCAAATGTCACCAAGAACACTGCCACTGTC

AGCTGGAAGAGGCCAACTGATGATGGTGGCAGCGAGATCACAGGATATCATGTAGAAAGGAGAGAAAAGAAAGGCCTGCGGTGGGTGAGAGCAACCAAAA

CACCAGTTTCCGATCTCAGGTGCAAAGTAACTGGACTGCAAGAAGGAAATACCTATGAGTTCCGTGTCAGTGCAGAAAACAGAGCCGGGATTGGTCCTCC

CAGTGACGCCTCGAATCCTGTTCTGATGAAAGATGTTGCAT ATCCCCCAGGACCACCTTCAAATGCACATGTCACTGATACCACCAAGAAATCGGCTTC

TTTAGCATGGGGCAAGCCTCATTATGATGGTGGGCTTGAAATCACTGGCTATGTGGTAGAGCATCAAAAAGTAGGAGATGATGCCTGGATCAAAGACACA

ACAGGAACAGCCCTCAGAATCACTCAGTTTGTGGTTCCTGATCTTCAGACTAAGGAAAAATACAATTTTAGAATTAGTGCCATCAACGATGCAGGTGTGG

GGGAACCAGCTGTGATTCCAAATGTTGAAATTGTAGAGAAGGAAGTGGCTCCTGATTTTGAGCTAGATGCTGAGCTGCGAAGAACACTTGTGGTTAGGGC

AGGGCTCAGTATTAGGATTTTTGTGCCAATTAAAGGTCGTCCTGCACCTGAAGTGACATGGACCAAAGATAATATCAACCTGAAGCACCGAGCCAACATC

GAAAACACAGAGTCATTTACTCTTCTCATTATTCCAGAATGTAACAGATATGACACTGGTAAATTTGTGATGACCATCGAAAACCCAGCTGGGAAGAAAA

GCGGCTTCGTTAACGTCAGAGTCCTAGACACACCAGGCCCTGTCCTTAACCTAAGGCCTACAGACATCACAAAGGACAGTGTCACCCTACACTGGGACCT

ACCTCTGATAGATGGGGGCTCACGTATAACAAATTATATTGTGGAGAAACGTGAAGCAACCAGGAAATCCTACTCCACAGTCACTACTAAGTGCCATAAA

TGTACATATAAAGTGACTGGCTTGACAGAAGGCTGTGAATATTTCTTCAGAGTGATGGCAGAAAATGAATATGGGGTTGGTGAGCCAACGGAAACCACAG

AACCTGTGAGAGCCTCTGAGGCACCGTTACCCCCAGATAGCCTTAACATTATGGACATTACCAAGAACACAGTCAGCCTGGCGTGGCCTAAGCCAAGGCA

TGATGGTGGGAGCAAGATCACTGGCTATGTGATTGAAGCCCAGAGAAAAGGGTCTGACCAGTGGACCCACATCTCAACAGTGAAAGGGTTAGAATGTGTG

GTGAGGAACCTAACCGAAGGAGAGGAATATACCTTCCAAGTGATGGCGGTAAACAGTGCAGGCAGGAGTGCCCCTAGAGAGAGCAGACCTGTCATTGTCA

AAGAGCAGACGATGCTCCCAGAGCTGGATCTCCGTGGCATCTATCAGAAGCTAGTCATTGCCAGAGCTGGTGACAACATCAAAGTTGAAATCCCAGTACT

TGGTCGACCCAAGCCCACAGTCACATGGAAAAAGGGAGACCAAATCCTTAAACAGACACAGAGAGTTAATGTTGAAAACACAGCAACGTCAACCATCTTA

AATATCAATGAGTGTGTCAGAAGTGACAGTGGACCCTATCCATTAACAGCAAAGAACACTGTAGGAGAGGTTGGTGACGTTATAACCATTCAAGTCCATG

ATATTCCAGGACCACCTACTGGACCCATTAAATTTGATGAAGTTTCATCTGACTTTGTAACCTTCTCTTGGGAGCCACCAGAGAATGATGGAGGTGTACC

AATAAGCAACTATGTAGTAGAGATGAGACAGACAGACAGTACTACATGGGTGGAGTTAGCAACAACTGTTATACGTACTACCTATAAAGCAACTCGTCTG

ACCACAGGAGTGGAGTATCAATTCCGTGTAAGGGCTCAAAACAGATATGGAGTTGGACCGGGCATCACATCTGCATCTGTAGTTGCAAACTATCCATTCA

AGGTGCCCGGGCCTCCCGGTACCCCTCAGGTTACTGCAGTCACCAAAGACTCCATGACAATCAGCTGGCATGAACCACTTTCTGATGGTGGAAGCCCCAT

TTTAGGATATCACATTGAAAGGAAAGAACGGAATGGCATCCTCTGGCAGACTGTGAGCAAAGCATTAGTACCAGGCAACATTTTCAAATCAACTGGACTT

ACCGATGGCATTGCTTATGAATTCCGAGTAATTGCAGAAAACATGGCAGGCAAGAGCAAGCCAAGCAAGCCATCTGAACCAATGTTTGCTTTGGATCCCA

TTGACCCACCCGGGAAACCAGTTCCTCTAAACATTACAAGACACACAGTGGCACTGAAGTGGGCTAAGCCTGAATATACCGGAGGCTTTAAAATTACTAG

CTATGTGGTTGAAAAGAGGGACCTTCCTAATGGACGATGGCTGAAGGCCAACTTCAGCAACATTTTAGAGAATGAATTTACGGTCAGCGGCCTAACTGAA

GATGCTGCATACGAGTTCCGTGTGATTGCCAAAAATGCTGCCGGTGCCATCAGTCCACCGTCTGAGCCATCAGATGCCATCACATGCAGGGACGACCTGG

AGGCACCAAGAATAATGGTGGATGTTAGATTTAAGGATACCATCACATTAAAAGCTGGCGAAGCATTCAAGTTGGAAGCTGATGTTTCAGGTCGCCCACC

TCCAACAATGGAATGGACTAAAGATGGAAAGGAGCTTGAAGGCACAGGGAAATTAGAAATAAAAATTGCAGACTTCTCCACTCATCTGATAAACAAGGAT

TCCTCAAGAACGGATAGTGGGGCTTACATCCTGACAGCAACCAATCCTGGTGGCTTTGCCAAACACATTTTCAATGTCAAAGTTCTTGATAGACCGGGAC

CACCTGAGGGACCTTTGGCTGTGTCTGATGTGACATCAGAGAAGTGTGTGTTGTCATGGTTGCCTCCACTGGACGATGGAGGTGCCAAAATTGATCATTA

CATCGTACAGAAACGTGAAACCAGCAGGTTGGCATGGACAAATGTTGCCACAGAAGTCCAAGTAACAAAGCTGAAGGTTACTAAGCTCCTGAAAGGGAAT

GAATACATATTCCGTGTCATGGCAGTAAATAAATACGGGGTTGGAGAGCCACTTGAATCAGAACCTGTGCTTGCAGTGGATCCATATGGACCACCTGACC

CACCCAAGAACCCGGAAGTTACAACTATCACCAAGGACTCCATGGTCGTCTGCTGGGGGCATCCTGACTCTGATGGTGGAAGTGAAATTATCAACTACAT

TGTGGAGCGGCGTGATAAAGCTGGCCAGCGCTGGGTAAAATGCAACAAAAAAGCTCTGACTGACTTAAGATTTAAAGTATCTGGGCTGACAGAAGGACAT

GAATACGAGTTCAGAATTATGGCAGAAAACGCAGCTGGAATCAGTGCTCCGAGTGCTACCAGCCCGTTTTATAAAGCTTGCGACACTGTGTTTAAACCTG

GCCCACCGGGTAACCCACGTGTCCTTGATACAAGCAGGTCGTCCATTTCAATTGCGTGGAATAAACCCATTTATGATGGAGGTTCAGAAATCACTGGGTA

TATGGTTGAGATTGCCCTGCCTGAAGAAGATGAATGGCAGGTTGTCACTCCACCAGCTGGGCTCAAGGCAACTTCCTATACCATCACCAGCCTCATAGAG

AATCAGGAATATAAAATCCGCATTTATGCCATGAATTCTGAGGGACTTGGGGAACCTGCCCTTGTTCCCGGAACTCCAAAGGCAGAAGAAAGAATGTTGC

CTCCAGAGATAGAACTGGATGCTGACTTACGCAAAGTTGTCACTATACGAGCCTGCTGCACCTTGAGGCTCTTTGTTCCCATCAAAGGGAGACCAGCACC

TGAGGTCAAGTGGGCCCGAGAGCATGGAGAATCTCTGGACAAGGCTAGCATTGAATCCACAAGCTCTTACACCCTGCTTGTTGTTGGAAATGTTAACAGA

TTCGACAGTGGCAAGTACATACTAACGGTAGAAAACAGCTCTGGCAGCAAGTCGGCGTTTGTCAATGTTAGAGTGCTAGATACGCCAGGCCCTCCACAGA

ATCTAAAGATAAAGGAGGTCACAAAGACATCTGTCACATTGACGTGGGAGCCTCCTCTCCTGGATGGAGGCTCAAAAATAAAGAACTATATTGTTGAGAA

GCGAGAGTCCACAAGAAAGGCATATTCAACCGTGGCAACGAATTGCCATAAGACGTCCTGGAAGGTAGACCAGCTGCAAGAAGGCTGCAGTTACTATTTC

CGTGTCCTCGCTGAAAACGAATATGGCATTGGACTGCCCGCCGAAACAGCTGAGTCTGTGAAGGCATCGGAGCGACCTCTTCCTCCAGGGAAGATAACTT

TGACGGATGTCACACGAAACAGTGTGTCTCTCTCTTGGGAGAAGCCAGAACATGACGGGGGCAGCCGAATTCTAGGCTACATTGTAGAGATGCAGAGCAA

AGGCAGTGACAGATGGGCCACGTGTGCCACAGTGAAAGTCACAGAAGCCACCATCACCGGCCTGATCCAGGGTGAGGAATACTCTTTCCGTGTTTCAGCG

CAGAATGAAAAGGGCATCAGTGACCCCAGACAACTGAGTGTGCCAGTAATTGCTAAAGACCTTGTTATCCCACCAGCCTTCAAACTCCTCTTCAATACAT

TCACGGTACTGGCAGGTGAAGACCTGAAAATTGATGTACCATTCATTGGACGCCCTCCACCAGCTGTCACCTGGCATAAAGATGACATACCTCTGAAGCA

AACAACTAGAGTGAATGCAGAGAGCACGGAAAACAATTCTCTACTGACAATAAAGGAAGCCTGCCGAGAAGATGTTGGACATTACACGGTTAAACTGACT

AACTCGGCAGGTGAAGCCACTGAAACCCTTAATGTTATCGTTCTTGACAAGCCAGGGCCCCCAACAGGACCAGTGAAGATGGATGAAGTGACAGCAGACA

GTGTCACTCTTTCCTGGGAACCACCAAAGTATGATGGCGGAAGCTCTATCAATAATTACATTGTAGAGAAACGAGACACATCCACAACCGCCTGGCAAAT

CGTGTCAGCTACGGTTGCAAGAACAACCATAAAGGCCTGCAGACTAAAGACTGGCTGTGAGTATCAGTTCAGAATTGCAGCAGAAAACAGATATGGGAAG

AGTACCTACCTCAACTCAGAGCCTGTTGTTGCCCAGTACCCATTCAAAGTGCCAGGGCCACCGGGCACACCATTCGTCACGCTTGCCTCCAAAGACAGCA

TGGAGGTACAATGGCATGAGCCAGTCAGTGATGGTGGGAGCAAAGTCATTGGCTACCATCTAGAGCGCAAGGAAAGAAATAGCATCCTCTGGGTCAAGCT

GAATAAGACACCTATTCCTCAAACCAAGTTCAAGACAACTGGCCTTGAAGAAGGCATTGAATATGAATTTAGAGTGTCTGCAGAGAACATCGTAGGCATC

GGCAAGCCAAGTAAGCCATCAGAATGTTATGCTGCTCATGACCCATGCGATCCACCAGGTCGGCCAGAGGCAATCATTGTCACAAGGAACTCTGTGACTC

TTCAGTGGAAGAAACCCACCTACGATGGTGGAAGCAAGATCACTGGTTACATTGTTGAGAAGAAAGAATTGCCTGATGGCCGCTGGATGAAAGCCAGTTT

TACAAATATCATTGACACCCAGTTTGAGGTAACTGGCCTACTGGAAGATCATAGATATGAGTTTCGAGTTATAGCTCGAAATGCTGCAGGAGTTTTCAGT

GAGCCCTCAGAAAGTACAGGGGCAATCACAGCAAGAGATGAGGTTGAGCCACCCAGAATAAGCATGGACCCCAAATACAGGGACACGGTTGTGGTTCAAG

CTGGTGAGTCATTCAAGATCGATGCAGATATATATGGCAAACCAATACCGACCACTCAGTGGGTAAAGGGTGACCAGGAGCTTTCAAGCACAGCTCGGTT

AGAAATTAAGAGCACCGACTTTGCCACCAGTCTCAGTGTCAAAGATGCGGTACGTGTGGATAGTGGCAATTATATCCTAAAGGCCAAAAACGTTGCAGGG

GAGAAATCAGTTACTATCAATGTCAAAGTTCTCGATAGACCAGGGCCACCTGAGGGACCTGTTGCTATATCAGGGGTTACAGCAGAAAAATGTACTCTAG

CTTGGAAACCCCCACTTCAGGATGGTGGGAGTGACATCACAAATTACATTGTGGAAAGGCGAGAAACCAGCCGCCTCGTCTGGACTCTGGTTGATGCCAA

TGTGCAAACGCTCAGCTGTAAAGTCCTGAAGCTTCTTGAGGGCAATGAATATATTTTCCGTATAATGGCTGTGAACAAATACGGTGTTGGTGAACCTCTT

GAATCTGAGTCATTGATTGCCAAGAATCCATTTGTAGTCCCAGATGCACCCAAAGCTCCAGAAGTTACAGCTGTGACCAAAGACTCAATGATTGTTGTAT

GGGAAAGGCCAGCGTCTGATGGTGGCAGTGAGATTCTAGGATATGTTCTAGAAAAACGGGACAAAGAAGGCATAAGATGGACAAGATGCCACAAGCGTCT

AATTGGAGAGCTGCGCCTGAGAGTGACTGGACTGTTAGAAAATCACAATTATGAATTCAGAGTCTCCGCTGAAAATGCTGCTGGACTTAGTGAACCAAGC

CCCCCTTCTGCTTACCAGAAGGCATGTGACCCCATTTATAAGCCAGGCCCTCCAAACAACCCCAAAGTCATGGATGTTACCAGATCTTCGGTTTTCCTTT

CTTGGACCAAACCTATCTATGATGGTGGCTGTGAAATCCAAGGATACATCGTAGAAAAATGTGATGTGAGTGTTGGTGAATGGACAATGTGTACGCCACC

AACTGGAATCAATAAGACAAATCTAGAAGTCGAGAAGTTGTTGGAAAAGCATGAATACAACTTCCGGATCTGTGCCATTAATAAGGCCGGAGTAGGGGAG

CATGCTGATGTCCCTGGGCCTGTAATGGTTGAAGAAAAACTTGAAGCACCTGATATAGACCTTGACCTTGAACTAAGGAAAGTGATTAATATAAGGGCAG

GTGGTTCCTTAAGGCTGTTTGTTCCTATAAAAGGCCGTCCTACACCAGAAGTCAAGTGGGGGAAGGTTGATGGTGATATCCGGGACGCAGCTATAATTGA

TGTCACTAGCAGCTTCACCTCTCTTGTTCTTGACAATGTCAATCGATATGATAGTGGAAAATACACTCTCACACTAGAAAACAGCAGTGGAACAAAATCT

GCCTTTGTGACGGTAAGGGTCCTGGACACACCAAGCCCACCTGTCAACTTAAAAGTCACAGAAATCACCAAGGACTCGGTATCAATTACATGGGAACCTC

CTTTGTTGGACGGAGGATCAAAAATTAAAAATTACATTGTTGAGAAACGAGAAGCCACAAGAAAATCCTATGCTGCAGTTGTAACAAACTGCCATAAGAA

TTCGTGGAAAATCGATCAGCTCCAAGAAGGTTGCAGTTACTACTTCAGGGTTACCGCTGAGAACGAATACGGTATTGGCTTGCCTGCCCGCACTGCAGAT

CCAATCAAGGTTGCAGAAGTCCCACAACCTCCAGGGAAAATAACTGTGGATGATGTCACCAGAAACAGTGTCTCTCTCAGTTGGACAAAGCCCGAACATG

ACGGTGGCAGTAAAATCATCCAGTATATCGTAGAAATGCAAGCTAAAAACACTGATAAGTGGTCAGAGTGTGCTAGGGTGAAGTCCCTTGACGCAGTTAT

TACCAACCTAACTCAGGGAGAAGAATACCTTTTCAGAGTCATTGCTGTAAATGAAAAAGGAAGAAGCGACCCCAGGTCCCTTGCGGTTCCAATCATCGCC

AAAGATCTGGTCATCGAGCCAGACGTGAGACCAGCATTCAGCAGTTACAGTGTACAGGTTGGCCAAGACTTGAAAATAGAAGTGCCAATTTCTGGACGTC

CTAAACCAAGCATTTCCTGGACTAAGGATGGGATGCCATTGAAGCAGACCACAAGAATCAATGTTACCGACTCCCTGGACCTCACCACACTCAGCATTAA

AGAAACTCATAAGGATGATGGTGGACAGTATGGAATCACAGTTTCCAATGTGGTGGGTCAGAAAACAGCAGCTATTGAAATCATAACTCTAGATAAACCT

GATCCTCCAAAAGGGCCTGTTAAATTTGATGAGATCAGTGCTGAGAGCATCACATTATCCTGGAACCCTCCCTTATATACAGGGGGCTGTCAAATTACCA

ACTACATTGTTCAGAAAAGAGACACAACCACCACAGTATGGGATGTCGTCTCTGCTACTGTTGCCAGAACGACCCTCAAAGTAACCAAGCTGAAAACGGG

TACAGAATACCAATTCAGAATATTTGCTGAAAACCGATACGGACAAAGCTTTGCTCTGGAGTCTGAGCCAGTTGTAGCTCAATATCCCTACAAAGAACCA

GGCCCTCCAGGAACGCCATTTGTCACAGCCATCTCCAAAGAGTCTATGGTGGTACAGTGGCATGAACCGATCAATAATGGTGGAAGCCCAGTCATAGGTT

ACCACCTTGAGAGAAAGGAAAGGAATAGTATTTTGTGGACAAAAGTCAACAAAACCATTATTCATGACACCCAGTTTAAAGCACTGAACCTTGAAGAAGG

CATTGAGTATGAATTTAGAGTTTATGCTGAAAATATTGTTGGGGTAGGCAAGGCAAGCAAGAATTCTGAATGCTATGTAGCCAGAGACCCCTGTGACCCA

CCAGGTACCCCAGAAGCAATAATAGTTAAGAGAAATGAAATCACTTTACAGTGGACCAAGCCTGTGTACGATGGTGGCAGTATGATCACAGGTTACATCG

TAGAGAAACGTGATTTACCCGAGGGTCGCTGGATGAAAGCCAGTTTCACAAATGTCATTGAAACTCAATTCACCGTGTCAGGTCTTACTGAAGATCAAAG

ATATGAATTCAGAGTCATTGCAAAGAATGCAGCTGGGGCAATAAGTAAACCCTCTGACAGTACTGGACCAATAACTGCCAAGGATGAGGTTGAACTCCCA

CGAATTTCAATGGATCCAAAATTCAGAGACACAATAGTGGTAAATGCTGGAGAAACATTCAGGCTTGAGGCCGATGTCCATGGAAAACCCCTACCCACCA

TTGAGTGGTTAAGAGGAGACAAGGAAATTGAAGAATCTGCCAGGTGTGAAATAAAGAACACAGATTTCAAAGCTTTACTTATTGTAAAAGATGCCATTCG

AATTGATGGTGGACAGTATATTTTAAGAGCCTCGAATGTTGCCGGGTCTAAGTCATTTCCAGTAAATGTGAAAGTGCTAGACAGACCAGGACCACCAGAA

GGGCCAGTTCAGGTTACTGGAGTCACAGCTGAAAAGTGCACTTTGGCATGGTCTCCACCACTTCAAGATGGTGGCAGTGACATTTCTCACTACGTGGTAG

AAAAGCGAGAAACCAGTCGACTTGCATGGACTGTGGTTGCTTCAGAAGTTGTGACTAATTCTCTGAAAGTTACCAAGCTCTTAGAAGGGAATAAATATAT

TTTCCGAATAATGGCTGTCAACAAGTACGGTGTCGGGGAACCTTTGGAATCTGCTCCAGTACTCATGAAAAATCCATTTGTGCTTCCTGGACCACCAAAG

AGCTTAGAAGTCACAAACATTGCCAAAGACTCCATGACAGTCTGCTGGAATCGGCCAGACAGTGATGGTGGCAGTGAGATCATTGGTTACATTGTGGAGA

AGAGAGACAGAAGTGGCATTCGGTGGATCAAGTGTAACAAACGCCGCATTACAGATTTGCGACTCAGGGTGACAGGATTAACAGAAGACCATGAGTATGA

ATTCAGAGTCTCTGCAGAAAATGCTGCTGGAGTTGGAGAACCAAGTCCTGCTACCGTTTACTATAAGGCATGTGATCCTGTGTTCAAACCTGGCCCACCC

ACCAATGCACACGTTGTAGACACCACTAAAAATTCAATTACACTTGCCTGGAGCAAACCTATCTATGATGGCGGCAGTGAGATCCTGGGCTACGTTGTAG

AAATCTGTAAAGCTGATGAAGAAGAATGGCAAATAGTTACTCCACAGACTGGCCTGAGAGTCACTCGATTTGAAATTGCCAAACTAATCGAACACCAAGA

ATATAAAATACGAGTTTGCGCCCTCAACAAAGTTGGTTTAGGTGAGGCTGCCTCAGTTCCTGGTACGGTGAAACCGGAAGATAAACTCGAGGCACCTGAA

CTTGACCTTGACTCTGAGTTAAGGAAAGGGATCGTTGTCAGAGCTGGTGGATCTGCCAGAATCCATATTCCATTCAAGGGTCGTCCAACGCCTGAGATCA

CTTGGTCAAAAGAGGAAGGTGAATTCACAGATAAGGTCCAAATTGAGAAGGGAATTAACTTCACCCAACTCTCAATAGATAACTGTGACAGAAACGACGC

CGGGAAATACATCCTCAAGTTGGAGAACAGCAGCGGATCAAAGTCGGCTTTCGTAACCGTGAAAGTACTTGACACACCAGGACCGCCACAGAATCTGGCT

GTCAAGGAAGTGAGAAAAGACTCTGTCCTTCTGGTATGGGAGCCACCTATCATTGACGGTGGGGCAAAGGTCAAGAACTATGTCATCGACAAGCGCGAGT

CCACTCGAAAAGCATATGCTAACGTGAGTAGTAAATGCAATAAAACGAGCTTCAGAGTCGAGAACCTGACCGAAGGAGCCATCTACTACTTTAGAGTCAT

GGCAGAGAATGAATTTGGGGTTGGTGTTCCCACGGAGACATCTGATGCTGTGAAAGCTTCTGAGCCTCCTTCCCCACCAGGAAAGGTCACACTCACTGAC

GTGTCCCAGACCAGTGCATCCCTTATGTGGGAGAAACCCGAGCATGATGGAGGGAGCAGAATTCTGGGCTATGTTGTTGAAATGCAGCCCAAAGGAACAG

AAAAGTGGAGCGTTGTGGCTGAATCCAAAGTCTGTAATGCAGTGGTTAGTGGCCTGAGCTCCGGGCAAGAATATCAGTTCCGTGTCAAAGCTTACAATGA

GAAAGGAAAAAGTGACCCGAGAGTGCTTGGCATTCCTGTCATAGCCAAGGACTTGACCATCCAGCCTAGTTTTAAGCTGCCATTTAATACATATAGTGTC

CAAGCGGGAGAGGATCTGAAAATAGAAATTCCAGTCATAGGCAGACCAAGACCTAAAATTTCTTGGGTCAAAGATGGTGAGCCTCTTAAACAGACCACCA

GAGTAAATGTTGAAGAAACGGCTACTTCGACTATTTTACACATTAAAGAAAGCAGCAAAGATGACTTCGGGAAATACAGTGTCACAGCAACAAACAGTGC

AGGCACAGCAACAGAAAACCTCAGTGTTATTGTTTTAGAAAAGCCTGGTCCTCCCGTTGGACCAGTGAAGTTTGATGAAGTTAGTGCAGACTTTGTGGTC

ATATCTTGGGAACCTCCCGCCTATACTGGTGGGTGCCAAATCAGCAACTACATTGTAGAGAAGCGAGATACTACCACTACCAACTGGCAGATGGTGTCAG

CAACAGTTGCCAGGACAACCATTAAAATAAGCAAACTGAAAACAGGCACCGAATACCAGTTTAGGATTTTTGCTGAGAACAGGTATGGGAAAAGCACTCC

CCTGGATTCTAAGCCCGTTGTTGTACAATATCCATTTAAAGAGCCTGGACCACCTGGAACCCCTTTTGTAACATCTATCTCCAAAGATCAAATGCTTGTG

CAGTGGCATGAGCCAGTTAATGATGGAGGCAGCAAAGTGACTGGCTACCATCTTGAACAGAAGGAAAAGAATAGCATCCTGTGGGTCAAGTTGAATAAGA

TCCCCATCCAAGACACCAAATTCAAAACAACGGGGCTTGATGAAGGGCTTGAATATGAGTTCAGGGTTTCTGCCGAGAACATTGTGGGCATTGGCAAGCC

TAGCAAAGTGTCAGAGTGCTATGTTGCGCGTGATCCGTGTGACCCACCTGGTCGACCTGAAGCCATCGTCATTACAAGAAACAGCGTCACGCTGAAATGG

AAGAAACCTGTTTATGATGGTGGCAGCAAGATAACGGGTTACATCGTAGAAAAGAAAGACCTTCCTGACGGCCGGTGGATGAAAGCCAGCTTCACCAATG

TTGTGGAAACTGAGTTTACAGTGACTGGGCTTGTAGAAGACCAAAGATATGAATTTAGAGTCATTGCAAGAAATGCGGCTGACAACTTTAGTGAGCCATC

TGAAAGCAGTGGCGCCATCACTGCAAGGGATGAAATCGATGCACCAAATGCCTCGCTGGATCCTAAATACAGAGATGTCATCATTGTTCATGCAGGAGAG

ACCTTTGTTCTCGAAGCTGATATCCGTGGCAAACCCATACCTGACATCATATGGTCAAAAGATGGGAACGAACTCGAAGAAACAGCAGCTAGGATGGAAA

TTAAATCTACTCTGCAGAAAACGACTCTCATTGTCAAGGACTGTATACGCACCGATGGGGGACAGTATACCTTGAAACTCAGCAATGTCGGGGGCACCAA

GACTATACCTATTACCGTGAAGGTGCTGGATAGGCCAGGGCCTCCCGAAGGACCTCTGAAAGTTACTGGAGTTACAGCCGAAAAGTGTTACCTGGCATGG

AACCCACCTTTGCAAGATGGTGGTGCTAGTATTTCACATTACATCATTGAAAAGAGAGAGACAAGCAGACTCTCCTGGACCCAGGTTTCAAATGAAGTAC

AGGCCCTCAACTACAAAGTCACGAAGTTGCTTCCTGGGAACGAGTATATTTTCCGGGTTATGGCAGTGAATAAATATGGAATTGGAGAGGCCCTGGAGTC

TGAACCGGTGATAGCCTGTAACCCATACAAGCGTCCAGGTCCTCCTTCAACACCCGAGGCCTCAGCCATCACCAAAGACTCTATGGTACTAACATGGACA

CGTCCAGTGGATGACGGAGGTGCTGAAATTGAGGGGTACATTCTTGAAAAGCGAGATAAGGAAGGCATCAGATGGACCAAGTGCAACAAGAAAACATTAA

CAGACCTTCGGTTCAGGGTGACAGGCCTCACAGAAGGCCACTCCTATGAATTCAGAGTTGCTGCTGAGAACGCAGCTGGTGTCGGGGAACCCAGTGAGCC

GTCCGTTTTCTACCGTGCATGTGATGCCTTGTATCCACCAGGTCCACCAAGCAACCCCAAAGTGACAGACACCTCCAGGTCTTCTGTCTCCCTAGCATGG

AATAAGCCAATTTATGATGGTGGTGCACCCGTTAGAGGATATGTGATTGAGCTCAAAAAAGCTGCGGCTGACGAATGGACTACCTGTACGCCACCATCGG

GATTACAAGGGAAGCAGTTCACAGTGACCAAGCTTAAGGAGAATACAGAGTACAACTTCCGCATCTGTGCTTTCAATACTGAAGGTGTAGGTGAGCCTGC

AACGATACCAGGCTCCGTTGTTGCTCAGGAGAGGATGGAAGCACCAGAAATAGAACTGGATGCTGATCTCAGAAAGGTGGTCACTCTGCGTGCAAGTGCC

ACTTTGCGCCTATTTGTCACTATCAAAGGCCGCCCAGAACCTGAAGTTAAGTGGGAAAAGGCTGAAGGCATTCTCACGGAAAGAGCCCAGATCGAGGTGA

CGAGTTCTTATACAATGCTGGTGATTGACAACGTGACCAGATTTGACAGTGGTAGATACAACCTCACCCTAGAAAACAACAGTGGCTCCAAAACGGCTTT

TGTCAATGTCAGAGTTCTTGACTCACCAAGCGCACCCGTGAATCTGACCATAAGAGAAGTGAAGAAAGACTCGGTGACGCTGTCCTGGGAGCCACCACTT

ATTGACGGTGGAGCAAAGATTACAAATTATATCGTTGAAAAACGAGAAACTACAAGAAAAGCTTACGCTACCATTACAAACAACTGCACTAAGAATACTT

TCAAAATCGAAAATCTACAAGAAGGGTGTTCTTATTACTTCCGAGTCCTGGCTTCTAATGAATATGGGATTGGTTTGCCAGCCGAAACAGCAGAGCCTGT

CAAAGTGTCCGAACCACCACTCCCACCTGGAAGGGTAACCCTTGTAGATGTGACCCGTAATACAGCTACGATTAAGTGGGAGAAGCCAGAGAGCGATGGC

GGCAGCAAGATCACTGGTTATGTTGTGGAAATGCAGACAAAGGGCAGTGAAAAGTGGAGCGCATGCACACAAGTGAAGACTTTGGAGACAACTATATCTG

GCCTAACTGCAGGGGAAGAGTATGTCTTCAGGGTAGCTGCAGTTAATGAAAAAGGAAGAAGCGACCCAAGACAGCTTGGGGTGCCAGTCATTGCAAAAGA

CATTGAAATAAAGCCCTCCGTTGAGCTTCCTTTTAATACTTTCAACGTTAAGGCTAATGACCAACTCAAAATTGACATACCATTTAAAGGAAGACCTCAA

GCTACCGTGGCCTGGAAAAAAGATGGTCAGGTCCTTAGAGAGACAACTAGAGTCAACGTAGCTTCCTCAAAGACCGTAACAACCCTATCTATTAAAGAAG

CCTCAAGGGAAGATGTTGGAACTTACGAACTATGTGTTTCAAATACTGCTGGATCCATAACAGTTCCTATTACTGTCATTGTCCTTGACAGGCCAGGACC

TCCAGGACCCATACGAATTGATGAAGTTAGTTGTGACAATGTGTCTATTTCTTGGAATCCTCCAGAGTATGATGGTGGCTGCCAAATTAGCAACTACATT

GTTGAAAAGAGAGAAACCACTTCTACAACGTGGCAGGTAGTTTCACAAGCAGTGGCAAGAACATCCATTAAGATAGTCCGTCTGACAACAGGAAGTGAGT

ATCAGTTCCGTGTCTGTGCAGAGAATCGGTATGGAAAGAGTTCCTACAGTGAGTCCTCAGCCGTTGTCGCTGAGTATCCATTCAGCCCTCCTGGGCCTCC

TGGTACTCCTAAAGTTGTGCATGCCACAAAATCTACCATGGTTGTAAGCTGGCAAGTACCAGTTAATGACGGAGGGAGCCAAGTGATTGGCTATCACCTT

GAATACAAAGAAAGAAGCAGCATTCTCTGGTCAAAAGCAAACAAAGTCCTCATTGCAGATACTCAGATGAAGGTCTCTGGTCTGGATGAGGGGCTGATGT

ACGAGTATCGTGTATATGCTGAGAATATCGCTGGAATTGGTAAATGCAGTAAAGCCTGTGAACCGGTCCCTGCAAGAGACCCTTGTGACCCTCCTGGACA

ACCTGAAGTCACCAATATCACAAGAAAATCAGTGTCACTTAAGTGGTCTAAACCACGTTATGATGGTGGAGCGAAGATCACCGGATACATTGTTGAACGC

AGAGAGCTACCGGACGGCAGGTGGCTGAAGTGCAATTTCACCAACGTTCAGGAAACATACTTTGAAGTAACTGAGCTAACTGAAGACCAGCGTTATGAAT

TCCGGGTTTTTGCAAGAAATGCTGCTGATTCAGTCAGTGAGCCATCTGAATCCACTGGACCTATCACGGTGAAAGACGACGTTGAGGCGCCAAGAATTAT

GATGGATGTCAAATTCCGAGATGTCATCATTGTCAAGGCCGGAGAAGTCCTTAAGATAAATGCAGACATTGCAGGGCGACCTCTGCCGGTAATTTCCTGG

GCCAAAGATGGGGTAGAAATTGAAGAAAGGGCAAAAACAGAAATTGTCTCAACAGACTATACTACCACATTAACAGTTAAAGACTGTGTAAGAAGAGACA

CTGGGCAGTATGTCCTTACACTGAAGAATGTGGCAGGAACTCGGACTATGGCAGTTAACTGTAAAGTACTTGATAAGCCTGGCCCGCCAGCAGGGCCACT

TGAAATAAATGGCCTCACTGCTGAGAAGTGCTCCCTTTCCTGGGGACGTCCCCAGGAAGATGGCGGTGCAGATATTGATTATTATATCGTAGAAAAACGT

GAAACAAGCCGCCTTGCATGGACCATATGTGAAGCAGAGTTAAGGACAACATCTTGTAAAGTGACCAAGCTACTCAAAGGCAACGAATATATCTTCAGAG

TAACTGGTGTTAATAAATATGGTGTTGGTGAGCCCTTGGAGAGCATGGCCGTGAAGGCGCTAGATCCATTCACCACTCCTAGCCCACCCACATCTTTGGA

AATTACATCTGTGACCAAAGATTCCATGACACTTTGCTGGTCAAGACCTGAGACTGATGGAGGCAGTGACATCTCTGGATACATAATCGAAAGGCGTGAG

AAAAACAGTCTACGGTGGATGCGTGTGAACAAGAAGCCAGTGTATGATCTGAGAGTGAAGTCCACAGGACTCCGAGAAGGATGTGAATATGAGTATCGGG

TTTTTGCTGAAAATGCTGCCGGCCTGAGTCTTCCAAGTGAAACTTCTCCCTTGGTTCGAGCAGAAGACCCTGTGTTCTTGCCATCTCCTCCATCTAAACC

CAAAATAGTGGACTCGGGCAAGACAACAATCACCATTGGCTGGGTTAAACCTTTGTTTGACGGTGGGGCTCCAATAACGGGATATACCGTAGAATACAAA

AAGTCTGAGGAAACCGACTGGAAAGTTGCCATTCAGAGCTTCAGAGGCACAGAATACACAATGAGTGGGCTAACAACAGGAGACGAGTATGTTTTTAGAG

TGAGGTCACTCAATAAGATGGGTGCCAGTGACCCCAGTGATAGCTCCGATCCCCAGGTAGCCAAAGAGAGAGAAGAAGAACCTGTATTTGACGTTGACAG

TGAGATGAGGAAGACCTTGATTGTCAAGGCTGGGTCCTCGTTTACCATGACAGTTCCTTTCAGAGGAAGACCAATCCCCAACGTCTCCTGGAGTAAGCCC

GACACCGACCTCCGCACGAGAGCGTACATCGACTCCACAGATTCTCGTACATTACTTACTATTGAGAATGCCAACAGAAATGATTCTGGAAAATACACGC

TGACAATTCAGAATGTGCTGAGCGCTGCTTCCATGACCTTCGTCGTCAAAGTCTTAGATTCCCCGGGGCCTCCAGCCAATATTACTGTACGTGAAGTAAC

CAAGGAAACTGCTATGCTGTCCTGGGATGTTCCTGAAAATGATGGCGGAGCACCGGTGAAGAATTACCACATAGAAAAACGTGAGGCCAGCAAGAAGGCG

TGGGTGTCGGTCACTAACAACTGCAACCGCCTCTCTTACAAAGTGACCAACTTACAGGAAGGAGCTATCTACTACTTCCGAGTCTCTGGGGAGAACGAGT

TTGGTGTTGGTGTGCCAGCTGAGACAAAGGAAGGAGTCAAAATAACAG AAAAACCAAGCCCACCAGAAAAGCTTGGTGTAACAAGTGTATCCAAAGACA

GTGTCTCATTGAGCTGGCTGAAGCCAGAACACGACGGTGGTAGCAGAATCATACACTATGTCGTCGAAGCACTTGAAAAAGGACAGAAAACGTGGGTTAA

GTGCGCTGTGGTGAAGACAACCCACCACGTTGTTTCCGGTCTGAGAGAGAGTCATGAGTACTTCTTCCGGGTCTTTGCAGAAAACCAAGCTGGTCTGAGT

GACCCCAGGGAGCTCCTGCTTCCTGTCCTCATCAAGGACCAGCTAG AACCACCCGAAATTGATATGAAGAATTTCCCAAGTCACACTGTGTATGTAAGA

GCTGGTTCCAACCTTAAAGTTGACATTCCAATTTCTGGAAAACCATTACCCAAAGTGACCTTATCAAGAGATGGTGTACCACTGAAGGCCACCATGAGAT

TTAATACTGAGATTACCGCTGAGAACCTGACCATCAATCTCAAAGAAAGTGTTACCACTGACGCTGGAAGATATGAGATCACTGCTGCCAACTCCAGTGG

AACCACCAAAACTTTCATTAACATCATTGTGCTGGACAGGCCTGGACCCCCTACTGGCCCTGTAGCCATTAGTGATATAACTGAAGAAAGTGTGACTCTC

AAATGGGAGCCACCAAAGTATGATGGCGGAAGCCACGTCACCAATTACATTGTCCTGAAGAGAGAAACAAGTACTGCAGTGTGGTCTGAAGTGTCAGCAA

CAGTAGCAAGAACCATGATTAAAGTCATGAAACTAACCACAGGAGAAGAATACCAATTCCGCATCAAGGCAGAAAATCGCTTCGGCATCAGTGATCATAT

AGATTCAGTGTGTGTGGTTGTCAAACTACCATACA CTACACCTGGACCACCATCTACACCCTGGGTATCTAACGTTACTCGAGAAAGCATCACTGTGGG

TTGGCACGAACCAGTGTCCAATGGAGGTAGTGCAGTCACGGGCTACCACCTGGAAATGAAAGACAGAAATAGTATTTTGTGGCAGAAAGCCAACAAAATG

ATCATCCGTACAACTCACTTCAAAGTTACAACAATCAGCGCTGGACTTATTTATGAATTCAGGGTGTATGCAGAGAATGCTGCTGGTATCGGAAAGCCCA

GTCACCCATCTGAACCAGTCTTGGCCATTGATGCCTGCG AACCCCCAAGAAATGTGCGGATCACTGATATCTCAAAGAACTCTGTCAACCTTTCATGGC

AACAACCAGCTTTTGATGGAGGAAGCAAGATTACAGGCTACATTGTTGAGAGGCGCGACCTTCCAGATGGGAGATGGACCAAGGCTAGCTTCACCAATGT

TATTGAGACTCAATTCACTGTCTCTGGATTGACTCAGAATTCCCAGTATGAATTCCGGGTCTTTGCTAGAAATGCTGTTGGTTCTGTCAGCAACCCATCT

GAGGTTGTAGGCCCCATCACATGCATTGACTCTTATG GTGGGCCTGTGATTGACTTGCCTCTAGAATATACAGAAGTTGTCAAATATAGAGCAGGTACC

TCCGTGAAGCTCAGAGCTGGTATTTCCGGCAAACCCGAGCCTACGATTGAGTGGTACAAAGATGATAAAGAATTACAAACCAATGCATTGGTGTGTGTGG

AAAATAGCACTGACCTTGCATCTATACTCATCAAAGATGCCAACCGCCTTAACAGTGGAAGCTATGAGTTGAAACTGAGGAATGCCATGGGTTCCGCCTC

AGCCACCATCAGAGTACAGATCCTTG ACAAACCAGGACCTCCAGGCGGACCAATTGAATTTAAGACTGTCACTGCAGAAAAGATAACTCTGCTCTGGAG

GCCCCCAGCTGACGACGGTGGCGCAAAGATCACGCACTACATCGTGGAAAAACGGGAGACAAGCCGAGTCGTGTGGTCTATGGTGGCTGAAAATCTGGAA

GAGTGCATCGTTACAACTACCAAAATTATCAAAGGGAATGAGTACGTCTTCCGAGTCCGAGCTGTGAATAAGTATGGAATTGGCGAGCCGCTAGAATCTG

AGCCAGTTGTAGCCAAGAATGCCTTTG TTACACCTGGGCCTCCAAGCATCCCAGAGGTGACAAAGATTACCAAGAATTCAATGACTGTTGTCTGGGACA

GGCCAACTGTAGATGGTGGCAGTGAAATAAATGGCTATTTCCTTGAAAGACGAGACAAGAAGAGTCTAGCGTGGCTTAAAGTATTAAAGGAGACTATTCG

TGACACCAGACAAAAGGTGACAGGACTCACGGAAAACAGTGACTATCAGTATCGAGTCTGTGCTGTAAATGCTGCTGGAGTGGGTCCATTCTCAGAACCA

TCCGACTTCTACAAGGCTGCTGATCCAATTG ATCCTCCAGGACCACCTGCCAAGATAAGAATTGCAGACTCGACCAAATCATCCATCACCCTTGGCTGG

AGTAAGCCTGTCTATGATGGTGGCAGTGATGTTACTGGATATGTGGTTGAGATGAAACAAGGAGATGAAGAAGAATGGACCATTGTCTCTACCAGGGGAG

AGGTCAGAACTACAGAATATGTGGTCTCTAACCTGAAACCCGGAGTCAATTATTATTTCCAAGTATCAGCAGTAAACTGTGCCGGCCAAGGAGAACCTAT

AACAATGACTGAACCTGCACAGGCTAAAGATGTCCTTG AGGAACCAGAAATCGACCTAGATGTGGCTCTCAGAACATCTGTTATAGCTAAAGCTGGTGA

AGATGTCCAACTACTGATTCCCTTTAAAGGCAGACCGCCACCTACTGTCACCTGGAGGAAAGATGAGAAGAATCTTGGCAGCGATACCAGATACAGCATC

CAAAACACTGATTCGTCTTCTTTGCTTGTTATTCCTCAAGTCACTCGCAATGATACAGGAAAATACATCCTGACAATAGAAAACGGAGTAGGCCAACCAA

AGTCTTCCACCGTGAGTGTTAAGGTGCTCGACACACCAGCTGCCTGCCAGAAGTTACAGGTGAAACATGTTTCCCTAGGCACAGTCACATTGCTCTGGGA

TCCTCCTCTCATCGATGGAGGGTCTCCCATCATTAACTATGTCATCGAAAAGAGAGATGCCACGAAGAGAACATGGTCTGTTGTGTCACACAAGTGTTCC

GGCACATCCTTTAAAGTAACAGATTTATCAGAGAAGACTCCATTCTTCTTCAGGGTTCTTGCAGAAAATGAAATTGGCATTGGTGAGCCTTGCGAGACCA

CGGAGCCCGTGAAGGCTGCTGAGGTGCCAGCACCTATCCGAGATCTCTCAATGAAAGATTCCACAAAGACATCTGTTGTCCTGAGCTGGACCAAGCCTGA

CTTTGATGGTGGGAGCATCATCACAGACTATCTGGTGGAACGGAAAGGCAAAGGTGAACAAGCATGGTCCCATGCTGGCATCAGTAAGACATGTGAGATT

GAGATTGGACAACTTAAAGAGCAATCAGTCTTGGAATTCCGAGTGTCTGCTAGAAATGAGAAAGGACAGAGCGACCCTGTCACTATTGGGCCACTTACAG

TGAAGGAGCTTGTAATTACACCTGAAGTTGACTTGTCAGAAATCCCTGGGGCACAAATATCTGTGAGAATTGGACATAACGTACACCTTGAATTACCTTA

TAAAGGAAAACCCAAGCCATCCATCAGTTGGCTGAAAGATGGCTTGCCACTGAAGGAAAGTGAATATGTTCGTTTCAGTAAGACAGAAAACAAAATCACC

TTGAGTATTAAGAATTCGAAGAAAGAGCATGGAGGGAAATATACTGTTATTCTTGATAATGCAGTGTGTAGAAACTCATTCCCCATTACAATCATCACCC

TCGGCCCACCGTCAAAGCCCAAAGGACCCATTAGATTTGATGAAATCAAGGCTGACAGCGCCATCATGTCATGGGACATACCTGAAGATGACGGAGGAGG

AGAAATCACCTGTTACAGCATTGAGAAGCGGGAAGCATCACAAACAAATTGGAAGATGGTGTGTTCAAGTGTTGCCAGAACAACTTTCAAAGTTTCCAAT

CTGGTCAAAGATTCTGAATACCAGTTTAGAGTTAGAGCAGAAAATAGATATGGAGTCAGTGAGCCACTTGCCTCAAATATCATCGTGGCAAAACACCAAT

TCAGGATTCCTGGTCCTCCAGGAAAGCCAGTCATCTACAATGTAACTTCGGATGGCATGTCACTAACTTGGGATGCACCAGTTTATGATGGTGGTTCAGA

AGTTACTGGATTCCATGTTGAAAAGAAAGAAAGAAACAGCATTCTTTGGCAAAGGGTTAACACATCACCAATATCTGGGAGAGAATACAGAGCTACTGGC

TTAATAGAAGGGCTGGACTATCAATTCCGTGTATATGCTGAGAATTCTGCTGGCCTGAGCTCACCTAGTGACCCAAGCAAGTTTACATTAGCTGTTTCCC

CAGTAG ACCCACCCGGCACTCCTGACTACATTGATGTCACCCGGGAAACCATCACACTTAAATGGAACCCACCATTACGTGATGGGGGCAGTAAGATCG

TGGCCTACAGCATTGAGAAGCGGCAAGGAAGTGACCGCTGGGTGAGATGCAACTTCACTGACGTCAGTGAGTGTCAGTACACAGTTACGGGACTCAGTCC

TGGAGATCGATATGAGTTCAGAATAATTGCAAGAAATGCTGTTGGCACTATAAGCCCCCCCTCACAGTCTTCTGGCCTCATTATGACAAGAGATGAAAAC

G TTCCACCAACAGTAGAATTTGGCCCTGAGTACTTCGATGGTCTTGTTATTAAGTCTGGAGACAGTCTTAGGATCAAAGCTTTGGTTCAAGGACGACCG

GTCCCACGAGTAACTTGGTTCAAAGATGGAGTTGAAATTGAGAGGAGAATGAACATGGAAATAACTGATGTTCTTGGCTCTACCAGCCTCTTTGTCAGAG

ACGCAACTCGAGATCACCGTGGTGTTTACACCGTGGAAGCCAAAAATGTATCTGGTTCCACAAAAGCAGAAGTTACAGTGAAAGTACAAG ATACACCAG

GAAAAGTAGTCGGGCCAATAAGATTTACTAATATTACTGGTGAAAAGATGACCCTGTGGTGGGAGGCACCTCTCAATGACGGCTGCGCTCCTGTCACGCA

CTACATCATTGAAAAGCGTGAAACCAGCAGACTTGCTTGGGCATTGATTGAGGATAATTGCGAAGCCCTAAGTTACACTGCCATTAAACTAATCACTGGC

AATGAGTATCAGTTCCGGATTTCTGCAGTTAACAAGTTTGGTGTTGGCAGGCCACTTGAGTCCGACCCCGTGGTTGCTCAAATACAATACA CCATTCCA

GATGCTCCCGGAGTTCCAGAACCTAGCAATGTCACAGGCAACAGCATTACCCTGACTTGGACGAGGCCAGAATCAGATGGTGGCAGTGAGATTCAACACT

ACATCCTTGAAAGGAGAGAAAAGAAAAGCACAAGATGGGTAAAAGTGATCAGCAAACGACCAATCTCTGAGACAAGGTTCAAAGTCACAGGTCTGGTGGA

AGGCAACGAGTATGAGTTCCATGTCATGGCTGAAAACGCTGCGGGCATAGGACCAGCAAGTGGGATCTCAAGACTCATTAAATGCAGAGAGCCTGTTAAC

CCACCAAGTGCCCCCTCGGTAGTCAAAGTGACAGACACATCAAAGACAACTGTGAGCTTGGAATGGGCCAGGCCAGTCTTTGACGGCGGGATGGAGATAA

TTGGATACATAATAGAAATGTGCAAAGCTGACTTAGGGGACTGGCACAAAGTAAACACAGAGCCATGTGTGAAAACAAGATACACGGTCACTGATCTACA

GGCTGGTGAAGAATACAAATTCCGGGTCAGTGCGGTCAATGGTGCTGGGAAAGGAGACAGCTGTGAGGTGACCGGCACAATAAAAGCAGTCGATCGGTTA

TCAGCTCCCGAGTTAGACATTGATGCAAACTTCAAGCAGACTCACATTGTTAGAGCGGGAGTTAGCATTCGTCTCTTCATTGCCTACCAGGGTAGACCCA

CTCCTACAGCAGTATGGAGCAAGCCTGACTCTAACCTTAGCATCCGGGCTGATATCCACACAACAGACTCCTTCAGCACCCTCACCGTGGAAAACTGCAA

CAGAAATGATGCAGGGAAATACACACTCACGGTAGAAAACAACAGCGGTAAGAAGTCGATAACATTCACTGTAAAGGTGCTGGACTCTCCAGGACCACCT

GGTCCCATTACCTTCAAAGATGTGACCCGGGGATCTGCTACACTGATGTGGGACGCCCCTCTCCTTGATGGTGGTGCCCGGATCCATCACTATGTGATAG

AGAAGCGGGAAGCGAGTCGCCGTAGCTGGCAGGTTGTCAGTGAAAAATGCACTCGCCAGATCCTCAAGGTGAGTGAGCTGACAGAAGGTGTTCCGTACTA

TTTCCGTGTTTCTGCTGAAAATGAGTACGGTGTTGGTGAACCCTATGAAATGCCAGAACCAATTGTAGCCACAGAACAGCCCGCTCCACCTAGGAGGCTT

GATGTCGTTGACACTAGCAAATCCTCTGCGGTCCTAGCCTGGCTTAAACCCGATCATGATGGAGGTAGTCGGATCACTAGCTACCTGCTTGAAATGCGAC

AAAAGGGATCTGACTTCTGGGTTGAAGCTGGTCACACCAAACAGCTGACTTTCACAGTGGAGCGCCTCGTTGAGAATACTGAATATGAATTCCGGGTGAA

AGCCAAGAACGACGCTGGCTACAGTGAACCCAGGGAAGCCTTCTCATCTGTCATTATCAAGGAGCCTCAAATTGAGCCCACTGCTGATCTCACTGGAATC

ACCAATCAGCTCATCACTTGCAAAGCAGGAAGCACATTTACCATTGACGTGCCAATCAGTGGTCGTCCTGCCCCCAAAGTAACATGGAAGCTAGAAGAAA

TGAGACTCAAGGAGACAGATCGAATGAGTATCGCAACAACAAAAGACAGGACCACCCTGACTGTAAAGGACAGTATGAGAGGTGACTCTGGCAGATACTT

CCTGACCCTAGAAAACACAGCCGGTGTTAAAACATTTACTATCACAGTTGTGGTCATTGGAAGACCAGGGCCAGTAACTGGTCCCATTGAGGTCTCATCT

GTCTCGGCTGAATCATGTGTCCTATCATGGACTGAACCAAAAGACGATGGAGGCACTGAAATTACAAATTATATAGTTGAAAAGCGCGAGTCGGGTACCA

CCGCCTGGCAGCTTATCAATTCTAGTGTGAAGCGCACGCAGATTAAAGTCACACACCTCACAAAATACAAAGAATACTGTTTCCGGGTCAGCTCAGAGAA

TAGATTCGGGGTCAGCAAGCCTCTGGAATCAGTGCCAATAGTTGCTGAACATCCATTTG TTCCACCAAGTGCTCCTACCAGGCCTGAGGTCTACTATGT

GTCTGCCAATGCTATGTCAATTCGTTGGGAAGAACCCTACCATGATGGCGGTAGTAAAATCGTTGGCTACTGGGTTGAGAAGAAAGAACGTAACACCATT

CTTTGGGTGAAAGAAAACAAAGTGCCGTGCTTAGAGTGTAACTACAAAGTGACAGGCTTGGTAGAAGGACTGGAGTATCAGTTCCGAACATATGCACTCA

ATGCTGCGGGCGTCAGCAAGGCCAGTGAAGCTTCAAGACCTATCATGGCTCAAAATCCAGTTG ATCCACCTGGTAGGCCAGAAGTGACAGATGTCACAA

GATCAACAGTGTCACTAATTTGGTCTGCCCCAGTGTATGACGGAGGCAGCAAAGTTGTGGGCTACATCATAGAACGGAAGCCAGTCAGTGAAGTTGGAGA

TGGTCGCTGGCTGAAGTGCAACTATACCATTGTCTCTGATAATTTCTTCACTGTGACCGCTCTCAGCGAAGGGGACACTTATGAATTCCGTGTGTTGGCC

AAGAACGCAGCAGGCGTAATTAGCAAAGGCTCTGAATCTACAGGCCCTGTAACTTGCCGAGATGAATATG CTCCACCAAAAGCTGAATTGGATGCCAGG

TTACAAGGCGATCTGGTGACCATCAGAGCAGGTTCAGATCTTGTTCTTGATGCTGCTGTTGGTGGCAAACCTGAACCCAAAATCATCTGGACCAAAGGAG

ACAAGGAACTGGATCTCTGTGAAAAAATTTCTCTACAGTACACTGGCAAGCGAGCCACTGCTGTGATCAAATACTGTGACCGGAGTGACAGTGGGAAATA

CACACTGACAGTGAAGAACGCTAGTGGGACCAAGTCCGTATCTGTCATGGTCAAAGTTCTTG ATTCTCCTGGCCCATGTGGAAAACTCACTGTCAGCAG

AGTGACCGAGGAGAAGTGCACCTTAGCCTGGAGCCTTCCACAGGAAGATGGAGGAGCAGAGATAACTCACTATATTGTAGAGAGACGGGAGACTAGCAGG

CTCAATTGGGTGATCGTGGAAGGGGAATGCCTGACCGCATCCTACGTGGTTACCAGACTCATCAAGAACAATGAATACACATTCCGCGTGAGGGCAGTGA

ACAAGTACGGCCTCGGCGTGCCAGTTGAGTCAGAGCCTATTGTGGCCAGAAACTCTTTCA CGATTCCATCACAACCTGGCATACCAGAAGAAGTTGGGG

CTGGCAAAGAGCACATCATTATTCAGTGGACGAAACCTGAATCTGATGGTGGCAATGAAATCAGCAACTACCTCGTCGACAAACGGGAGAAGAAAAGCTT

GCGCTGGACCCGTGTCAACAAAGACTACGTGGTGTACGACACCAGGCTGAAGGTGACCAGCCTCATGGAAGGCTGTGATTATCAGTTCCGAGTGACTGCC

GTGAACGCTGCTGGCAACAGTGAGCCCAGTGAAGCTTCAAACTTCATCTCATGCAGAGAGCCATCAT ACACCCCTGGGCCACCTTCTGCTCCAAGAGTT

GTGGATACCACCAAGCGCAGCATTAGTTTGGCATGGACCAAGCCCATGTACGACGGTGGTACTGACATCATAGGATACGTCCTTGAAATGCAAGAGAAGG

ACACAGATCAATGGTGCCGAGTACATACAAACGCCACGATAAGAAACAACGAATTCACTGTGCCTGACCTTAAGATGGGCCAGAAGTACTCCTTCAGGGT

TGCTGCTGTGAACGCCAAGGGTATGAGTGACTACAGTGAGACGACTGCTGAAATTGAGCCCGTGGAAAGACTAG AAATACCAGATCTTGAGCTTGCAGA

TGATCTGAAGAAGACCGTGATTGTCAGGGCTGGAGCCTCCTTGCGCCTGATGGTGTCTGTCTCTGGAAGACCTTCTCCTGTCATCACGTGGAGCAAAAAA

GGCATTGACCTTGCAAATCGGGCAATTATTGACAACACAGAGAGCTACTCTTTACTCATTGTAGACAAAGTTAATCGGTATGATGCTGGAAAATACACAA

TTGAAGCTGAAAATCAGTCTGGCAAGAAATCAGCAACGGTCCTAGTTAAAGTCTATG ATACTCCTGGTCCCTGCCCTTCAGTGAGCGTTAAAGAAGTTT

CGAGAGATTCTGTGACCATCACTTGGGAAATCCCCACAATTGATGGTGGTGCTCCGGTCAACAATTACATTATTGAGAAGCGAGAAGCCGCCATGAGGGC

ATTCAAGACAGTAACCACCAAATGCAGCAAGACTCTTTACCGCATATCTGGACTCGTCGAGGGAACCATGTACTACTTTAGAGTGCTTCCAGAAAACATC

TATGGCATCGGAGAGCCTTGCGAAACATCAGACGCAGTTCTAGTCTCAGAAGTACCTTTGGTGCCCACAAAACTAGAAGTGGTTGATGTCACCAAATCCA

CTGTGACCCTTGCTTGGGAGAAACCACTCTATGACGGTGGAAGCCGACTCACCGGATATGTTCTTGAGGCCTGCAAAGCCGGCACCGAGAGATGGATGAA

AGTTGTCACTTTGAAACCCACAGTCTTAGAGCACACTGTTATTTCCCTGAATGAAGGCGAGCAGTACTTGTTTAGAGTGAGGGCTCAAAATGAGAAAGGT

GTGTCAGAACCGAGAGAGATCGTCACACCAGTGACAGTACAAGACCTCAGAG TGTTGCCAACGATTGACCTTTCCACAATGCCCCAAAAGACCATCCAT

GTCCCAGCTGGCAGACCAATTGAGCTGGTGATACCGATCACTGGTCGGCCGCCACCTACTGCTTCCTGGTTCTTTGCTGGTTCTAAACTGAGAGAATCAG

AGCGTGTCACAGTTGAAACCCACACTAAAGTCACCAAGCTAACCATCCGTGAAACTACTATAAGAGATACGGGAGAATATACGCTTGAACTAAAGAATGT

TACTGGAACCACCTCAGAGACAATAAAAGTTATTATTCTTG ACAAGCCTGGTCCACCAACTGGGCCCATCAAGATTGATGAAATTGATGCCACGTCAGT

TACGATATCCTGGGAACCTCCCGAATTGGATGGTGGTGCTCCACTGAGTGGCTATGTGGTAGAGCAGCGTGATGCTCATCGTCCAGGATGGCTGCCAGTT

TCTGAGTCTGTAACAAGACCAACGTTTAAGTTTACCAGACTCACCGAAGGAAATGAATACGTGTTCCGCGTGGCTGCAACAAACCGCTTCGGGATTGGCT

CGTACTTGCAGTCTGAGGTCATAGAATGCCGAAGCAGCATCA GTATTCCTGGACCTCCAGAAACATTACAGATATTTGATGTCTCCCGTGATGGCATGA

CACTTACATGGTATCCACCTGAAGATGATGGTGGCTCCCAAGTGACTGGATATATCGTGGAACGTAAAGAAGTAAGAGCTGATCGGTGGGTCCGTGTAAA

TAAAGTACCAGTGACTATGACCCGGTACCGCTCCACCGGCCTTATTGAAGGCTTAGAATATGAACATCGGGTCACAGCCATTAATGCAAGAGGAACTGGA

AAACCAAGTCGTCCTTCCAAACCCACCGTTGCCATGGATCCAATTG CTCCACCAGGAAAACCACAAAATCCAAGAGTTACAGATACAACAAGGACTTCA

GTCTCCCTGGCCTGGAGTGTTCCGGAAGATGAAGGTGGATCTAAAGTCACAGGGTACTTGATCGAAATGCAAAAAGTAGATCAACGTGAATGGACCAAAT

GTAACACCACCCCAACCAAGATTCGGGAGTATACCCTAACACACCTACCTCAGGGCGCTGAATACAGATTCCGTGTCCTAGCCTGTAATGCTGGTGGACC

TGGAGAACCTGCTGAGGTACCAGGAACCGTCAAAGTCACAGAGATGCTGG AATACCCTGACTATGAACTTGATGAGAGATACCAGGAAGGTGTCTTTGT

TCGACAAGGTGGGGTCATCAGGCTTACCATCCCAATCAAAGGAAAACCATTCCCAGTATGTAAATGGACCAAGGAAGGCCAAGACATTAGTAAGCGTGCC

ATGATTGCAACATCGGAAACACATACTGAGCTTGTGATCAAAGAAGCAGACAGAAACGATTCTGGAACTTACGACTTGGTTCTGGAAAACAAATGTGGCA

AGAAGACCGTTTACATTAAGGTCAAGGTGATAGGAAGTCCCAACACTCCAGAAGGGCCACTGGAATACGATGACATACAAGCCCGCTCTGTAAGGGTCAG

CTGGAGACCTCCTGCTGACGATGGTGGTGCTGACATCCTGGGCTACATCCTTGAGAGAAGAGAGGTACCTAAGGCTGCCTGGTATACCATTGACTCCAGA

GTCCGAGGCACATCTCTGGTGGTGAAAGGCCTCAAAGAAAACGTGGAATACCATTTCCGTGTCTCAGCAGAAAACCAGTTTGGCATAAGCAAACCCTTGA

AATCTGAGGAGCCAGTCATACCAAAGACACCACTGA ATCCACCAGAACCACCAAGCAATCCTCCTGAAGTACTTGATGTGACCAAAAGTTCCGTTAGCT

TGTCATGGTCTCGACCTAAAGATGACGGCGGCTCTCGAGTGACGGGCTACTACATTGAGCGCAAGGAGACATCCACTGACAAGTGGGTCAGACACAACAA

AACCCAGATAACCACCACGATGTACACTGTCACCGGCCTCGTTCCCGATGCTGAGTACCAGTTCCGCATCATCGCACAGAATGACGTTGGCCTTAGTGAG

ACCAGCCCTGCTTCTGAACCTGTTGTTTGCAAAGATCCCTTTG ATAAGCCAAGCCAACCAGGAGAACTTGAGATTCTCTCGATATCCAAAGACAGTGTC

ACCCTCCAGTGGGAGAAACCCGAATGTGATGGTGGCAAAGAAATCCTTGGATACTGGGTTGAATACAGACAGTCTGGAGACAGTGCTTGGAAGAAGAGCA

ATAAGGAACGGATCAAGGACAGACAGTTCACCATCGGCGGTTTGCTAGAAGCTACTGAATATGAGTTCCGAGTATTTGCTGAGAACGAGACTGGGCTCAG

CCGACCACGTAGAACAGCTATGTCTGTCAAGACTAAACTAACAT CTGGAGAAGCCCCAGGAGTGCGCAAAGAAATGGCTGATGTGACCACCAAATTAGG

TGAAGCTGCACAACTCTCATGCCAGATAGTTGGAAGGCCCCTTCCTGACATTAAATGGTACCGGTTTGGTAAAGAGCTCATACAAAGCCGGAAGTACAAA

ATGTCCTCAGATGGGCGCACGCATACTCTGACAGTAATGACAGATGAACAAGAAGATGAAGGTGTTTATACATGTGTAGCCACAAATGAAGTAGGAGAAG

TAGAAAGCAGCAGCAAGCTTCTTCTGCAAGCGGCACCACAGTTCCATCCTGGTTACCCACTGAAAGAGAAGTATTACGGGGCCGTGGGGTCTACGCTTCG

GCTCCACGTTATGTATATTGGCCGCCCAGTACCTGCCATGACTTGGTTCCATGGCCAGAAACTTTTGCAAAACTCAGAAAAAATCACCATTGAAAACACT

GAGCACTATACTCACCTTGTCATGAAGAATGTCCAACGAAAGACTCATGCTGGGAAATACAAGGTTCAGCTCAGCAATGCCTTTGGGACAGTGGATGCCA

CCCTAGATGTGGAAATACAAG ATAAACCAGACAAGCCTACTGGACCCATTGTGATTGAAGCACTACTCAAGAACTCGGTGGTGATCAGCTGGAAACCAC

CTGCTGATGATGGCGGCTCCTGGATCACCAATTACGTGGTAGAGAAATGTGAGGCCAAAGAAGGTGCTGAATGGCAATTGGTGTCTTCAGCCATCTCGGT

GACAACCTGCAGAATTGTGAACCTCACAGAGAATGCCGGCTACTATTTCCGGGTCTCAGCTCAGAACACCTTTGGCATCAGTGAGCCACTAGAGGTCGCC

TCCATTGTGATCATCAAGAGTCCATTCG AAAAGCCAGGTGTTCCTGGTAAACCAACCATCACTGCTGTCACAAAGGATTCTTGTGTTGTGGCTTGGAAG

CCACCTGCAAGCGATGGCGGTGCAAAGATCAGAAATTACTACCTTGAGAGGCGCGAGAAGAAGCAAAACAAGTGGATTGCTGTGACGACAGAGGAAATTC

GAGAAACCGTCTTCTCAGTGCAAAACCTTATTGAAGGTCTTGAATATGAGTTCCGTGTGAAATGTGAAAACCTGGGTGGAGAGAGTGAATGGAGTGAAAT

ATCAGAACCCGTCACTCCAAAATCCGACGTCCCGATTCAGGCTCCACACTTCAAGGAGGAGCTGAGAAACCTGAATGTAAGGTATCAGAGCAACGCCACT

CTGGTCTGCAAGGTGACCGGTCACCCAAAGCCTATTGTGAAATGGTACAGACAAGGCAAAGAAATTATCGCCGATGGACTCAAGTACAGGATTCAAGAAT

TTAAGGGCGGTTACCACCAGCTCATCATTGCAAGCGTCACAGATGATGATGCCACGGTGTACCAAGTCAGAGCCACCAACCAAGGGGGCTCCGTGTCTGG

CACTGCTTCCTTGGAAGTGGAAG TTCCAGCTAAGATACACTTGCCCAAGACTCTCGAAGGCATGGGAGCGGTCCATGCTCTCCGAGGGGAAGTGGTTAG

CATCAAGATCCCCTTCAGTGGTAAGCCAGACCCCGTGATCACCTGGCAGAAAGGACAAGATCTCATCGACAATAATGGCCACTACCAAGTGATTGTCACA

AGATCCTTCACGTCACTTGTCTTCTCCAATGGAGTGGAGAGAAAAGATGCTGGCTTCTATGTCGTCTGTGCTAAAAACAGATTTGGAATTGATCAAAAGA

CAGTCGAACTGGATGTGGCTGATGTCCCCGACCCACCCAGGGGTGTCAAAGTTAGTGACGTCTCACGCGATTCTGTCAACTTAACATGGACAGAGCCAGC

TTCTGATGGTGGTAGCAAGGTCACCAACTACATCGTGGAAAAGTGTGCAACTACTGCAGAAAGATGGCTCCGAGTGGGACAGGCCCGAGAAACCCGTTAC

ACTGTGATCAACTTGTTTGGAAAAACAAGTTACCAGTTCCGAGTAATAGCTGAAAATAAATTTGGCCTGAGCAAGCCATCAGAGCCCTCAGAACCAACCG

TTACCAAAGAAGATAAGACCAGAGCTATGAATTATGATGATGAGGTGGATGAAACCAGAGAGGTCACCACGACTAAAGCATCACACTCCAAAACTAAAGA

ACTCTACGAGAAATACATGATAGCTGAAGATCTGGGGCGTGGTGAGTTTGGAATTGTCCACCGTTGCGTTGAAACATCCTCAAAGAGGACATTCATGGCC

AAATTTGTTAAAGTCAAAGGAACCGATCAGGTTTTAGTCAAGAAAGAGATTTCCATTCTAAACATTGCTAGGCACAGGAACATCTTATACCTCCATGAAT

CATTTGAAAGCATGGAAGAGTTAGTTATGATCTTTGAATTTATATCAGGACTCGACATATTTGAACGCATCAACACGAGCGCCTTTGAGCTTAATGAAAG

AGAAATTGTAAGCTATGTCCGCCAAGTCTGCGAAGCACTGGAGTTCTTACATAGCCAGAATATTGGCCACTTTGACATTCGACCAGAAAATATCATTTAC

CAGACAAGAAAGAACTCCACTATTAAAATAATAGAGTTTGGTCAAGCCCGTCAGCTGAAGCCAGGAGACAACTTTAGGCTGCTGTTCACTGCCCCTGAAT

ACTATGCCCCTGAAGTCCACCAGCATGATGTTGTCAGCACTGCCACAGACATGTGGTCGCTTGGTACATTGGTGTATGTGCTACTGAGTGGAATCAACCC

ATTTTTGGCTGAAACTAACCAACAGATGATTGAGAACATCATGAACGCTGAATATACTTTTGATGAAGAAGCCTTCAAAGAAATTAGCCTTGAAGCGATG

GATTTTGTCGACCGGCTATTGGTGAAAGAGCGAAAATCTCGCATGACAGCATCAGAGGCCCTGCAGCACCCATGGCTGAAGCAAAGGATCGACAGAGTCA

GTACTAAAGTCATCAGAACACTGAAACACCGGCGGTACTACCACACCCTGATAAAGAAAGACCTCAATATGGTTGTATCAGCAGCCCGGATCTCCTGTGG

TGGTGCAATACGATCTCAGAGGGGAGTGAGCGTGGCTAAAGTTAAAGTTGCATCCATTGAAATTGGTCCGGTCTCTGGGCAAATAATGCACGCCATTGGC

GAAGAAGGCGGGTATGTCAAATATGTTTGCAAGATCGAAAATTATGATCAGTCTACCCAGGTGACCTGGTACTTTGGCGTGAGACAGCTGGAAAACAGTG

AGAAATATGAAATCACCTATGAAGATGGAGTGGCCACCATGTATGTCAAAGACATCACCAAATTTGATGATGGGACCTACAGATGCAAAGTCGTCAATGA

CTACGGTGAAGATAGCTCTTACGCAGAGCTGTTCGTTAAAGGAGTGAGGGAAGTTTATGACTACTATTGCCGCCGAACCAAGAAAGTCAAGCGCAGAACA

GATGCGATGCGGCTCCTTGAAAGGCCACCAGAATTTACCCTGCCTCTCTATAACAAGACGGCATACGTGGGTGAAAATGTCCGTTTTGGAGTAACTATTA

CCGTCCACCCAGAACCTCGTGTGACGTGGTATAAATCAGGTCAGAAAATCAAGCCAGGTGATGATGAAAAGAAATACACATTCGAGTCTGACAAGGGTCT

TTATCAATTAACAATCAACAGCGTGACCACAGACGATGATGCTGAATACACCGTTGTGGCAAGGAACAAACATGGTGAAGACAGCTGTAAAGCAAAGCTG

ACGGTGACTTTACATCCACCCCCGACGGAAACCACGCTCAGACCCATGTTCAAGCGGCTGCTGGCAAATGCCGAATGCCATGAAGGCCAAAGTGTCTGCT

TTGAGATCAGAGTTTCTGGCATCCCTGCACCAACATTAAAATGGGAGAAGGATGGCCAGCCGCTGTCCCTCGGGCCCCACATTGAAATTGTCCATGAAGG

CTTAGATTATTATGCACTGCATATCAGGGACACTTTGCCGGAAGACACAGGTTATTACAGAGTCACGGCCACAAACACGGCCGGATCCACCAGCTGCCAG

GCTCACTTACAGGTAGAGCGGTTGCGCTACGTAAAGCAGGAATTCCAGAGTAAAGAGGAACGTGAGCGCCATGTCCAAAAACAGATTGACAAGACACTGA

GGATGGCTGAAATCCTTTCTGGAACTGAAACTGTGCCATTGACTCCCGTAGCCCAAGAGGCTCTGCGAGAAGCTGCCATTCTTTACAAACCAGCAGTGAG

CACCAAGACTGTCAAAGGAGAATACCGACTTCAGACGGAGGAAAAGAAAGAGGAGAGAAAACTCCGCATGCCTTACGAAGTCCCAGAGCCCCGCAGGTTC

AAACAAGCCACAGTAGAAGAAGACCAGCGCATCAAGCAGTTCGTGCCTATGTCTGACATGAAGTGGTATAAGAAGATCCGGGATCAATATGAAATGCCTG

GGAAACTTGACAGAGTTGTCCAGAAAAGGCCCAAGCGCATCCGCCTTTCAAGATGGGAACAGTTCTATGTGATGCCTCTTCCTCGCATTACTGACCAATA

CCGACCTAAATGGCGGATCCCCAAACTGACCCAAGACGATCTGGAAATGGTGAGGCCGGCCCGACGGCGTACCCCTTCCCCAGATTATGATCTTTACTAT

TATAGAAGGAGGAGACGCTCTCTGGGTGACATGTCAGATGAGGAACTGCTCCTCCCCATTGATGACTACCTGGCGATGAAGAGAACCGAGGAAGAGAGGC

TGCGTCTGGAGGAGGAGCTTGAACTGGGCTTCTCGGCTTCACCTCCCAGCCGAAGCCCCCCGAGGTTTGAGCTGTCTAGCCTGCGCTATTCTTCACCGCC

AGCTCATGTCAAGGTGGAAGACAGAAGAAGAGACTTCAGGTACTCGACCTATCACGTCCCCACAAAGGAGGAAACCAGCACGAGTTATGCAGAGCTGCGG

GAACGGCATGCCCAGGCCTCATACAGGCAGCCGAAGCTACGGCAGAGAATCATGGCCGAGAAGGAGGAAGAGGAGCTACTGCGGCCAGTGACAACCACCC

AGCGTCTCTCAGAATACAAGAGTGAGCTGGACTACATGTCAAAAGAAGAAAAGTCTAAAAAGAAATCAAAACGACAGAGACAAGTGACAGAAATAACGGA

AATCGAAGAGGAATACGAAATCTCAAGACGGGCTCAAAGGGAATCATCCTCCTCCGTGTCCAGACTACTGAGACGCCGTCGCTCCTTGTCTCCAACTTAT

ATTGAGTTAATGAGACCAGTGTCTGAGCTGATTCGGTCCCATCCACGACCTGCTGAGGAATATGAAGATGATGCAGAAAGAAGGTCTCCTACTCCAGAGA

GAACTCGCCCACGTTCTCCCAGCCCTGTGTCTAGCGAGCGATCCCTCTCAAGATTTGAGAGGTCTGCAAGATTTGACATCTTCTCCAGGTACGAGTCCAT

GAAAGCTGCCTTAAAAACTCAGAAGACATCGGAAAGGAAGTATGAGGTTTTGAGTCAGCAGCCTTTCACACTGGACCATGCCCCTCGAATCACACTGCGG

ATGCGCTCCCACAGGGTTCCCTGTGGCCAAAACACACGCTTCATCCTAAACGTCCAGTCGAAGCCGACTGCCGAAGTTAAATGGTACCACAATGGTGTAG

AACTCCAAGAGAGCAGTAAGATTCATTACACCAACACAAGTGGGGTCCTGACCTTGGAGATTCTGGACTGCCAGACTGAGGACGGTGGAACCTACCGTGC

CGTGTGCACCAACTACAAAGGAGAGGCATCAGACTACGCAACCCTGGATGTAACTGGCGGAGCTTATACCACCTATGCATCCCAGCGCAGAGATGAGGAG

GTCCCCAAGTCAGTCTTCCCTGAACTGACAAAAACAGAGGCATATGCAGTCTCGTCGTTCAAGAGAACATCTGAGCTGGAAGCTGCTTCTTCAGTCAGGG

AAGTGAAGTCACAAATGACAGAGACGAGGGAAAGTCTCTCAACCTATGAGCATTACGCCTCTGCGGAAATGAAAAGCGCCACATCAGAGGAAAAGTCACT

GGAAGAAAAAGCCACGGTGAGAAAGATTAAGACAACACTGGCAGCAAGAATTTTAACCAAGCCACGCTCCATAACTGTCCATGAAGGTGAGTCTGCGAGG

TTTTCCTGCGACACTGATGGGGAGCCGGTACCAACAGTGACCTGGCTGCGTGAAGGACAAGTGGTGAGTACTTCTGCTCGCCACCAAGTGACCACCACCA

AGTACAAGTCGACCTTTGAGATTTCTTCAGTTCAGGCCTCTGATGAGGGCAACTACAGCGTGGTAGTTGAAAACAGCGATGGGAAGCAAGAAGCACAGTT

CACCCTGACCGTGCAAAAGGCCAGGGTTATTGAAAAGGCTGTGACGTCACCACCCAGAGTCAAGTCCCCAGAGCCTCGGGTGAAGTCCCCAGAAACAGTG

AAGTCTCCCAAAAGAGTGAAATCTCCAGAACCAGTAACTTCTCATCCAAAAGCCGTGTCACCCACAGAGACAAAGCCAACAGAGAAGGGTCAACATCTCC

CAGTCTCTGCCCCACCAAAGATAACTCAGTCCCTGAAAGCAGAAGCTTCTAAAGACATTGCAAAGCTGACCTGTGCGGTTGAAAGTAGTGCACTGTGTGC

AAAAGAGGTCGCCTGGTATAAAGATGGCAAGAAACTCAAGGAAAATGGGCATTTTCAATTTCATTACTCAGCAGATGGGACCTACGAACTCAAAATTCAC

AACCTTAGCGAATCTGATTGCGGAGAGTATGTTTGTGAGGTCTCTGGTGAAGGAGGAACTTCCAAAACCAGCTTCCAGTTTACTGGACAATCCTTCAAGA

GTATCCATGAGCAGGTGTCAAGCATATCAGAAACTACAAAATCGGTTCAGAAAACTGCTGA GTCACCAGAAGCCAAGAAGCAGGAACCAATAGCTCCTG

AATCAATTTCCTCAAAGCCAGTAATTGTTACTGGGCTGCGGGATACAACAGTTTCTTCAGACAGTGTTGCTAAATTTACAATTAAAGTTACTGGAGAGCC

CCAGCCAACTATCACCTGGACAAAGGATGGAAAG GCTATTGCACAAGGCAGTAAATACAAACTCTCTAGCAACAAAGAAGAATTCATCTTAGAAATCCT

CAAGACCGAGACATCTGATGGCGGACTTTACGCCTGTACAGTAACAAATTCTGCTGGATCTGTGTCCTCGAGCTGCAAGCTGACAATAAAAG CTGTAAA

AGACACCGAGGCACAGAAAGTATCTACCCAGAAGACCTCCGAAGTCACATCTCAGAAGAAAGCGAGTGCCCAAGAGGAAATTTCTCAAAAAGCCCTAACT

TCTGAAGAAATCAAAATGTCAGAAGTAAAATCTCATGAAACGCTGGCCATCAAGGAGGAAGCGTCCAAAGTTCTGATTGCTGAGGAGGTCAAGAGGTCAG

CAGCAGCCTCCCTGGAGAAATCCATCGTCCATGAAGAAGTCACCAAAACCTCACAGGCATCCGAAGAAGTCAAAACTCACGCGGAGATCAAAACACTGTC

TACCCAGATGAACATAACCAAGGGCCAGCGAGCGACCCTGAAAGCCAACATTGCTGGGGCCACAGATGTGAAATGGGTCCTGAACGGCACTGAGCTTCCG

AACTCAGAGGAATACAGATACGGGGTATCTGGCAGTGACCAAACTCTCACCATCAAACAAGCCAGTCACAGAGAGGAAGGGATCCTCAGCTGCATAGGCA

AAACCAGCCAGGGAGTTGTCAAGTGTCAGTTTGACTTGACCCTGAGTGAAGAACTCTCGGATGCTCCAAGCTTCATCACACAGCCCAGATCTCAAAACAT

TAACGAGGGACAAAATGTTCTCTTTTCTTGTGAGGTCAGCGGGGAGCCGTCCCCTGAAATTGAGTGGTTTAAAAATAACCTTCCA ATTTCCATTTCTTC

AAATATCAGTGTGAGTCGCTCCAGAAACGTGTACACTCTTGAAATCCGAAATGCGGCTGTAAGTGACAGCGGAAAGTACACAATTAAGGCTAAGAATTTC

CACGGCCAGTGCTCTGCAACAGCGTCCCTCACAGTGCTCC CTCTGGTGGAAGAACCACCGAGAGAGGTGGTATTGAAAACGAGCAGTGACGTGAGCTTG

CACGGAAGCGTCTCGTCTCAGTCAGTCCAAATGTCTGCCTCTAAGCAGGAGGCATCCTTCAGCAGCTTCAGCAGCAGCAGCGCTAGCAGCATGACTGAAA

TGAAGTTTGCGAGCATGTCTGCCCAAAGCATGTCTTCCATGCAAGAGTCCTTTGTAGAAATGAGTTCCAGCAGTTTTATGGGAAAATCTAGCATGACACA

ACTGGAAAGCTCAACCAGTAGAATGCTCAAAGCAGGCGGAAGAG GAATTCCACCTAAAATTGAAGCTCTTCCCTCTGATATCAGCATCGACGAAGGCAA

AGTCCTAACAGTAGCCTGTGCCTTTACTGGGGAGCCTACTCCAGAAATAACATGGTCCTGTGGTGGAAGGAAAATCCAAAACCAAGAACAACAAGGAAGA

TTCCACATTGAAAACACAGATGACCTGACCACCCTGATCATCATGGACGTACAGAAACAAGATGGCGGACTTTATACCCTAAGCTTAGGGAATGAATTTG

GATCTGACTCTGCCACTGTGAATATTAATATCCGTTCTATGTAAGAGGGCCAGGGCCAAGAGCGGGGGCCCTTTACACTCGATGCTCATTCATAATCTCT

CTCAAATGATTCACATGAACTAATCTTTCTGACCTGTAAATATTTTTAAGTAGTTTTATATCCATCTGAATGAGTCACAGTTCCAAAACTATGCATTTCA

ATCCTTTCATACTTGACCTGAGAATATTTGCTAATGACACACATGTACATACTGTATATAGCCGGGTTCACGGTTATAAAGTTTTGTACCATTTTATTTT

ATGACATTTTACACTGTAACTTTTGAAACTAACTGTTGGTGGGAGAAAGTTTCTTATAGATTATAGAACGAATACCCTGCCAATACTTAATCAATCTTTG

TGCCTCAACATACTGTTGATGTCTAAGTATGCCTCAGTGGGTTGAGAAATTCCCCACTGAAGATGTCCTATCCACCTAAAAAAAAAAGGATGCTTCTGTA

CATGTCCCTGACATGTGCACTGACACCTATTGAATCAGAAATGTAAGGCATTGGTGATGTTTGCATCTACCCTCCTGTAAGCAACACTTTAACGTCTTAC

GTTTTCTCTGATGATGTCACACTGAAAATTATCATGACAAATATAACCAGAGCAAAGTGTAACGGCCATACACTTTGTTCGCCCACTTCACACTGTCTCT

GGCATACAGAGTGCATGGATAGCTTGGGAAATGTACCATCTCCTGGCCATCCCCTCGTCTAACCAAGCTATGCAAGTATTCCTATGCCAGAGCGGTGTCG

ACTCCTGGAGGTCCCAGGTGCAGCTCCTGCCTTGTGTGGTAGTTCTAAATTCAAATTTCACCGGGAACTGGGCAACTAAGCAATGAGCCACAGCAAAATA

ATAATAATAATAATTTAAAAAAATGTAACAAGTGAAGCTGTCGTTAAAACAACAATACTACCAACTGCCCATAAAAAAAAAAATTACTAATTTGATGTAG

TCCTTTTCATGCCAGTATATGTTCAATTGGTAGTTATAAATGTTGGACCTCCTTGAGATTAAAAAAAAATAAAGCAAGCTATCTGCACCTCAAAA
Translation
 MTTQAPMFTQPLQSVVVLEGSTATFEAHVSG GSPVPEVSWFRDGQVISTSTLPGVQISFSDGRARLMIPAVTKANSGRYSLRATNGSGQATSTAELLV

TA AETAPPNFSQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELVVQG

 GEEVVPAKKTKTIVSTAQISETRQTRIEK KIEAHFDARSIATVEMVIDGATGQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPV

RHVRAPTPSPVR RSVSPAGRISTSPIRSVKSPLLIRKTQTTTMATGPEVPPPWKQEGYVASSTEAEMRETTMTSSTQIRREERWEGRYGVQEQVTISGA

AAAAASASVSSSFTAGAITTGTKE VKQETDKSAAVATVVAAVDMARVREPAISAVEQTAQRTTTTAVHIQPAQEQ ARKEAEKTAVTKVVVAADKAKEQ

ELKSRTREVMVTTQEQTHISHEQ IRKETEKAFVPKVVISATKAKEQETRITGEITTKQEQKRITQET IRQETEEIAASMVVVATAKSTKLEAAVGVQE

ETAIQQDQMHLTHEQ MMKETRKTVVPKVIVATPKIKEQDLVSRSREAITTKRDQVQITQEK KRKEVETTALSTIAVATAKAKEQETVLRSREAMATRQ

EHIQVTHGQ VGVGKKAEAVATVVAAVDQARVREPREPTHVEESHSQQTTLEYGYKEHISTTKVPEQPRRPASEPHVVPQAVKPAVIQAPSETHIKTTDQ

MGMHISSQ VKKTTDISTERLVHVDKRPRTASPHFTVSKISVPKTEHGYE ASIAGSAIATLQKELSATSSTQKITKSVKAPTVKPGETRVRAEPTPSPQ

FPFADMPPPDTYKSQAGIEVKKEVGVSISGSTVREEHFEVLRGREAK VTETARVPAPAEVPVTPPTLVS GLKNVTVIEGESVTLECHISGYPSPKVTW

YREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQV VSEEFDKETTLTEKFATEEKR RFVESRDVVMTDTSITEEQ

AGPGEPAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSGVPLTTGYR RYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASL

LEEA ADYEALVKTQQEMLYQTQMSTFIQEPKVGEIAPGFAYSEYEKEYEKEQALIRKKMAKDTVMVRTFVEDQ EFHISSFEERLIKEIEYRIIKTTLE

ELLEEDGEEKMAVDISESEAIESGFDIRIKNYRILEGMGVTFHCKMSGYPLPK IAWYKDGKRIRHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFAS

NIKGNAICSGKLYVEPAAPFSAPTYMPTPEAVSRIR RSVSPRSLSRSPIRMSPAMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVL

KPASFKCLEGQTARFDLKVVGRPMPETFWFHNG GQQIVNDYTHKVVIKEDGTQSLIIVPASPSDSGEWTVVAQNRAGKSTISVTLTVEA AVEHQIKPA

FVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRIR RIEGTRGEAALKIDSIISQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPE

PERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMIN

EFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSATLIVKDEKSLVEESQLPDGKKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEPVRVLEG

ETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGVTEHKVKLEIQQREDFRSVLRRAPEPKPEFHVHEPG

KLQFEVQKVDRPVDTSETKEVVKLKRAERITHEKVSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLKKTKDELLHWTKELTEEEKKALAE

EGKITIPTFKPERIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAIN

IAGETSSHAFLLVQA AKQLITFTQELQDVVAKEKDTMATFECETSEPFIKVKWYKDGIEVHAGDKYRMHSDRKVHFLSVLTIDTSDAEDYSCVLVEDEN

IKTTAKLIVEG GAVVEFVKELQDIEVPESYSGELECIISPENIEGKWYHNDVELKSNGKYSITSRRGRQNLTVKDVTKEDQGEYSFVVDGKKTTCKLKM

KP PRPIAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWMKDGQEVQHSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGNVSVYS SVDV

ITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQSIVKGTKQRLVINRTHASDEGPYKLMVGRVETSCNLSVEK KIKIIRGLRDLTCT

ETQNVVFEVELSHSGIDVVWNFKGKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGEYAFYAGENTTSGKLTVAG GGAISTPLTDQTVAESQEAVFECEV

ANPESEGEWLKDGKHLALSNNFRGESDGHKRRLVIAAAKLDDAGEYTYKVATSKTSAKLKVEA AVKIKKTLRNLTVTETQDAVFSVELTHPDVKGVQWI

KNGVVLDSNDKYEISVKGTLYSLKIKNCAMADESVYGFKLGRLGASARLHVET TVKIIKKPKDVTALENATVTFEVSVSHDTVPVKWFHKNVEIKPSDK

HRLVSERKVHKLMLQSISPSDAGEYTAMVGQLECKAKLFVET TLHITKTMKSIEVPETKAASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQ

LIIMNTSTEDSAEYTFVCGNDQVSATLTVTP PIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDRCQMRTKKLTHSLNIRNVHFGDA

ADYTFVAGKATSTATLYVEA ARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDGQELQIADR RIKIQKEKYVHRLLIPSTRMSDAGKYTVVA

GGNMSTANLFVEGRDVRIRSIKKEVQ VIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSVT

LYVNA APEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV

EV VPEVVSPDQEMPVYPPAIVTPLQDTVTSEGRPARFQCQVSGTD DLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYAFVANNAVGQ

VSSTATLRLEA APESILHERIGQQIEMEMKE EIASLLSAEEDFQTYSSDLRLPNANETLELLSEPPARSTQFDSRQEGAAPVFIREISDVEISVEDVA

KLSVTVTGCPKPKIQWFFNGMLLTPSADYKFVFDGDTHSLIILFTRFQDEGEYTCLASNEYGKAVCSAHLRISPRGERSTEMESGEKKALEKPKGPCPPY

FFKELKPVHCGPGIPAVFEYSVHGEPAPTVLWFKEDMPLYTSVCYTIIHSPDGSGTFIVNDPQRGDSGLYLCKAQNLWGESTCAAELLVLPEDTDVPDAS

CKEESTLGVPGDFLETSARGPLVQGVDSRQEITAFAEGTISKAALIAEETLQLSYERSVDDSEVGTGVTIGAQKLPPVVLSTPQGTGELPSIDGAVHTQP

GRGPPPTLNLQAVQAQTTLPKEATLQFEEPEGVFPGASSAAQVSPVTIKPLITLTAEPKGNYPQSSTAAPDHALLSSVAAETLQLGEKKIPEVDKAQRAL

LLSQSLAEGCVESLEVPDVAVSNMRSEPQVPFQHTCTEGKILMASADTLKSTGQDVALRTEEGKSLSFPLALEEKQVLLKEEQSEVVAVPTSQTSKSEKE

PEAIKGVKEVREQELLSKETLFPSMPEEQRLHLKTQVRRALQAAVAREQANLFSEWLRNIDKVEVTAVNFTQEPKRILCTYLITSVSSLTEELTVTIEDI

DPQMANLETGLKDALCSIVCEERNILMAEDPRIHEEDKIDVQGGRDHLSDAQKVETVIEAEADSKYLVSKEEVSWSKVESQLKDGDTNEVPQAETLKLAE

ESGTQKTSTEMSQEEAEGTLADLCPAVLKHLVDTISEEGDTVHLTSSISNAKEVHWYFKGNLVPSDGKFKCLKEQNAYTLVIEAVKTEDEGEYVCEASND

SGKAKTSAKLTVGERA AAPVIKRRIEPLEVALGHLAKFTCEIQGAPNVRFQWFKAGREIYESDKCSIRSSNYVSSLEILRTQVVDCGEYTCKASNEYGS

VSCTATLTVTE EAYPPTFLSRPKALTTFVGKAAKFLCTVSGTPVIEIIWQKDGAALSPSPDCRVTDADNKHSLELSNLTVQDRGIYSCKASNKFGADIC

QAELTIIDKPHFIKELEAVQSAINKKIHLECQVDEDRKVTITWSKDGQKLPAGKDYKIYFEDKIASLEIPLAKLKDSGTYTCTASNEAGSSSSSAAVAVR

E EPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMSFVNSEAILDITDVKVDDSGTYSCEATNDVGSDSCSTEVVIKE EP

PSFIKTLEPADIVRGANALLQCEIAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHLLKE EPPTFVK

KVDDFTALAGQTVTLQAAVRGSEPISVMWMKGQEVIKEDGKIKMSFSNGVAVLTIPDVQISLGGKYTCLAENEAGSQTSVGELIVKE EPAKIIERAELI

QVTAGDPATLEYTVSGTPELKPKWYKDGRPLVASKKYRISFKNNIAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLD DRDIAPLFTKPLRNVDS

VVGGACRLDCKIAGSLPMRVSWFKDGKELTASDRYQIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSKDSSGALIVQE EPPSFVTKPGSRDVLPGSA

VCLKSAFQGSAPLTIKWFKGDKELVSGGSCYITKETSESSLELYAVKTSDSGTYTCKVSNVAGSVECSADLFVKE EPATFIEKLEPSQLLKKGDGTQLA

CKVTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCTGIVIVKE ESPYFTKEFKSIEVLKEYDVMLLAEVAG

TPPFEITWFKDNTTLRSGRKYKTFLQDQLVSLQVLKFVAADAGEYQCRVTNEVGSSTCSARVTLRE EPPSFIKKIEATSSLRGGTAAFQATLKGSLPIT

VTWLKDNDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKE EPATIMEEAVSIDVTQGDPATLQVKFSGTKEISAKWFK

DGQELTLGPKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKASINVLD DLIIPPSFTKKLRKMDSIKGSFIDLECIVAGSHPISIQWFKDD

QEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHSQCSGHLTVKE EPPYFVEKPQSQDVNPGTRVQLKALVGGTAPMTIKWFKDNKELHP

GAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKATIFVKE EPPQFIKKPSPVLVLRNGQSTTFECQVTGTPEIRVSWYLDGNEITDLRKY

GISFVDGLATFQISNARVENSGTYVCEARNDAGTASCSIELKVKE EPPIFIRELEPVEVVKDSDVELECEVMGTTPFEVTWLKNNKEIRSGKKYTMSEK

MSVFYLHITKCDPSDVGEYQCIIANEGGSCACSARVALKE EPPSFIKKIENVTTVLKSSATFQSTVAGSPPISITWLKDDQILEENDNVHISFEDSVAT

LQVRSVDNGHSGRYTCQAKNESGIERCYAFLLVQE EPAQIIEKAKSVDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQS

VMKQDSGQYTFKVENDFGSSSCDAYLRVLD DQDIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHENTVSLEVSNLE

LEDTANYTCKVSNVAGDNACSGILTVKE EPPSFLVKPERQQAIPDSTVEFKAVLKGTPPFKIKWLKDDVELVSGPKCFIGLEGSTSFLNLYSVDSSKTG

QYTCQVTNDVGSDSCTTMLLVTE EPPKFVKKLEASKIIKAGDSARLECKITGSPEIQVVWYRNEHELTASDKYQMTFIDSVAVIQMNSLGTEDSGDFIC

EAQNPAGSTSCSTKVIVKE EPPVFSSFPPIVETLKNTEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNE

VGSDACVCAVKLKE EPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKNDGGVR

ENMATLTVLE EPAVIIEKAGSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLKILSVEKEDAGTYTFQVQNNVGKSSCTAV

VDVSD DRMVPPSFTRRLKDTGGVLGTSCILECKVAGSSPISIAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGSYTCVAANVAGSDECRALLT

VQE EPPSFVKEPEPLEVLPGKNITFTSVIRGTPPFKVGWFRGARELVKGNRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKE E

PATFVKKLSDHSVEPGKSIILEGTYTGTLPISVTWKKDGVSITPSERCNIVTTEKTCILEILSSTKGDAGHYSCEIENEAGRDACDALVSTLE EPPYFV

TELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTIFRIQE ERQLPPSFARQ

LKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSTARLTARE EPKKSPFFDIKPV

SIDVIAGESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKE EPPKFIKKLDASKVA

KQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVGDASCSTALKVKA APPVFTQKPPPVGALKGSD

VILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKE EPPRFVKKLSDASTLIGDPVELQA

VVEGFQPISVVWLKDKGEVIRESENVRISFVDNIATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTVLE EPATIVEKPEPMTVTTGNPFTLECVVAG

TPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSVHVSD DRVVPPSFVRRLKDTSATLGASVVLECRVSGSA

PISVGWFLDGNEIISSPKCQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAVLTVQE EPPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVK

WFKGSRELVSGEACTISLEDFVTELELLEVEPGQSGDYSCLVTNDAGSASCTTHLFVKE EPATFVKRLADTSVETGSPIVLEATYSGTPPISVSWMKNE

YPLSQSPNCGITTTEKSSILEILESTIEDYAQYACLIENEAGQDICEALVSVLE EPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIRISWYKEHTKLRS

APAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSAVLVIKE ERKLPPSFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGELLKDDA

NLQMSFVHHVATLQILQTDQSHVGQYNCSASNPLGTASSSAKLILSE EHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPIKITWAKDNREIRPGGNY

KMTLVENTATLTVLKVAKGDAGQYTCYASNVAGKDSCSAQLGVQE EPPRFIKKLDQSRIVKQDEYTRYECKIGGSPEIKVLWYKDEVEIQESSKFRMSF

EDSVAILEMHSLSVEDSGDYTCEARNAAGSASSSTSLKVKE EPPVFRKKPFPVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSENLLT

SIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKA APPQFVKKLTDISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISYSENIATLQF

SRAEPANAGKYTCQIKNDAGMQECYATLSVLE EPAAIVEKPESIKVTTGDTCTLECTVSGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVVP

GDSGVYSFEVQNPVGKDSCKVSIQVSD DRIIPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVLWFHDGNEISSGRKYQTTLTDNTCALTVNMLEEAD

AGDYTCIATNVAGSDECSAPLTVRE EPPSFVQKPDPMDVLTGSNVTFTSIVKGSPPFTVSWFKGSTELVPGARCNVSLQDSVGELELFDVDTSQSGEYT

CIVSNEAGRASCTTRLFVKA APAIFVKRLNDYSIEKGKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIEN

ASGKDSCSAQILILE EPPYFVKQLEPVKVTVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVGEV

SSSTFLTVQE EQKLPPSFSRQLRDVQETVGLPVVFECAVSGSEPISVSWYKDGKPLKDSPNIQTSFLDNIATLNIFKTDRSLSGQYSCTATNPIGSASS

GAKLILTE EGKNPPFFDIPLAPMDAVVGESADLECHVTGTQPIKVTWAKDNREIRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCYAVNEVGKDSCTA

QLNIKE ERLIPPSFTKKLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNVEIHPTSNCEIMFKNNALLLQVKRASMADAGLYTCKATNDAGSALCTSS

IVIKE EPKKPPVFDQHLAPVTASEGDSVQLSCHVQGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAGSDTSKCKVT

IKE EKPAAAPAAKKAAVDGKLFFVSEPQSIRVVEK KTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRCVAF

NKHGEIESNVNLQVDERKKQEKIEGDLRAMLKK KTPALKKGSGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRL EIE

ELEKSERDEKEFEELVAFIQQRLTQTE PVTLIKDIENQTVLKDNDAIFEIDIKINYPEIKLSWYKGTEKLEPSNKYEISIDGDRHTLRVKNCQPKDQGN

YRLVCGPHIASAKLTVIE EPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLETS

AELRIEA AEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEG GVYSVIARLEPRGEARSTAE

LYLTTKE EIKLEMKPPD DIPDSRVPIPTMPIRAVPPEE EIPPAVAPSIPLLLPLPEEKKPPAKRIEV VTKKGVKKDTKKVVTKPKEEAPPPPV VA

KKPPPPTPMIPAKA ASEIIDVSSKAEEVKITTITRKKEVHKEKEAVYEREEAVYEKKVHIEPWEEPYEELETEPYTEPYEEPYYEEPDEDYEEIKVEAK

KQVHEEWEEDFEEGQEYYEREEGYDEGEEEWEEIYHEREIIQVQKEVHEE ELHEKKIPAKVPEKKVPPPKV VVKKPVVEKVEKTTRRMEEEKVQVIKV

 VPEVSKKIVPQKPSRTPVQEEIIEVKV VPAVHTKKMVISEEKMFFASHTEEEVSVSV VPEVQKKTVTEEKIHVAVSKKIEPPPKV VPEPPKKPVPE

EVVPVPIPKKVEPPAAKV VPEAPKKPVPEEKKPVPIPKKKEPAAPPQV VPEAPKKPAPEEKIPVPVTKKKEAPPAKV VPEVQKKVVTEEKIAIITQR

EESPPPAV VPEIPKKKVPEEKRPVPRKEEVPPPKV VPVPPKKAVPEAVVPAPIPKKAPPRA AEVSKKTVVEEKRFAAEEKLSVAVPQRVELMRHEE 

EEEWTYSEEEERVSVSVYREEERDEEEAEITEYEV VLEEPEEYVVEEKMHFISKKVEVEPAKV VPEKKIIPKPKVPAKIEEPPPTKV VPEPPKKIVP

EKKVPAPAPKKVPPAKA APEESKRPVPEKRAPAEEVGIEEPPPTKV VAERHMKITQEEKVLVAVTKKEAPPRARV VPEEPKKVAPEERFPKLKPRRE

EEPPAKV VTEVRKRAVKEEKVSIEVPKREPRPTKE EVTVTEEKKWSYTREEETVSEHREEEYEDYEDYEEYKEFEEYEPTEEYDQYDEYAEREVEHYE

EHEEYVTE EPKKPVPVKPAQEPVPAKPKAPPPKV VLKKAVPEEKAPLPIQKKLKPLPPKA APEEPKKVVEEKIQISITKREKQQVTEPVAKV VPMK

PKRVVPEAKIPAPTKEVAVPVRV VPGVPKKRELEEVVVFKEEVEAHEEYIVEEEEEYVHEEEYVHKEEYVHEEEYVHKEEYIHEEEEHLHEEEETIAEE

EVVPVAPVKV VPVVPKKPVPEEKKPVPVPKKKEAPPAKV VPEIPKKPEEKVPVPIPKKEKAPPAKV VPEVPKKPVPEEKPPVPVPKKVEPPPAKV V

PEVPKKPVPEKKVPAPTPKKVEAPPAKV VPEVPKKPIPEEKKPTALLKKMEAPPPKA APKKREVVPVPVALPREEEEEEVPFEEVPEEEILPEEEVPS

EEEAPPEEVPPEEEEVLPEEEEVLPEEEEVLPEEEEVQPEEEALPEIKPKVPKPAPV VPKKTVPEKKVPVPVPKKVEPPPPPKV VPEIKKKVPEKKVV

VPKKEEAPPTKV VPEVSKKVEERRIIPPKEEEVPPAEV VYEEAEEPTPEEIPEEPPSIEEEEIVEEEEEEEEVLPPRA APEVVKKAVPEAPTPVPKK

AEAPPAKV VPKKIPEEKVPVPVQKKEAPPAKV VPEKKKIPEKKVPVPKKEAVPPAKG GKAVFEEKISVAYQQEELVQERIELELVEAKVEEAFEEEE

FHEVQEYFEEEEFHEVEEFIRVEERRFQEEHKVEEVHRVIEFLEAEEVEVYEKPKIPPKKG GPEVSEKVIPPKKPPTKVIPRKEPPAKV VPEVTKKTV

VEEKIRAPEEPKVPAPKA APEVPKKITPEEKVREAVPKKPEVPPPKV VPEVPKKIIQEEKLPVVLPEDTEIYM MYEASEETVIEEEHVTLPQKARLK

VAKV VPAPPQTVVTEEKTYVTIRKTRETLALKE ESETTREAFPELKSYKAVPEIPEPPSPED DLEIIEDVLPEKRPPASKRRKTQLPTA APEAPRE

MPPEMNTFEEISVEPEMLPTQV VLDTYQEATVEKKTLRISRKKPELPSDEEV VPEAPREVVAKKKVLPPQVPEVVPVKV VPGAPKEVVSERKSLEEP

PKKPAVRPVTV VPEEPKEVIPEKKVSLVPPKKPAAPPVTV VPEAPEEVFSEDEETLAPPQEPEAPPAKV VPEAPKEVVPEKKVSVVPPKKPEAPPAK

V VPEAPKEAAPEKKVPVAPKKKPEAPPVKV VPEAPKKVVPEKKLPVAAPKKPEAPAAEV VPEVPKTAVPQKKIPEAIPPKPESPPLEV VPEVPPKE

VTPEKKVPAAPPTKPEIPPPKV VPEAPQAAVVEEKTPEALPKKAEAAPVPV VPQVQETVPEKTRPVGPPKKPEATTVPV VPKVQKTIPEKTRPEAPP

KRPEARTVPE ETVPEKTRPMAPPKKPEATTLPV VPEVQETVPEKTRPVGPPKKPEATTVPV VPEVQETIPEKTRPPKKPEATPVPV VPEVQETVPE

KTRPVGPPKKPEATTVSV VPEVQETIPEKTRPAAPPKKPEATAVPE ETIPEKTRPEAPPKRPEATTVPV VPEADQAVVPEKKVPRVPPKKVEAPPIT

V VPEEPKEVIPEKKVSLVPPKKPAAPPVTV VPEAPEEVFSEDEETLAPPQEPEAPPAKV VPEAPKEVVPEKKVSVVPPKKPEAPPAKV VPEAPKEA

APEKKVPVAPKKKPEAPPVKV VPEAPKKVVPEKKLPVAAPKKPEAPAAEV VPEVPKAAVPQKKIPEAIPPKPESPPPEV VYEEPEEEIVPEEPPEEA

VEEPVPAPPPKV VTEPPKKPVPEKKAPPAVVKKPEPPPAKV VPEVPKEAPPEKKVPPKKPEAPPAKV VPEVPKEVVTEKKVAVPKKPEVPPAKV VP

EVPKKPVIEEKPAIPVVEKVASPPAEV VYEEPEEVTAEEEEPAPAVEEEEYEAPPPPAPV VPEEPKKVVPEKKFPVIKKPEAPPPKV VPEVPKKAVP

VKKVPVVKKPEPPEAEV VPEVPKKLVPVKKEPVPVTKKTEVLPEKV VPEAPKKITPEKKESVPVPEEPEAPPASV VEETPEETIYEEKATITIGRKE

TPPVEE EREIEKFIQPEEPELEPEPEEIPVQE EPEPEKKVIEKPKLKPRPPARPPSPPKEDVKEKMFQLKA - UNI36362 - AVSKKKVPEKPEV

VEKVEPAPLKV - UNI36362 - VPTAEKKVRKLLPEPKPQPKEEVVLKSV - UNI36362 - VLRKKPEEEEPKVEPKKVEKAKKPEE EPQPPP

KAVEVEAPPEPTPKERKVPEPAKV - UNI17655 - VPEIKPAIPLPGPEPKPKPEPE - UNI17655 - EVKTMKAPPIEPAPTPIAAPVTAPVV

GKKAE EAKPKDEAAKPKGPIKG GVAKKTPSPIEAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTEAESVGSSAIFECLVSPSTAITT

WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLIVEE ELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDG

KIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVE EIIREWLVKPIRDQHVKPKGTAVFTCDIAKDTPNIKWFKGYDEIP

LEPNDKTEILKEGNHLFLKVKNAMPEDIDEYAVEIEGKRYPAKLTLGE EREVELLKPIEDVTIYEKESASFDAEISEEDIPGEWKLKGELLRPSP TCE

IKAEGGKRFLTLHKVKLDQAGEVLYQACNAITTAILTVKE EIELDFAVPLKDVTVPEKRQARFECVLTREANVIWSKGPDIIKASDKFDIIADGKKHIL

VINDSQFDDEGVYTAEVEGKKTSAQLFVTG GIRLKFISPLEDQTVKEGQTATFVCELSHEKMHVVWFKNDVKLHTTRTVLMSSEGKTYKLEIRETTLDD

ISQIKAQVKNLSSTANLKVLE EADPYFTVKLHDKTGVEKDEIILKCEVSKDVPVKWFKDGEEIVPSPKHSVKTDGLRRILKIKKAELKDKGEYVCDCGT

DTTKANVTVEA ARLIKVEKPLYGVEVFVGETARFEIELSEPDVHGQWKLKGEPLTASP DCEIIEDGKKHVLVLYNCQLDMTGEISFQAANAKSAANLK

VKE ELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTRHSLVIKSAAFEDEAKYMFEAEDKRTSGKLIIEG - UNI

35827 - GIRLKFLTPLKDVTAKERENAVFTVELSHDNIPVSWFKNDQRLHTSKRVSMHDEGKTHSITFKDLSIDDTSQIRVEAMGISSEAKLTVLE -

 UNI35827 - - UNI35899 - EGDPYFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNVVIKADGKKRMLILKKALKSDIGQYTC

DCGTDQTSGKLDIED - UNI32138 - - UNI35827 - - UNI35899 - DREIKLVRPLYSVEVMETETARFETEISEDDIHANWKLKGEALLQ

TP - UNI32138 - - UNI33036 - - UNI35899 - ECEIKEEGKIHVLILHNCRLDQTGGVDFQAANVKSSAHLRVKP - UNI32138 - -

 UNI32541 - - UNI33036 - PRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPNDK - UNI14991 - - UNI16643 - 

- UNI32541 - - UNI33036 - VVTRSEGRVHTLTLRDVKLEDAGEVQLTAKDFKTQANLFVKE - UNI14991 - - UNI16643 - - UNI

32541 - EPPVEFTKPLEDQTVEEEATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVP -

 UNI14991 - PPHVEFLRPLTDLQVKEKETARFECEISKENEK VQWFKDGAEIKKGKKYDIISKGAVRILVINKCLLNDEAEYSCEVRTARTSGMLT

VLE EEEAVFTKNLANLEVSEGDTIKLVCEVSKPGAEVIWYKGDEEIIETGRFEILTDGRKRILIIQNAQLEDAGSYNCRLPSSRTDSKVKVHE ELAAE

FISKPQNLEILEGEKAEFVCTISKESFEVQWKRDDQTLESGDKYDIIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIE EKLRIIVPLKDTKV

KEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDARLDDQANFNVSLTNHRGENVKSAANLIVEE EEDLRIVEPLKDIETMEKK

SVTFWCKVNRLNVTLKWTKNGEEVAFDNRISYRIDKYKHSLIIKDCGFPDEGEYVVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSRE

KANVKWYRNGREIKEGKK KYKFEKDGSIHRLIIKDCRLEDECEYACGVEDRKSRARLFVEE EIPVEIIRPPQDILEAPGADVIFLAELNKDKVEVQWL

RNNMIVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAA AAPKIKTADQDLVVDAGQPLTMVVPYDAYPKAEAEWFKENEPLSTK

TVDTTAEQTSFRISEAKKDDKGRYKIVLQNKHGKAEGFINLQVID DVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLVTD

RADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDSPVEARSKYD DVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDT

AMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIE ERPSPPVNLNASEQTQSSVQLTWEPPLKDGGSPILGYIIERREEGKDN

WIRCNMKPVPELTYK VTGLQKGNKYLYRVSAENAAGVSDPSEILGPLTADDAFV VEPTMDLSAFKDGLEVIVPNPIKILVPSTGYPRPKATWTFGDQV

LEEGDRVKMKTISAYAELVISPSERTDKGIYTLTLENPVKSISGEINVNVIA APPSAPKELKFSDITKDSVHLTWEPPDDDGGSPLTGYVVEKRDMSRK

TWTK VMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYTDEPVNMSAPAT TVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVEKCPR

GSDKWVACGEPVPDTK KMEVTGLEEGKWYAYRVKALNRQGASKPSKPTEEIQAVDTQE EAPEIFLDVKLLAGITVKAGTKIELPATVTGKPEPKITWT

KADTLLKPDQRITIENVPKKSTVTITDSKRSDTGTYIIEAVNVCGRATAVVEVNVLD DKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERK

ATDSDVWHKLSSTVKDTNFKATKLTPNKEYIFRVAAENMYGVGEPVQAAPIIAKYQFD DPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVER

LDPDTDKWVRCNKMPVKDTTYR RVKGLTNKKKYRFRVLAENLAGPGKPSRSTEPILIKDPID DPPWPPGKPTVKDIGKTSLVLNWTKPEHDGGAKIES

YVIEMLKTGTDEWVRVAEGVPTTEHLLTGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLY YPPSPPRWLEVINITKNTADLKWTVPEKDGGSPI

TNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIGDSVLAKDTFT TTPGPPYALTVVDVTKRHVDLKWEPPKNDGGR

PIQR RYIIEKKEKLGTRWVKAGKTSGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTS SPPSPPLDLHVTDAGRKHIAIAWKPPE

KNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGIVPDKEYVLRVRAVNAVGVSEPSEISENVVAKDPDC CKPTIDLETHDIVVIEGEKLNIP

VPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVHADAGVYTITLENKLGSATASINVKVIG GLPGPCKDIKASDITKSSCKLTWEPPEF

DGGSPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQ QPPDPPVDVEVHNPTAKAMTITWKPP

LYDGGSKIMGYIIEKITKGEDRWKRCNEHLVPVLTYTAKGLEEGKEYQFRVRAENAAGIGEPSRATPPTKAVDPID DAPKVILRTSLEVKRGDEIALDA

TISGSPYPTITWIKDENVIVPEEIKKRAAPPVRRKKGEAEEEEPFSLPLTERLSINNSKQGESQLRIRDSLRPDHGQYMIKVENDHGVAKAPCSVSVLD 

DTPGPPINFVFEDIRKDSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSDWIVITSTLRNCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLLAKDP

FE EPPDAPDKPIVEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKTLLSSLKTKVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAR

DPIS SPPGPPVPRVADTSSTTIELEWEPPAFNGGGEIMGYFVDKQLVGTNEWSRCTEKMIKVRQFTVKEIREGADYKLRVSAVNAAGEGPPGETEPVTV

AEPQE EPPTVELDVSVKGGIQIMAGKTLRIPAEVTGRPVPTKVWTIEEGELDKERVIIENVGTKSELIIKNALRKDHGRYVITATNSCGSKFAAVRVEV

FD DVPGPVLDLKPVVTNRKMCLLNWSDPADDGGSDITGFIIERKDAKMHTWRQPIETERSKCDITGLIEGQEYKFRVIAKNKFGCGPPVEIGPILAVDP

LG GPPTSPERLTYTERTKSTITLDWKEPRSDGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNDVGESEPSLPLNVVIQ

DDEV VPPTIKLRLAVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKNEKVIDKPTDTLNITKEEVSRSEAKTELSIPKAAREDKGTYTITASNRLGSVF

RNVHVEVYD DRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYIIDKRDASRKKSEWEEVTNTAVERRYG IWKLIPNGQYEFRVRAVNKYGISDE

CKSDKVVIQDPYRLPGPPGKPKVLERTKGSMLVSWTPPLDNGGSPITGYWLEKREEGGTYWSRVSRAPITKVGLKGVEFNVPRLIEGVKYQFRAMAINAA

GIGPPSEPSDPAVAGDPIY YPPGPPSCPEVKDKTKSSISLAWKPPAKDGGSPIKGYIVEMQEEGTTDWKPVNEPDKLLTACECVVPNLKELRKYRFRVK

AVNEAGESEPSDTTGEIPATDIQE EVPEVFIDIGAQDCLVCKAGSQVKIPAVIKGRPTPKSSWEFDGKAKKAMK DGVHDIPEDAQ LETAENSSVIII

PECTRAHSGKYSITAKNKAGQKTANCRVKVMD DAPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNCGSTTFVVPDLI

SEQQYFFRVRAENRFGIGPPAETIQRTTARDPIY YPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGKKKEAWRQCNRRDVEEL

EFTVEDLIEGGEYEFRVKAVNEAGVSKPSATVGPVIVKDQTC CPPAIELKEFMEVEEGTDVNIVAKIKGVPFPTLTWFKAPPKKPDSKEPVVYDTHVNK

QVVDDTCTLVIPQSRRSDTGLYSITAVNNLGTASKEMRLNVLG GRPGPPVGPIKFESISADQMTLSWLPPKDDGGSKITNYVIEKREANRKTWVRVSSE

PKECMYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFS SVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNR

DPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPVTARDPVA APPGPPFPKVTDWTKSSVDLEWSPPLKDGGSKITGYIVEYKEEGKEE

WEK GKDKEVRGTKLVVTGLKEGAFYKFRVRAVNVAGVGEPGEVTDVIEMKDRIV VSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWSMNER

ALPQEAAIETTAISSSMVIKNCQRSHQGVYSLLAKNEGGERKKTIIVDVLD DVPGPVGIPFLSDNLTNDSCKLTWFSPEDDGGSPITNYVIQKREADRR

AWTPVTYTVTRQNATVQGLIQGKSYFFRIAAENSIGMGPFVETPNALVIRDPIT TVPERPEDLEVKEVTKNTVSLTWNPPKYDGGSEIINYVLESRLIG

TEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELA APPTLDLDFRDKLTVRVGESFALTGRYSGKPKPKIDWFKDEA

DVLEDDRTHIKTTPTTLALEKTKAKRSDSGKYCVVVENSTGSRKGFCQVNVVD DRPGPPVGPVIFDEVTKEYMVISWKPPLDDGGSEITNYIIEKKELG

KDIWMPVTSASAKTTCKVPKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDRFR RVPDAPEQPVVTEVTKDSALVTWNKPNDGGKPITNYILEKRETM

SKRWVRVTKEPIHPYTKYRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFARDPIA AKPSPPINPEAIDTTCNSVELTWQPPRHDGGSKILGYIVEY

QKVGDEEWRRANHTPESCPETKYKVTGLRDGQSYKFRVLAVNEAGESDPAHVPEPVLVKDRLE EPPELILDANMAREQHIRVGDTLRLSAIIKGVPFPK

VTWKKEDREAPTKAQIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGTKTVSVKVLVLD DKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVVTNYVVE

RKDVATAQWSPLSTTSKKKSHMAKHLTEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLH HPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYL

VEYQEEGDKDWIKFKTVKNLDCVVTGLQQGKTYRFRVKAENIIGLGLPDTTIPIECQEKLV VPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAK

WTTDGTEIKTDDHYTVETDSFSSVLTIKNCLRKDTGEYQLTVSNAAGTKTVAVHLTVLDVPGPPTGPINILDVTPEYMTISWQPPKDDGGSPVINYIVEK

QDTRKGTWGVVSAGSSKLKLKVPHLQKGCEYVFRVKAENKMGVGPPLDSIPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYVERR

EITGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSNPSPSSDPIKACRPIKPPGPPINPKLKDKSKESADLVWTKPLSDGGSPILGYVVEYQ

KPGTAQWDRINKDELIRQCAFRVPGLIEGNEYRFRIRAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWS

KEGKVLVKDKRVDLIHDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVSNVTKENCTISWENPLDNGGSEITNFIVEYRKP

NQKGWSIVASDVTKRLVKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKG

SADWERVHKGSIKETHYMVDKCVENQIYEFRVQTKNEGGESDWVRTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATD

LTRSPRVKIDTSAESSKFSLTKAKRSDGGKYVITATNPAGSFVAYATVNVLDKPGPVRNLKITDVSSDRCTIRWDPPEDDGGCEIQNYILEKCESKRMVW

STYSANVLTPSATVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDRPGRPDPPEVTKVSKEEMTVVWNAPEYDGGKSITGYYLEKKEKHAVRWV

PVNKSAIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPSLPSRPVVAKDPIE EPPGPPTNFKVVDTTKSSITLAWGKPVYDGGAPIIGYVVEMRPKIAD

ASPDEGWKRCNAAAQLIRMEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILE EPPEIDLDASMRKLVVVRAGCPIRLFAIVRGRPAPKVT

WRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVKVLD DTPGPVADLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEK

REAERKTWSTVTPEVKKTSFNVTNLVPGNEYFFRVTAVNEYGPGVPTDIPKPVLASDPLS SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYII

SYREEDQPADRWTEYSVVKDLSLIVTGLKEGKKYKFRVAARNAVGVSMPREAEGVYEAKEQLL LPPKILMPEQITIKAGKKLRVEAHVYGKPNPICKWK

KGDDEVVTSSHLAIHKADGSSVLIIKDVTRKDSGYYSLTAENSSGSDTQKIKVTVMD DAPGPPQPPFDISEIDADACSLSWHIPLEDGGSNITNYIVEK

CDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMLAKFPFD DVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIE

RKERNSLLWVKANDTIVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVD DPPGKPEVVDVTKNSASLIWARPKHDGGSRIIGYFVE

ACKLPGDKWVRCNTTPHQIPQEEYTATGLEENAQYQFRAIAKTAVNISQPSEPSDPVTILAENV VPPRIELSVEMKSLLTVKAGTNVCLDATVFGKPMP

TVSWKKDTTPIKQAEGIKMAMKRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLD DKPGPPASVKINKMYADRAMLSWEPPLEDGGSEITNY

IIDKRETSRPNWAQVSATVPITSCTVEKLIEGHEYQFRICAENKYGVGDPILTEPAIAKNPYD DPPGRCDPPVISNITKDHMTVSWKAPADDGGSPITG

YLVEKRETQAVNWTKVNRKPVIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAVYAQDPLY YPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSP

IIGYLVEVKRADSDHWVRCNLPEKLQKTRFEVTGLMENTEYQFRVYAVNKIGYSDPSDVPDKHCPKDILI IPPEGELDAELRKTLILRAGVTMRLYVPV

KGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLD DTPGPPVNVTVKEVSKDSAYVTWDPPIIDGG

SPIINYVVEKRDAERKSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASE ETPGPVVDLKALAITKSSCTIGWKKPRSDGGS

RITGYVVDFLTEENKWQRVMKSLSLQYSTKDLKEGKEYTFRVSAENENGEGTPSEIVVVAKDDVV VAPDLDLKDLPDLCYLAKENSNFRLKIPIKGKPA

PSVSWKKGEDPLATDTRVSVESTAVNTTLVVYDCQKSDAGKYTITLKNVAGTKEGTLSIKVVGKPGIPTGPIKFDEVTAEAMTLKWGPPKDDGGSEITNY

VLEKRDSVNNKWVTCASAVQKTTFRVTRLHEGIEYTFRVSAENKYGVGEGLKSEPIVAKHPFD DVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITG

 GYHIEFKERNSLLWKRANKTPIRMKDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPID DPPGKPEVISVTRNSVTLIWTEPKYDGGHKL

TGYIVEKRDLPSKSWMKANHVNVPDCAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTGTIICKDEYE EAPTIVLDPTIKDGLTVKAGDSIVLSAISI

LGKPLPKSSWSRAGKDIRPSDIAQITSTPTSSMLTVKYATRKDAGEYTITATNPFGTKEEHVKVSVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSP

IKAYVLEKRETSRLLWTVVSEDIQACRHVVTKLIQGNEYLFRVSAVNHYGKGEPVQSEPVKMVDRFG GPPGPPGKPEISNVTKNTATVSWKRPTDDGGS

EITGYHVERREKKGLRWVRATKTPVSDLRCKVTGLQEGNTYEFRVSAENRAGIGPPSDASNPVLMKDVAY YPPGPPSNAHVTDTTKKSASLAWGKPHYD

GGLEITGYVVEHQKVGDDAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPNVEIVEKEVAPDFELDAELRRTLVVRAGLSIRIFVP

IKGRPAPEVTWTKDNINLKHRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRI

TNYIVEKREATRKSYSTVTTKCHKCTYKVTGLTEGCEYFFRVMAENEYGVGEPTETTEPVRASEAPLPPDSLNIMDITKNTVSLAWPKPRHDGGSKITGY

VIEAQRKGSDQWTHISTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIARAGDNIKVEIPVLGRPKPTVTW

KKGDQILKQTQRVNVENTATSTILNINECVRSDSGPYPLTAKNTVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWEPPENDGGVPISNYVVEMR

QTDSTTWVELATTVIRTTYKATRLTTGVEYQFRVRAQNRYGVGPGITSASVVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKE

RNGILWQTVSKALVPGNIFKSTGLTDGIAYEFRVIAENMAGKSKPSKPSEPMFALDPIDPPGKPVPLNITRHTVALKWAKPEYTGGFKITSYVVEKRDLP

NGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDLEAPRIMVDVRFKDTITLKAGEAFKLEADVSGRPPPTMEWTKDG

KELEGTGKLEIKIADFSTHLINKDSSRTDSGAYILTATNPGGFAKHIFNVKVLDRPGPPEGPLAVSDVTSEKCVLSWLPPLDDGGAKIDHYIVQKRETSR

LAWTNVATEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVDPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQ

RWVKCNKKALTDLRFKVSGLTEGHEYEFRIMAENAAGISAPSATSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEE

DEWQVVTPPAGLKATSYTITSLIENQEYKIRIYAMNSEGLGEPALVPGTPKAEERMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWAREHG

ESLDKASIESTSSYTLLVVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQNLKIKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAYS

TVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLTDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDRWATCA

TVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKIDVPFIGRPPPAVTWHKDDIPLKQTTRVNAEST

ENNSLLTIKEACREDVGHYTVKLTNSAGEATETLNVIVLDKPGPPTGPVKMDEVTADSVTLSWEPPKYDGGSSINNYIVEKRDTSTTAWQIVSATVARTT

IKACRLKTGCEYQFRIAAENRYGKSTYLNSEPVVAQYPFKVPGPPGTPFVTLASKDSMEVQWHEPVSDGGSKVIGYHLERKERNSILWVKLNKTPIPQTK

FKTTGLEEGIEYEFRVSAENIVGIGKPSKPSECYAAHDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPDGRWMKASFTNIIDTQFE

VTGLLEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVEPPRISMDPKYRDTVVVQAGESFKIDADIYGKPIPTTQWVKGDQELSSTARLEIKSTDFAT

SLSVKDAVRVDSGNYILKAKNVAGEKSVTINVKVLDRPGPPEGPVAISGVTAEKCTLAWKPPLQDGGSDITNYIVERRETSRLVWTLVDANVQTLSCKVL

KLLEGNEYIFRIMAVNKYGVGEPLESESLIAKNPFVVPDAPKAPEVTAVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVT

GLLENHNYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVMDVTRSSVFLSWTKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNLE

VEKLLEKHEYNFRICAINKAGVGEHADVPGPVMVEEKLEAPDIDLDLELRKVINIRAGGSLRLFVPIKGRPTPEVKWGKVDGDIRDAAIIDVTSSFTSLV

LDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQE

GCSYYFRVTAENEYGIGLPARTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKNTDKWSECARVKSLDAVITNLTQGEEY

LFRVIAVNEKGRSDPRSLAVPIIAKDLVIEPDVRPAFSSYSVQVGQDLKIEVPISGRPKPSISWTKDGMPLKQTTRINVTDSLDLTTLSIKETHKDDGGQ

YGITVSNVVGQKTAAIEIITLDKPDPPKGPVKFDEISAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFA

ENRYGQSFALESEPVVAQYPYKEPGPPGTPFVTAISKESMVVQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKALNLEEGIEYEFRVYA

ENIVGVGKASKNSECYVARDPCDPPGTPEAIIVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKN

AAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILR

ASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTAEKCTLAWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNKYIFRIMAVNKY

GVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAA

GVGEPSPATVYYKACDPVFKPGPPTNAHVVDTTKNSITLAWSKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEIAKLIEHQEYKIRVCALN

KVGLGEAASVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSKEEGEFTDKVQIEKGINFTQLSIDNCDRNDAGKYILKLEN

SSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSVLLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCNKTSFRVENLTEGAIYYFRVMAENEFGVGV

PTETSDAVKASEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRILGYVVEMQPKGTEKWSVVAESKVCNAVVSGLSSGQEYQFRVKAYNEKGKSDPRVL

GIPVIAKDLTIQPSFKLPFNTYSVQAGEDLKIEIPVIGRPRPKISWVKDGEPLKQTTRVNVEETATSTILHIKESSKDDFGKYSVTATNSAGTATENLSV

IVLEKPGPPVGPVKFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTNWQMVSATVARTTIKISKLKTGTEYQFRIFAENRYGKSTPLDSKPVVVQ

YPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGSKVTGYHLEQKEKNSILWVKLNKIPIQDTKFKTTGLDEGLEYEFRVSAENIVGIGKPSKVSECYVA

RDPCDPPGRPEAIVITRNSVTLKWKKPVYDGGSKITGYIVEKKDLPDGRWMKASFTNVVETEFTVTGLVEDQRYEFRVIARNAADNFSEPSESSGAITAR

DEIDAPNASLDPKYRDVIIVHAGETFVLEADIRGKPIPDIIWSKDGNELEETAARMEIKSTLQKTTLIVKDCIRTDGGQYTLKLSNVGGTKTIPITVKVL

DRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGASISHYIIEKRETSRLSWTQVSNEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEALESEPVIACNPY

KRPGPPSTPEASAITKDSMVLTWTRPVDDGGAEIEGYILEKRDKEGIRWTKCNKKTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDA

LYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVRGYVIELKKAAADEWTTCTPPSGLQGKQFTVTKLKENTEYNFRICAFNTEGVGEPATIPGSVVAQ

ERMEAPEIELDADLRKVVTLRASATLRLFVTIKGRPEPEVKWEKAEGILTERAQIEVTSSYTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSP

SAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKNTFKIENLQEGCSYYFRVLASNEYGIGLPAETAEPVKVSEPPLPP

GRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSACTQVKTLETTISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIAKDIEIKPSVEL

PFNTFNVKANDQLKIDIPFKGRPQATVAWKKDGQVLRETTRVNVASSKTVTTLSIKEASREDVGTYELCVSNTAGSITVPITVIVLDRPGPPGPIRIDEV

SCDNVSISWNPPEYDGGCQISNYIVEKRETTSTTWQVVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHAT

KSTMVVSWQVPVNDGGSQVIGYHLEYKERSSILWSKANKVLIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKACEPVPARDPCDPPGQPEVTNITRK

SVSLKWSKPRYDGGAKITGYIVERRELPDGRWLKCNFTNVQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVI

IVKAGEVLKINADIAGRPLPVISWAKDGVEIEERAKTEIVSTDYTTTLTVKDCVRRDTGQYVLTLKNVAGTRTMAVNCKVLDKPGPPAGPLEINGLTAEK

CSLSWGRPQEDGGADIDYYIVEKRETSRLAWTICEAELRTTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESMAVKALDPFTTPSPPTSLEITSVTKDSM

TLCWSRPETDGGSDISGYIIERREKNSLRWMRVNKKPVYDLRVKSTGLREGCEYEYRVFAENAAGLSLPSETSPLVRAEDPVFLPSPPSKPKIVDSGKTT

ITIGWVKPLFDGGAPITGYTVEYKKSEETDWKVAIQSFRGTEYTMSGLTTGDEYVFRVRSLNKMGASDPSDSSDPQVAKEREEEPVFDVDSEMRKTLIVK

AGSSFTMTVPFRGRPIPNVSWSKPDTDLRTRAYIDSTDSRTLLTIENANRNDSGKYTLTIQNVLSAASMTFVVKVLDSPGPPANITVREVTKETAMLSWD

VPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGVPAETKEGVKITE EKPSPPEKLGVTSVSKDSVSLSWLK

PEHDGGSRIIHYVVEALEKGQKTWVKCAVVKTTHHVVSGLRESHEYFFRVFAENQAGLSDPRELLLPVLIKDQLE EPPEIDMKNFPSHTVYVRAGSNLK

VDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTTDAGRYEITAANSSGTTKTFINIIVLDRPGPPTGPVAISDITEESVTLKWEPPK

YDGGSHVTNYIVLKRETSTAVWSEVSATVARTMIKVMKLTTGEEYQFRIKAENRFGISDHIDSVCVVVKLPYT TTPGPPSTPWVSNVTRESITVGWHEP

VSNGGSAVTGYHLEMKDRNSILWQKANKMIIRTTHFKVTTISAGLIYEFRVYAENAAGIGKPSHPSEPVLAIDACE EPPRNVRITDISKNSVNLSWQQP

AFDGGSKITGYIVERRDLPDGRWTKASFTNVIETQFTVSGLTQNSQYEFRVFARNAVGSVSNPSEVVGPITCIDSYG GGPVIDLPLEYTEVVKYRAGTS

VKLRAGISGKPEPTIEWYKDDKELQTNALVCVENSTDLASILIKDANRLNSGSYELKLRNAMGSASATIRVQILD DKPGPPGGPIEFKTVTAEKITLLW

RPPADDGGAKITHYIVEKRETSRVVWSMVAENLEECIVTTTKIIKGNEYVFRVRAVNKYGIGEPLESEPVVAKNAFV VTPGPPSIPEVTKITKNSMTVV

WDRPTVDGGSEINGYFLERRDKKSLAWLKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGVGPFSEPSDFYKAADPID DPPGPPAKIRIADSTKSSI

TLGWSKPVYDGGSDVTGYVVEMKQGDEEEWTIVSTRGEVRTTEYVVSNLKPGVNYYFQVSAVNCAGQGEPITMTEPAQAKDVLE EEPEIDLDVALRTSV

IAKAGEDVQLLIPFKGRPPPTVTWRKDEKNLGSDTRYSIQNTDSSSLLVIPQVTRNDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQKLQVKHVSLGT

VTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSGTSFKVTDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVVL

SWTKPDFDGGSIITDYLVERKGKGEQAWSHAGISKTCEIEIGQLKEQSVLEFRVSARNEKGQSDPVTIGPLTVKELVITPEVDLSEIPGAQISVRIGHNV

HLELPYKGKPKPSISWLKDGLPLKESEYVRFSKTENKITLSIKNSKKEHGGKYTVILDNAVCRNSFPITIITLGPPSKPKGPIRFDEIKADSAIMSWDIP

EDDGGGEITCYSIEKREASQTNWKMVCSSVARTTFKVSNLVKDSEYQFRVRAENRYGVSEPLASNIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPV

YDGGSEVTGFHVEKKERNSILWQRVNTSPISGREYRATGLIEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVD DPPGTPDYIDVTRETITLKWNPPL

RDGGSKIVAYSIEKRQGSDRWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGLIMTRDENV VPPTVEFGPEYFDGLVIKSGDSLR

IKALVQGRPVPRVTWFKDGVEIERRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNVSGSTKAEVTVKVQD DTPGKVVGPIRFTNITGEKMTLWWEA

PLNDGCAPVTHYIIEKRETSRLAWALIEDNCEALSYTAIKLITGNEYQFRISAVNKFGVGRPLESDPVVAQIQYT TIPDAPGVPEPSNVTGNSITLTWT

RPESDGGSEIQHYILERREKKSTRWVKVISKRPISETRFKVTGLVEGNEYEFHVMAENAAGIGPASGISRLIKCREPVNPPSAPSVVKVTDTSKTTVSLE

WARPVFDGGMEIIGYIIEMCKADLGDWHKVNTEPCVKTRYTVTDLQAGEEYKFRVSAVNGAGKGDSCEVTGTIKAVDRLSAPELDIDANFKQTHIVRAGV

SIRLFIAYQGRPTPTAVWSKPDSNLSIRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGKKSITFTVKVLDSPGPPGPITFKDVTRGSATLMWDAPL

LDGGARIHHYVIEKREASRRSWQVVSEKCTRQILKVSELTEGVPYYFRVSAENEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDG

GSRITSYLLEMRQKGSDFWVEAGHTKQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPISG

RPAPKVTWKLEEMRLKETDRMSIATTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSVSAESCVLSWTEPKDDGGTEI

TNYIVEKRESGTTAWQLINSSVKRTQIKVTHLTKYKEYCFRVSSENRFGVSKPLESVPIVAEHPFV VPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSK

IVGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVD DPPGRPEVTDVTRSTVSLIWSAPVYDGGSK

VVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYA APPKAELDARLQGDLVTIRAGSDLVL

DAAVGGKPEPKIIWTKGDKELDLCEKISLQYTGKRATAVIKYCDRSDSGKYTLTVKNASGTKSVSVMVKVLD DSPGPCGKLTVSRVTEEKCTLAWSLPQ

EDGGAEITHYIVERRETSRLNWVIVEGECLTASYVVTRLIKNNEYTFRVRAVNKYGLGVPVESEPIVARNSFT TIPSQPGIPEEVGAGKEHIIIQWTKP

ESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSY YTPGPPSAPRVVDTTKRSISLA

WTKPMYDGGTDIIGYVLEMQEKDTDQWCRVHTNATIRNNEFTVPDLKMGQKYSFRVAAVNAKGMSDYSETTAEIEPVERLE EIPDLELADDLKKTVIVR

AGASLRLMVSVSGRPSPVITWSKKGIDLANRAIIDNTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYD DTPGPCPSVSVKEVSRDSVTIT

WEIPTIDGGAPVNNYIIEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVVDVTKSTVTLAWEK

PLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVISLNEGEQYLFRVRAQNEKGVSEPREIVTPVTVQDLRV VLPTIDLSTMPQKTIHVPAGRP

IELVIPITGRPPPTASWFFAGSKLRESERVTVETHTKVTKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILD DKPGPPTGPIKIDEIDATSVTISW

EPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRPTFKFTRLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSIS SIPGPPETLQIFDVSRDGMTLT

WYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAINARGTGKPSRPSKPTVAMDPIA APPGKPQNPRVTDTTRTSV

SLAWSVPEDEGGSKVTGYLIEMQKVDQREWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLE EYPDYELDERYQEGVF

VRQGGVIRLTIPIKGKPFPVCKWTKEGQDISKRAMIATSETHTELVIKEADRNDSGTYDLVLENKCGKKTVYIKVKVIGSPNTPEGPLEYDDIQARSVRV

SWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLN NPPEPPSNPPEVLDVTKSS

VSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFD DKPSQPGELEILSIS

KDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDRQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSVKTKLTS SGEAPGVRKEMAD

VTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTDEQEDEGVYTCVATNEVGEVESSSKLLLQAAPQFHPGYPLKEKYYGA

VGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSEKITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNAFGTVDATLDVEIQD DKPDKPTGPIVIEALLKNS

VVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISEPLEVASIVIIKSPFE EKPGVPGKPTITAVT

KDSCVVAWKPPASDGGAKIRNYYLERREKKQNKWIAVTTEEIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEPVTPKSDVPIQAPHFKEELRNL

NVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEV VPAKIHLPKTLEGMG

AVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFSNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSR

DSVNLTWTEPASDGGSKVTNYIVEKCATTAERWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTVTKEDKTRAMNYDDEVDETREVT

TTKASHSKTKELYEKYMIAEDLGRGEFGIVHRCVETSSKRTFMAKFVKVKGTDQVLVKKEISILNIARHRNILYLHESFESMEELVMIFEFISGLDIFER

INTSAFELNEREIVSYVRQVCEALEFLHSQNIGHFDIRPENIIYQTRKNSTIKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVHQHDVVSTATDMWSLGT

LVYVLLSGINPFLAETNQQMIENIMNAEYTFDEEAFKEISLEAMDFVDRLLVKERKSRMTASEALQHPWLKQRIDRVSTKVIRTLKHRRYYHTLIKKDLN

MVVSAARISCGGAIRSQRGVSVAKVKVASIEIGPVSGQIMHAIGEEGGYVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVATMYVKDITKFD

DGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTKKVKRRTDAMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDE

KKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVTLHPPPTETTLRPMFKRLLANAECHEGQSVCFEIRVSGIPAPTLKWEKDGQPLS

LGPHIEIVHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYVKQEFQSKEERERHVQKQIDKTLRMAEILSGTETVPLTPVAQEALR

EAAILYKPAVSTKTVKGEYRLQTEEKKEERKLRMPYEVPEPRRFKQATVEEDQRIKQFVPMSDMKWYKKIRDQYEMPGKLDRVVQKRPKRIRLSRWEQFY

VMPLPRITDQYRPKWRIPKLTQDDLEMVRPARRRTPSPDYDLYYYRRRRRSLGDMSDEELLLPIDDYLAMKRTEEERLRLEEELELGFSASPPSRSPPRF

ELSSLRYSSPPAHVKVEDRRRDFRYSTYHVPTKEETSTSYAELRERHAQASYRQPKLRQRIMAEKEEEELLRPVTTTQRLSEYKSELDYMSKEEKSKKKS

KRQRQVTEITEIEEEYEISRRAQRESSSSVSRLLRRRRSLSPTYIELMRPVSELIRSHPRPAEEYEDDAERRSPTPERTRPRSPSPVSSERSLSRFERSA

RFDIFSRYESMKAALKTQKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILD

CQTEDGGTYRAVCTNYKGEASDYATLDVTGGAYTTYASQRRDEEVPKSVFPELTKTEAYAVSSFKRTSELEAASSVREVKSQMTETRESLSTYEHYASAE

MKSATSEEKSLEEKATVRKIKTTLAARILTKPRSITVHEGESARFSCDTDGEPVPTVTWLREGQVVSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVV

ENSDGKQEAQFTLTVQKARVIEKAVTSPPRVKSPEPRVKSPETVKSPKRVKSPEPVTSHPKAVSPTETKPTEKGQHLPVSAPPKITQSLKAEASKDIAKL

TCAVESSALCAKEVAWYKDGKKLKENGHFQFHYSADGTYELKIHNLSESDCGEYVCEVSGEGGTSKTSFQFTGQSFKSIHEQVSSISETTKSVQKTAE E

SPEAKKQEPIAPESISSKPVIVTGLRDTTVSSDSVAKFTIKVTGEPQPTITWTKDGK AIAQGSKYKLSSNKEEFILEILKTETSDGGLYACTVTNSAGS

VSSSCKLTIKA AVKDTEAQKVSTQKTSEVTSQKKASAQEEISQKALTSEEIKMSEVKSHETLAIKEEASKVLIAEEVKRSAAASLEKSIVHEEVTKTSQ

ASEEVKTHAEIKTLSTQMNITKGQRATLKANIAGATDVKWVLNGTELPNSEEYRYGVSGSDQTLTIKQASHREEGILSCIGKTSQGVVKCQFDLTLSEEL

SDAPSFITQPRSQNINEGQNVLFSCEVSGEPSPEIEWFKNNLP ISISSNISVSRSRNVYTLEIRNAAVSDSGKYTIKAKNFHGQCSATASLTVLP PLV

EEPPREVVLKTSSDVSLHGSVSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGKSSMTQLESSTSRMLKAGGRG 

GIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEITWSCGGRKIQNQEQQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNINIRSM
Transcript ENSMUST00000078848
Sequence
AAGCCAGTAATTGTTACTGGGCTGCGGGATACAACAGTTTCTTCAGACAGTGTTGCTAAATTTACAATTAAAGTTACTGGAGAGCCCCAGCCAACTATCA

CCTGGACAAAGGATGGAAAG GCTATTGCACAAGGCAGTAAATACAAACTCTCTAGCAACAAAGAAGAATTCATCTTAGAAATCCTCAAGACCGAGACAT

CTGATGGCGGACTTTACGCCTGTACAGTAACAAATTCTGCTGGATCTGTGTCCTCGAGCTGCAAGCTGACAATAAAAG CTGTAAAAGACACCGAGGCAC

AGAAAGTATCTACCCAGAAGACCTCCGAAGTCACATCTCAGAAGAAAGCGAGTGCCCAAGAGGAAATTTCTCAAAAAGCCCTAACTTCTGAAGAAATCAA

AATGTCAGAAGTAAAATCTCATGAAACGCTGGCCATCAAGGAGGAAGCGTCCAAAGTTCTGATTGCTGAGGAGGTCAAGAGGTCAGCAGCAGCCTCCCTG

GAGAAATCCATCGTCCATGAAGAAGTCACCAAAACCTCACAGGCATCCGAAGAAGTCAAAACTCACGCGGAGATCAAAACACTGTCTACCCAGATGAACA

TAACCAAGGGCCAGCGAGCGACCCTGAAAGCCAACATTGCTGGGGCCACAGATGTGAAATGGGTCCTGAACGGCACTGAGCTTCCGAACTCAGAGGAATA

CAGATACGGGGTATCTGGCAGTGACCAAACTCTCACCATCAAACAAGCCAGTCACAGAGAGGAAGGGATCCTCAGCTGCATAGGCAAAACCAGCCAGGGA

GTTGTCAAGTGTCAGTTTGACTTGACCCTGAGTGAAGAACTCTCGGATGCTCCAAGCTTCATCACACAGCCCAGATCTCAAAACATTAACGAGGGACAAA

ATGTTCTCTTTTCTTGTGAGGTCAGCGGGGAGCCGTCCCCTGAAATTGAGTGGTTTAAAAATAACCTTCCA ATTTCCATTTCTTCAAATATCAGTGTGA

GTCGCTCCAGAAACGTGTACACTCTTGAAATCCGAAATGCGGCTGTAAGTGACAGCGGAAAGTACACAATTAAGGCTAAGAATTTCCACGGCCAGTGCTC

TGCAACAGCGTCCCTCACAGTGCTCC GAATTCCACCTAAAATTGAAGCTCTTCCCTCTGATATCAGCATCGACGAAGGCAAAGTCCTAACAGTAGCCTG

TGCCTTTACTGGGGAGCCTACTCCAGAAATAACATGGTCCTGTGGTGGAAGGAAAATCCAAAACCAAGAACAACAAGGAAGATTCCACATTGAAAACACA

GATGACCTGACCACCCTGATCATCATGGACGTACAGAAACAAGATGGCGGACTTTATACCCTAAGCTTAGGGAATGAATTTGGATCTGACTCTGCCACTG

TGAATATTAATATCCGTTCTATGTAAGAGGGCCAGGGCCAAGAGCGGGGGCCCTTTACACTCGATGCTCATTCATAATCTCTCTCAAATGATTCACATGA

ACTAATCTTTCTGACCTGTAAATATTTTTAAGTAGTTTTATATCCATCTGAATGAGTCACAGTTCCAAAACTATGCATTTCAATCCTTTCATACTTGACC

TGAGAATATTTGCTAATGACACACATGTACATACTGTATATAGCCGGGTTCACGGTTATAAAGTTTTGTACCATTTTATTTTATGACATTTTACACTGTA

ACTTTTGAAACTAACTGTTGGTGGGAGAAAGTTTCTTATAGATTATAGAACGAATACCCTGCCAATACTTAATCAATCTTTGTGCCTCAACATACTGTTG

ATGTCTAAGTATGCCTCAGTGGGTTGAGAAATTCCCCACTGAAGATGTCCTATCCACCTAAAAAAAAAAGGATGCTTCTGTACATGTCCCTGACATGTGC

ACTGACACCTATTGAATCAGAAATGTAAGGCATTGGTGATGTTTGCATCTACCCTCCTGTAAGCAACACTTTAACGTCTTACGTTTTCTCTGATGATGTC

ACACTGAAAATTATCATGACAAATATAACCAGAGCAAAGTGTAACGGCCATACACTTTGTTCGCCCACTTCACACTGTCTCTGGCATACAGAGTGCATGG

ATAGCTTGGGAAATGTACCATCTCCTGGCCATCCCCTCGTCTAACCAAGCTATGCAAGTATTCCTATGCCAGAGCGGTGTCGACTCCTGGAGGTCCCAGG

TGCAGCTCCTGCCTTGTGTGGTAGTTCTAAATTCAAATTTCACCGGGAACTGGGCAACTAAGCAATGAGCCACAGCAAAATAATAATAATAATAATTTAA

AAAAATGTAACAAGTGAAGCTGTCGTTAAAACAACAATACTACCAACTGCCCATAAAAAAAAAAATTACTAATTTGATGTAGTCCTTTTCATGCCAGTAT

ATGTTCAATTGGTAGTTATAAATGTTGGACCTCCTTG
Translation
  AQEEISQKALTSEEIKMSEVKSHETLAIKEEASKVLIAEEVKRSAAASLEKSIVHEEVTKTSQASEEVKTHAEIKTLSTQMNITKGQRATLKANIAGA

TDVKWVLNGTELPNSEEYRYGVSGSDQTLTIKQASHREEGILSCIGKTSQGVVKCQFDLTLSEELSDAPSFITQPRSQNINEGQNVLFSCEVSGEPSPEI

EWFKNNLP ISISSNISVSRSRNVYTLEIRNAAVSDSGKYTIKAKNFHGQCSATASLTVLR RIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEITWS

CGGRKIQNQEQQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNINIRSM
Transcript ENSMUST00000111865
Sequence
GAGCAGTCGCGCATTCCCACCTCGCCTCGGGTGTAGGGATTGCATAGGAAACAAAACCACACAGTCAAGACTGTGTGGTTTTGTTTGGAGGGTTAGAGGC

TCACCGATTCATGTCGGAGATGGTTGGAAAAACCAACTCTACGTAGGACGTCGTTTCAGAAGCAAACTTGGGCTTGGTCCCACCCTTTTTGGGCACTCCT

GAGAAATCAG AGTGCCTGAAAAGATGACTACTCAAGCACCGATGTTTACGCAGCCGTTACAAAGCGTTGTGGTACTGGAGGGTAGTACCGCAACCTTTG

AGGCTCACGTTAGTG GTTCCCCAGTTCCTGAGGTGAGCTGGTTTCGGGATGGCCAGGTGATTTCAACTTCCACTCTGCCCGGCGTGCAGATCTCCTTTA

GCGATGGCCGCGCTAGATTGATGATCCCCGCCGTGACTAAAGCCAACAGTGGACGATACTCCCTGAGAGCCACCAATGGATCTGGACAAGCGACTAGTAC

TGCTGAGCTTCTTGTGACAG CCGAGACAGCACCACCCAACTTCAGTCAGCGGCTGCAGAGCATGACTGTGAGACAAGGAAGCCAAGTGAGACTCCAAGT

GAGAGTGACTGGAATCCCTACACCTGTGGTGAAGTTCTACCGGGATGGAGCCGAAATCCAGAGCTCCCTTGATTTCCAAATTTCTCAAGAAGGAGACCTC

TACAGCTTACTGATTGCCGAAGCATACCCTGAAGACTCCGGGACCTATTCTGTAAATGCCACCAACAGCGTTGGAAGAGCTACTTCCACTGCAGAATTGG

TGGTTCAAG GTGAAGAAGTAGTACCTGCTAAAAAGACAAAGACGATCGTGTCGACTGCTCAGATTTCAGAAACAAGACAAACCCGGATTGAAAAA AAG

ATTGAAGCCCACTTTGATGCCAGATCAATCGCAACAGTTGAGATGGTCATAGATGGTGCCACTGGACAGCTGCCACATAAAACACCTCCCAGGATACCTC

CTAAGCCCAAGTCCAGGTCTCCGACACCACCTTCCATTGCTGCCAAAGCACAGCTGGCCAGACAACAGTCCCCATCACCAATAAGACACTCTCCCTCCCC

AGTCAGACACGTGCGGGCACCAACCCCATCTCCAGTCAG GTCCGTGTCTCCAGCGGGGAGGATCTCCACTTCCCCGATCAGATCCGTGAAGTCGCCACT

GCTCATTCGCAAGACTCAGACCACCACCATGGCCACAGGCCCCGAGGTGCCTCCCCCTTGGAAGCAAGAGGGCTACGTGGCCTCCTCGACTGAGGCTGAG

ATGAGAGAGACGACAATGACAAGCTCTACCCAGATCAGAAGAGAAGAGAGGTGGGAAGGGAGATACGGGGTCCAGGAGCAAGTGACCATCAGTGGAGCCG

CGGCTGCTGCGGCCAGTGCGTCGGTCAGCTCGTCATTCACGGCAGGAGCCATCACCACTGGGACTAAGGAG GTGAAACAAGAGACAGACAAGAGTGCAG

CTGTTGCGACTGTCGTTGCTGCTGTTGATATGGCCAGAGTGAGAGAACCAGCCATCAGTGCTGTAGAGCAAACTGCTCAGAGGACAACCACGACTGCTGT

GCATATACAACCTGCTCAAGAACAG GCGAGAAAAGAGGCGGAGAAGACCGCAGTAACCAAGGTTGTAGTTGCTGCCGATAAAGCCAAGGAACAGGAACT

AAAATCACGAACCAGAGAAGTGATGGTGACAACGCAAGAGCAGACTCACATATCTCATGAGCAG ATAAGAAAAGAAACTGAAAAAGCATTTGTACCAAA

GGTAGTGATCTCCGCAACCAAAGCCAAAGAGCAAGAAACTAGAATCACGGGAGAAATTACTACAAAACAAGAGCAAAAGCGAATAACTCAAGAAACA AT

GATGAAGGAAACTAGGAAAACAGTGGTACCCAAAGTCATAGTTGCCACGCCCAAGATTAAAGAGCAAGATTTAGTATCAAGAAGTAGAGAAGCCATCACT

ACCAAAAGAGATCAAGTTCAAATAACTCAGGAAAAG AAGAGAAAGGAAGTGGAAACAACTGCCTTGTCTACAATAGCAGTTGCTACTGCTAAAGCCAAA

GAGCAAGAAACAGTTCTGAGGTCTAGAGAAGCCATGGCCACTAGACAAGAACACATCCAAGTTACCCATGGACAG GTGGGCGTTGGGAAGAAGGCAGAA

GCCGTGGCAACAGTTGTAGCTGCTGTGGACCAGGCCCGAGTGAGGGAACCCAGAGAGCCTACGCATGTGGAGGAATCGCATTCTCAGCAGACTACGTTAG

AGTATGGCTACAAAGAACACATTTCCACCACAAAGGTCCCAGAGCAGCCCCGGCGCCCAGCCTCAGAGCCCCACGTTGTCCCTCAAGCAGTCAAGCCTGC

TGTGATTCAGGCTCCTTCTGAGACTCATATCAAAACTACTGACCAAATGGGAATGCATATATCGTCACAG GTCAAGAAAACTACAGATATCTCAACAGA

AAGATTAGTTCATGTGGATAAACGCCCCCGCACAGCGAGCCCTCACTTTACTGTTTCAAAAATTTCTGTACCTAAGACAGAACATGGATATGAG GCATC

GATAGCTGGTAGCGCTATCGCCACACTACAAAAAGAATTGTCAGCCACATCTTCAACTCAGAAGATCACCAAATCCGTGAAGGCACCCACCGTGAAGCCT

GGGGAGACGAGAGTAAGGGCGGAGCCCACCCCTTCCCCACAGTTCCCCTTTGCTGACATGCCGCCGCCAGACACTTACAAGAGTCAGGCTGGCATTGAGG

TGAAGAAGGAAGTCGGGGTGAGCATCAGTGGCAGCACCGTTCGTGAGGAGCACTTCGAAGTACTGCGCGGACGTGAAGCCAAG GTAACAGAGACAGCAC

GAGTGCCTGCTCCTGCTGAAGTGCCTGTTACTCCGCCTACCTTGGTCTCG GGCTTAAAAAACGTGACTGTCATAGAAGGCGAATCTGTCACCTTGGAGT

GCCACATCTCTGGATACCCATCCCCCAAGGTGACATGGTACAGAGAAGACTACCAAATCGAAAGTTCCATTGATTTCCAGATAACCTTCCAGGGTGGAAT

TGCTCGTCTCATGATCCGCGAAGCCTTTGCGGAAGACAGCGGACGGTTTACCTGCAGCGCCGTGAATGAGGCCGGGACCGTCAGCACTTCCTGCTATCTT

GCTGTGCAAG TGTCAGAAGAGTTTGACAAGGAAACAACTCTGACTGAGAAATTTGCCACCGAAGAGAAACG CTTCGTGGAGTCAAGAGATGTAGTCAT

GACCGACACCAGCATCACAGAGGAGCAGGCAGGGCCTGGAGAGCCTGCTGCGCCTTTCTTCATTTCAAAGCCGGTGGTCCAGAAACTGGTGGAGGGTGGG

AGTGTTGTGTTTGAATGCCAGATCGGCGGCAACCCAAAGCCCCACGTCTACTGGAAAAAATCTGGCGTTCCTCTCACCACTGGATACAG ATACAAAGTG

AGTTATAACAAGCAGACTGGGGAATGCAGACTGGTGATTTCTATGACGTTCGCTGATGATGCTGGAGAATACACTATTGTCATCCGAAACAAGCACGGGG

AGACGTCTGCATCTGCCTCCTTGCTGGAGGAAG CTGATTACGAGGCATTGGTGAAGACTCAGCAAGAAATGCTTTACCAGACACAAATGAGCACATTTA

TTCAAGAACCCAAAGTGGGGGAAATAGCACCTGGATTTGCATATTCTGAATATGAGAAGGAATATGAAAAGGAACAGGCCTTAATTAGGAAGAAAATGGC

CAAAGATACTGTGATGGTCAGGACTTTTGTAGAAGACCAA GAATTCCACATCTCTTCTTTTGAAGAGAGGCTCATTAAAGAGATTGAATACAGAATAAT

AAAGACTACGCTGGAAGAACTTCTTGAGGAGGATGGAGAAGAGAAGATGGCAGTCGACATTTCTGAATCTGAAGCTATCGAGTCAGGATTTGATATAAGG

ATAAAAAATTATAGAATTCTTGAGGGGATGGGTGTCACTTTTCATTGCAAGATGTCTGGATATCCGTTACCCAAG ATTGCGTGGTATAAGGATGGCAAG

CGCATCAGACATGGGGAAAGATATCAAATGGACTTTCTACAAGATGGCAGAGCCAGCCTGCGTATACCTGTTGTCCTTCCAGAGGACGAGGGCATCTATA

CTGCATTTGCCAGCAATATCAAAGGAAATGCGATTTGCTCTGGGAAGCTGTACGTGGAGCCTGCTGCACCATTTAGCGCTCCAACTTACATGCCCACACC

AGAAGCAGTGAGCAGAATCAG GTCTGTCTCTCCACGTTCACTGAGCAGGTCACCTATACGTATGTCTCCTGCGATGTCCCCTGCACGAATGTCCCCCGC

ACGGATGTCCCCTGCACGGATGTCCCCCGCACGGATGTCTCCTGGACGCAGGCTGGAGGAGACAGATGAATCACAGCTGGAGAGACTGTATAAGCCAGTC

TTTGTATTAAAACCTGCTTCTTTCAAATGTTTAGAAGGACAGACTGCCAGATTTGACTTGAAGGTTGTGGGCAGACCCATGCCAGAGACATTCTGGTTTC

ACAATG GACAGCAAATTGTCAATGATTATACGCACAAAGTCGTCATTAAAGAAGATGGAACTCAGTCACTGATCATTGTCCCTGCGTCACCCAGCGATT

CAGGAGAATGGACAGTGGTGGCCCAAAACAGAGCAGGAAAATCCACAATATCTGTGACTTTAACTGTAGAAG CTGTGGAACACCAGATCAAGCCAGCAT

TTGTGGAAAAACTGAAAAATGTCAACATAAAGGAAGGTTCCAGGCTCGAAATGAAAGTCAGAGCTACAGGCAACCCCAACCCTGACATTGTGTGGCTGAA

AAACAGTGACATCATTGTTCCTCATAAATACCCAAGGATCAG GATTGAAGGAACCAGAGGAGAAGCCGCCCTTAAGATTGATTCCATTATCAGCCAAGA

TTCAGCCTGGTATACAGCCACGGCTATTAACAAGGCAGGCCGAGACACCACAAGGTGCAAAGTCAATGTTGAGGTTGAGTTTGCAGAACCTGAACCGGAA

AGAAAGCTGATTATTCCACGAGGAACGTACAGAGCAAAGGAGATTGCTGCCCCAGAACTGGAGCCTCTCCATTTGAGATACGGTCAAGAACAGTGGGAGG

AGGGTGACCTCTATGACAAGGAGAAACAACAGAAACCGTTTTTCAAGAAAAAACTCACTTCCCTCAGACTGAAGCGCTTTGGACCTGCCCACTTTGAGTG

CAGACTCACACCAATTGGTGACCCAACCATGGTGGTGGAGTGGCTTCACGATGGGAAGCCCCTGGAGGCGGCCAACAGGCTTCGGATGATTAATGAATTC

GGCTACTGCAGCCTTGATTATGGAGCAGCGTATTCCAGAGACAGTGGTGTCATCACCTGCAGAGCTACTAACAAATATGGGACAGATCACACCTCTGCTA

CTCTTATTGTCAAAGATGAGAAAAGCCTAGTGGAAGAATCTCAACTGCCTGATGGGAAAAAAGGCTTACAGAGGATAGAAGAACTAGAGAGAATGGCTCA

CGAAGGTGCGCTGACAGGTGTGACAACAGATCAAAAAGAAAAACAAAAGCCAGACATTGTCTTGTTCCCAGAGCCAGTGAGAGTGCTGGAAGGGGAGACA

GCCAGATTCCGCTGCCGAGTGACAGGCTACCCTCAGCCCAAGGTCAACTGGTACCTCAATGGACAGCTCATCCGGAAAAGCAAAAGGTTCAGAGTTCGCT

ATGATGGCATTCACTATCTGGATATTGTGGACTGCAAATCCTATGACACAGGTGAAGTCAAGGTCACTGCGGAAAATCCTGAAGGTGTGACGGAACACAA

AGTAAAACTTGAAATCCAACAGAGGGAGGATTTCAGATCTGTCCTTAGGCGTGCTCCCGAGCCAAAGCCCGAGTTTCATGTACACGAACCGGGGAAACTT

CAGTTCGAAGTGCAGAAGGTAGACAGACCCGTGGACACCAGCGAAACCAAAGAAGTGGTGAAGCTGAAAAGGGCTGAAAGGATTACCCATGAGAAGGTGT

CCGAGGAGTCTGAAGAACTGCGCAGTAAATTTAAGCGCCGGACGGAAGAGGGATACTATGAAGCCATCACAGCCGTGGAGCTGAAGTCTCGCAAGAAGGA

TGAGTCTTACGAAGAGCTCCTCAAGAAAACTAAAGATGAGCTTCTGCACTGGACCAAAGAGTTAACTGAAGAGGAGAAGAAAGCCTTGGCTGAAGAAGGC

AAAATCACGATTCCAACCTTTAAACCTGAGCGAATCGAACTTAGCCCTAGTATGGAGGCACCCAAAATCTTTGAACGAATCCAGAGCCAGACCGTTGGCC

AAGGATCTGATGCTCACTTTAGAGTCAGGGTTGTGGGAAAACCAGACCCTGAGTGTGAATGGTATAAAAATGGTGTAAAAATTGAGCGATCTGACCGAAT

CTACTGGTACTGGCCAGAAGACAATGTTTGTGAACTGGTCATAAGAGATGTAACTGCAGAGGACTCTGCCAGCATCATGGTAAAGGCCATCAACATAGCT

GGGGAAACCTCAAGCCACGCATTCCTGCTCGTCCAAG CCAAGCAACTGATCACTTTTACACAAGAATTGCAAGATGTTGTTGCTAAGGAAAAGGACACC

ATGGCAACATTTGAATGTGAAACTTCAGAACCATTTATCAAAGTAAAATGGTATAAAGATGGTATCGAAGTTCATGCAGGGGATAAGTATAGGATGCACT

CTGACCGAAAAGTTCACTTCCTGTCTGTGCTGACCATCGACACATCTGATGCTGAAGACTACAGCTGTGTACTTGTGGAAGATGAAAATATCAAGACGAC

AGCGAAACTTATTGTGGAAG GTGCAGTAGTTGAATTTGTGAAAGAACTTCAGGACATAGAAGTCCCAGAGTCATACTCAGGAGAGTTAGAGTGCATCAT

ATCTCCAGAAAACATAGAAGGCAAATGGTATCACAATGATGTGGAGTTGAAGTCCAATGGCAAATACTCAATTACATCCCGCCGTGGGCGCCAGAACCTC

ACAGTCAAGGATGTAACCAAAGAGGACCAGGGAGAGTACAGCTTTGTTGTTGATGGGAAAAAGACAACCTGTAAACTGAAGATGAAAC CCCGACCTATT

GCTATTCTCCAAGGACTTAGCGATCAAAAGGTCTGCGAGGGTGACATTGTTCAACTTGAAGTCAAAGTCTCCTTAGAAAATGTAGAAGGTGTCTGGATGA

AAGATGGTCAAGAAGTACAACACAGTGACAGAGTTCACATTGTAATAGACAAGCAGTCCCACATGCTACTTATTGAAGACATGACCAAAGAAGATGCTGG

GAATTACTCCTTCACTATTCCTGCCCTTGGACTCTCCACCAGTGGGAATGTCTCTGTCTATA GTGTTGATGTGATAACACCTCTCAAAGATGTCAATGT

GATTGAAGGTACCAAGGCTGTACTTGAATGCAAGGTCTCAGTTCCCGATGTAACTTCTGTTAAATGGTACCTAAATGATGAACAAATCAAGCCTGATGAT

CGTGTGCAATCCATTGTCAAAGGCACCAAACAGCGACTTGTGATTAACCGAACCCATGCTTCTGATGAAGGACCTTACAAGCTGATGGTTGGCAGGGTGG

AAACCAGCTGTAACCTGTCTGTAGAGA AAATTAAAATTATCAGAGGTCTCCGTGACCTTACCTGCACAGAAACACAAAATGTGGTCTTTGAGGTTGAGC

TATCCCACTCAGGAATTGATGTTGTATGGAATTTTAAGGGCAAGGAAATTAAGCCCAGTTCTAAATATAAAATTGAAGCTCATGGGAAAATATACAAACT

GACAGTCCTCAATATGATGAAAGATGATGAAGGGGAGTATGCATTCTATGCAGGAGAAAATACAACATCTGGAAAGCTAACTGTGGCAG GAGGAGCCAT

CTCCACACCACTCACAGACCAGACTGTGGCTGAATCCCAGGAGGCTGTGTTTGAATGTGAAGTTGCCAACCCTGAGTCTGAGGGGGAATGGCTGAAGGAT

GGAAAGCACTTGGCTCTGAGTAACAACTTCAGAGGTGAATCCGATGGCCACAAAAGGAGGCTTGTCATCGCTGCCGCCAAGTTAGATGACGCTGGAGAAT

ATACCTACAAGGTGGCTACCTCCAAAACATCTGCCAAGCTGAAAGTTGAAG CTGTCAAAATTAAGAAGACCCTGAGGAACCTCACTGTGACAGAGACAC

AGGATGCAGTCTTCTCTGTTGAACTCACACACCCAGATGTCAAAGGGGTCCAGTGGATCAAAAACGGAGTTGTCTTAGATTCCAACGACAAGTATGAGAT

CTCAGTCAAAGGGACACTTTATTCACTGAAGATTAAAAACTGTGCCATGGCAGATGAATCTGTCTACGGCTTCAAACTGGGGAGGCTAGGAGCTAGCGCC

CGGCTGCACGTTGAGA CTGTCAAGATTATTAAGAAACCAAAGGACGTGACCGCCTTGGAAAACGCCACTGTTACCTTCGAAGTCAGTGTTTCCCATGAC

ACGGTGCCAGTAAAATGGTTCCATAAGAACGTGGAGATTAAGCCAAGTGACAAGCACAGACTGGTCTCAGAGAGAAAAGTCCACAAACTCATGCTTCAGA

GCATCTCCCCCTCGGATGCCGGCGAGTACACAGCCATGGTGGGCCAGCTGGAGTGCAAAGCCAAGCTGTTTGTGGAGA CACTCCATATCACAAAGACTA

TGAAAAGTATCGAGGTTCCTGAAACCAAAGCTGCCTCTTTCGAGTGTGAGGTGTCCCACTTCAATGTCCCCTCCATGTGGCTAAAGAACGGAGTGGAAAT

TGAGATGAGTGAAAAATTCAAGATCGTCGTGCAGGGGAAACTGCACCAGCTGATCATCATGAACACGAGCACGGAGGACTCAGCGGAATACACATTTGTT

TGTGGCAATGACCAAGTCAGTGCTACCCTGACAGTGACCC CAATCATGATTACATCCATGCTGAAAGACATCAATGCTGAAGAAAAAGATACCATAACT

TTTGAGGTGACAGTAAACTATGAAGGCATCTCTTACAAATGGTTAAAGAACGGTGTGGAGATCAAGTCGACTGACAGGTGCCAGATGAGAACCAAGAAGC

TCACGCACTCGCTGAACATCAGGAATGTTCACTTTGGAGATGCTGCTGATTATACTTTTGTGGCTGGAAAAGCCACATCGACGGCCACCCTTTATGTGGA

AG CTCGTCATATAGAATTTAGGAAACACATTAAGGATATTAAGGTTCTGGAGAAGAAACGAGCCATGTTTGAATGTGAAGTTTCTGAGCCCGACATAAC

TGTTCAGTGGATGAAAGATGGCCAAGAGCTTCAGATAGCAGACAG GATAAAGATCCAGAAGGAGAAATATGTCCACCGCCTTCTGATCCCATCCACACG

CATGTCTGATGCCGGGAAATATACAGTGGTGGCAGGAGGCAACATGTCAACTGCTAACCTCTTTGTCGAAGGCAGGGATGTCCGCATCCGGAGCATTAAG

AAGGAGGTCCAG GTCATTGAGAAGCAGCGTGCTGTCGTGGAGTTCGAAGTCAATGAGGATGACGTAGACGCCCACTGGTATAAAGATGGCATTGAAATC

AACTTCCAAGTTCAAGAGCGACACCAGTATGTGGTGGAGAGAAGAATTCACCGGATGTTTATATCAGAAACAAGACACAGTGACGCAGGCGAATACACCT

TTGTGGCAGGCAGAAACAGGAGTTCTGTGACTCTTTATGTCAATG CTCCAGAACCACCCCAAGTCCTGCAGGAACTCCAGCCTGTCACTGTACAGTCCG

GCAAGCCGGCTCGCTTCTGCGCCGTGATATCAGGCAGACCGCAGCCCAAAATTTCCTGGTACAAGGAGGAGCAGCTGCTTTCCACTGGCTTCAAGTGCAA

ATTTCTGCACGACGGGCAGGAGTACACACTTCTGCTCATTGAGGCTTTCCCAGAGGATGCGGCAGTCTACACCTGTGAAGCCAAGAATGACTACGGAGTA

GCCACAACGTCGGCTTCTCTGTCCGTGGAAG TTCCAGAAGTTGTATCTCCGGATCAGGAAATGCCAGTCTACCCGCCTGCCATAGTCACTCCACTTCAG

GACACAGTTACTTCTGAGGGGCGCCCAGCGCGTTTCCAGTGCCAAGTTTCAGGGACAG ATTTGAAGGTGTCTTGGTACTGCAAAGACAAGAAAATCAAA

CCATCTCGGTTCTTCAGGATGACCCAGTTTGAAGACACCTACCAGCTGGAGATCGCTGAAGCCTACCCCGAGGACGAGGGAACGTATGCCTTTGTTGCTA

ATAATGCTGTGGGCCAAGTGTCCAGCACTGCCACCCTGAGGCTGGAAG CCCCCGAGTCGATTCTGCATGAGAGGATCGGCCAGCAAATCGAAATGGAGA

TGAAAG AAATTGCTAGCCTTCTGTCCGCCGAGGAAGATTTTCAAACCTATAGTTCTGATCTACGTTTACCTAATGCGAATGAAACACTTGAACTTCTGT

CTGAGCCTCCAGCTCGTTCCACCCAGTTTGATTCCAGACAGGAAGGCGCTGCCCCAGTTTTCATCAGAGAAATATCAGACGTTGAAATAAGCGTCGAAGA

TGTAGCTAAATTGTCTGTTACTGTCACTGGCTGCCCCAAGCCTAAAATTCAATGGTTCTTTAATGGGATGCTGTTAACCCCTTCTGCTGACTACAAATTT

GTCTTTGATGGGGATACCCACAGCCTAATCATTCTGTTCACCAGATTTCAGGATGAGGGGGAGTACACGTGCCTGGCCAGTAATGAATATGGAAAGGCAG

TGTGTAGCGCTCACCTAAGAATAAGTCCCAGAGGAGAGAGGAGCACGGAGATGGAGTCAGGAGAGAAAAAGGCTCTGGAAAAGCCCAAAGGGCCTTGTCC

TCCTTATTTTTTCAAGGAATTAAAACCAGTGCACTGTGGCCCAGGAATCCCTGCTGTCTTTGAGTACTCGGTGCACGGAGAGCCTGCCCCCACTGTCTTG

TGGTTCAAAGAAGACATGCCACTTTATACCAGTGTTTGCTACACCATCATTCACAGTCCTGACGGATCCGGGACCTTCATCGTTAATGACCCACAGAGGG

GAGATAGTGGCCTGTACCTCTGTAAAGCCCAGAACCTCTGGGGGGAGTCCACCTGTGCCGCAGAGCTTCTTGTGCTTCCAGAAGACACAGATGTGCCCGA

TGCCTCCTGCAAGGAAGAGTCCACCTTAGGAGTTCCTGGTGATTTTCTGGAAACATCTGCCAGGGGCCCTTTAGTTCAGGGAGTTGACTCACGGCAGGAA

ATTACAGCTTTTGCCGAGGGTACCATTTCGAAAGCTGCTTTAATTGCAGAGGAAACGCTGCAGCTTTCTTACGAGCGTAGTGTTGATGACAGTGAAGTGG

GTACTGGGGTGACCATAGGGGCCCAGAAGCTGCCGCCTGTTGTATTGTCCACTCCCCAGGGCACTGGGGAGCTGCCTTCCATTGATGGTGCAGTTCACAC

ACAGCCAGGCAGAGGACCACCCCCCACTTTAAACCTGCAGGCAGTCCAGGCTCAGACAACCCTCCCCAAGGAAGCTACTCTACAGTTTGAAGAGCCTGAG

GGAGTCTTCCCAGGTGCCTCATCTGCAGCACAAGTGAGTCCGGTCACCATCAAACCTCTGATAACCTTAACAGCTGAACCCAAAGGGAATTATCCACAGT

CTTCCACAGCAGCTCCTGATCATGCACTTCTGTCCTCTGTGGCTGCAGAAACACTTCAGCTAGGAGAAAAGAAAATCCCAGAAGTGGACAAAGCACAAAG

AGCTCTCCTCCTGAGTCAGAGCTTAGCTGAGGGATGTGTAGAAAGTTTAGAGGTTCCTGATGTTGCAGTCTCTAACATGCGCTCTGAGCCCCAAGTCCCT

TTCCAACATACATGCACAGAAGGCAAGATCCTGATGGCTAGTGCAGACACTCTAAAAAGCACAGGGCAAGATGTTGCACTGAGGACCGAGGAAGGCAAGT

CCCTAAGCTTCCCACTAGCACTTGAGGAAAAGCAGGTCCTACTTAAGGAAGAGCAATCAGAGGTCGTGGCAGTGCCCACTAGCCAAACCTCTAAGTCTGA

GAAAGAGCCAGAGGCCATAAAGGGAGTGAAGGAGGTACGAGAACAGGAGCTGCTTTCTAAGGAAACATTGTTTCCTAGTATGCCTGAAGAGCAGCGATTA

CATCTGAAAACTCAGGTCCGCAGGGCTTTGCAAGCTGCCGTGGCCAGGGAACAAGCAAATCTTTTCTCTGAGTGGCTAAGAAACATTGACAAGGTGGAGG

TCACAGCCGTAAACTTCACTCAAGAGCCCAAGCGTATCCTGTGCACCTACCTTATTACCTCAGTGAGCTCACTAACCGAAGAGTTAACCGTCACTATTGA

AGACATAGATCCTCAAATGGCTAACCTGGAAACTGGACTGAAGGATGCCTTGTGCTCCATTGTCTGTGAAGAAAGAAACATCTTAATGGCTGAGGATCCG

AGGATTCACGAAGAAGACAAAATAGACGTGCAAGGCGGAAGAGATCACCTTTCAGATGCACAGAAAGTTGAAACCGTCATAGAGGCAGAAGCTGACTCTA

AGTACCTTGTCTCCAAAGAAGAGGTCAGTTGGTCGAAAGTGGAAAGTCAACTCAAAGATGGAGATACCAATGAGGTTCCGCAGGCTGAGACTCTGAAATT

AGCAGAAGAGAGTGGTACCCAGAAGACCAGTACAGAGATGTCACAAGAAGAAGCTGAGGGTACCTTAGCTGACCTTTGCCCTGCTGTCCTTAAACACTTA

GTGGATACCATTTCTGAGGAAGGAGATACTGTCCACCTTACATCATCCATATCAAATGCTAAGGAGGTGCACTGGTATTTCAAGGGTAACCTGGTGCCCT

CAGACGGAAAGTTCAAGTGTTTAAAGGAGCAGAATGCCTACACTCTGGTAATTGAGGCAGTAAAGACGGAGGATGAAGGGGAGTATGTCTGCGAAGCCTC

AAATGACAGTGGGAAAGCAAAGACATCAGCAAAGCTCACTGTGGGAGAAAGAG CTGCCCCTGTGATCAAAAGGAGAATTGAGCCCCTGGAAGTAGCTCT

GGGCCACCTGGCCAAATTCACCTGTGAGATCCAAGGAGCCCCCAACGTCCGGTTCCAGTGGTTCAAAGCTGGCAGAGAGATCTATGAGAGCGACAAGTGT

TCCATTCGATCTTCGAACTATGTCTCCAGCCTGGAGATCCTGAGAACCCAGGTCGTTGACTGCGGGGAGTACACCTGCAAAGCCTCCAATGAGTATGGCA

GTGTCAGCTGCACAGCCACACTAACTGTGACAG - UNI36362 - TGCCTACAGCTGAAAAGAAAGTTCGTAAATTACTTCCTGAACCTAAGCCGCAG

CCAAAGGAAGAGGTGGTGCTGAAAAGCG - UNI36362 - TTCTAAGAAAGAAACCCGAGGAAGAAGAACCTAAAGTAGAACCTAAAAAAGTAGAAAA

AGCTAAAAAACCGGAAG AGCCACAGCCACCTCCAAAAGCCGTTGAAGTTGAAGCTCCTCCAGAGCCTACACCAAAGGAAAGGAAAGTTCCAGAACCGGC

CAAAG - UNI17655 - TTCCTGAAATTAAGCCAGCGATACCTCTCCCTGGACCTGAACCAAAGCCAAAGCCTGAGCCAG - UNI17655 - AGGT

GAAAACCATGAAAGCTCCACCCATCGAGCCGGCACCCACTCCCATCGCTGCCCCCGTGACAGCGCCTGTGGTTGGGAAGAAAGCAG AAGCCAAACCTAA

GGATGAGGCTGCCAAGCCAAAAGGTCCCATCAAAG GTGTAGCCAAAAAGACTCCTTCACCAATAGAAGCTGAAAGGAAAAAGCTCAGACCAGGAAGCGG

TGGAGAGAAACCTCCAGACGAAGCTCCGTTCACTTACCAACTCAAGGCCGTGCCACTGAAATTCGTGAAAGAAATCAAAGACATCGTTTTGACAGAGGCA

GAGTCTGTGGGCTCTTCTGCCATCTTCGAATGTTTGGTCTCCCCATCCACTGCCATTACAACCTGGATGAAGGACGGCAGCAACATCCGTGAGAGCCCAA

AGCACAGATTCATTGCAGACGGCAAAGACAGGAAGCTGCACATTATCGACGTTCAGCTGTCTGATGCTGGTGAATACACCTGTGTGCTACGCTTGGGAAA

TAAAGAGAAGACGTCCACTGCTAAGCTCATCGTAGAAG AACTTCCTGTGCGCTTTGTGAAAACACTGGAGGAGGAAGTCACGGTGGTCAAGGGGCAGCC

GTTGTACTTGAGCTGTGAGTTGAACAAAGAACGCGATGTGGTCTGGAGGAAGGATGGTAAGATTGTGGTGGAGAAACCTGGCAGGATCGTGCCTGGTGTC

ATTGGCCTGATGCGGGCCCTGACCATCAATGATGCTGATGACACTGATGCCGGAACATACACTGTGACTGTGGAAAATGCCAACAACCTGGAATGTTCTT

CTTGTGTAAAAGTAGTAG AAATCATTAGAGAATGGCTTGTGAAACCTATCCGAGATCAGCATGTGAAGCCCAAGGGAACAGCTGTTTTCACCTGTGACA

TAGCCAAGGACACGCCAAACATTAAGTGGTTCAAAGGCTATGACGAGATCCCCTTGGAACCAAACGACAAGACTGAGATACTGAAAGAGGGAAACCACCT

CTTTCTCAAGGTTAAGAATGCTATGCCAGAAGATATTGATGAGTATGCAGTGGAAATTGAAGGGAAAAGATACCCAGCAAAGCTGACACTTGGAG AGCG

CGAAGTTGAGCTACTTAAGCCGATAGAAGATGTCACCATTTATGAGAAGGAAAGTGCCAGCTTTGATGCAGAAATCTCAGAGGAAGACATTCCTGGGGAG

TGGAAGCTGAAGGGCGAGCTTCTGCGGCCCTCGCCT ACTTGTGAAATCAAAGCTGAAGGTGGGAAGCGCTTCTTAACTTTGCACAAAGTGAAACTGGAC

CAAGCTGGCGAAGTCCTCTACCAGGCTTGCAATGCGATCACAACTGCCATTCTGACAGTCAAAG AAATCGAGCTTGACTTTGCTGTACCCCTGAAGGAT

GTGACTGTCCCAGAGAAGAGACAGGCTCGGTTTGAATGTGTCCTCACCAGAGAGGCAAATGTCATATGGTCTAAAGGGCCTGATATAATCAAGGCATCTG

ACAAATTTGATATTATTGCTGATGGAAAGAAACACATTCTTGTTATCAACGACTCTCAGTTTGACGATGAAGGAGTCTATACTGCAGAGGTGGAGGGCAA

GAAGACGTCAGCACAATTATTTGTGACAG GCATAAGACTTAAGTTCATATCACCACTGGAAGATCAAACAGTAAAAGAAGGCCAAACAGCAACTTTTGT

CTGTGAGCTCTCTCATGAAAAAATGCACGTGGTCTGGTTCAAAAACGATGTCAAGCTACACACAACCAGGACAGTGCTCATGTCTTCTGAGGGAAAGACT

TATAAGCTGGAGATAAGGGAGACCACACTGGATGATATCTCACAGATCAAAGCTCAAGTGAAGAACCTCAGCTCTACAGCCAACCTGAAGGTCTTGG AG

GCCGATCCCTACTTCACCGTGAAATTACACGACAAGACTGGCGTGGAGAAGGACGAGATCATTCTTAAGTGTGAAGTGAGCAAAGATGTTCCGGTCAAAT

GGTTCAAAGACGGGGAAGAGATTGTGCCTTCGCCCAAACATTCTGTCAAGACCGACGGCCTGCGCCGCATCTTAAAGATCAAGAAGGCAGAGCTCAAAGA

CAAAGGGGAATATGTGTGCGACTGCGGTACAGACACCACCAAGGCCAACGTCACTGTTGAGG CTCGACTCATAAAAGTGGAGAAACCCCTGTACGGCGT

GGAAGTGTTTGTGGGTGAAACCGCCCGCTTTGAAATTGAACTGTCTGAACCTGACGTGCATGGCCAGTGGAAGTTAAAGGGAGAGCCTTTGACTGCTTCT

CCT GACTGCGAAATCATCGAAGATGGGAAGAAACATGTCTTGGTTCTGTATAACTGTCAGCTGGATATGACCGGGGAGATATCCTTCCAGGCCGCCAAC

GCTAAATCAGCAGCCAACCTGAAAGTGAAAG AACTGCCGCTCATTTTCATCACCCCTCTGAGTGACGTCAAAGTCTTTGAGAAAGATGAGGCGAAGTTT

GAGTGTGAAGTATCCAGGGAGCCCAAAACATTCCGCTGGCTGAAAGGAACCCAGGAAATCACTGGTGATGACAGATTTGAGCTCATCAAGGATGGCACCA

GGCATTCATTGGTGATCAAGTCAGCAGCTTTTGAAGATGAGGCCAAATACATGTTTGAAGCTGAAGATAAACGCACAAGCGGCAAACTGATCATTGAAG 

- UNI35827 - GAATCCGTCTCAAATTCCTGACCCCACTCAAGGATGTGACAGCCAAAGAAAGGGAAAATGCCGTGTTTACTGTGGAGCTGTCCCATG

ACAACATCCCAGTGAGCTGGTTCAAGAACGACCAGCGCCTGCACACCAGCAAGCGGGTCTCCATGCATGATGAAGGGAAAACACACTCCATCACGTTCAA

AGACCTGTCTATTGACGACACCTCCCAAATTAGAGTGGAGGCCATGGGGATAAGTTCAGAGGCTAAGCTCACTGTGCTGG - UNI35827 - - UNI3

5899 - AGGGAGACCCATACTTCACAGGAAAGCTTCAAGATTACACAGGCGTGGAGAAGGATGAAGTGATTCTTCAGTGTGAAATCAGCAAAGCAGACG

CACCCGTGAAATGGTTTAAGGACGGGAAGGAAATTAAGCCGTCTAAAAACGTTGTTATCAAGGCTGACGGCAAGAAACGCATGCTGATCCTGAAGAAGGC

CTTGAAATCAGATATCGGCCAATATACCTGTGACTGTGGGACAGACCAGACCTCTGGGAAGCTGGACATTGAAG - UNI32138 - - UNI35827 -

 - UNI35899 - ATCGGGAAATTAAACTGGTGCGACCCCTGTACAGCGTGGAGGTGATGGAGACCGAGACGGCCCGCTTTGAAACTGAGATCTCTGAA

GATGATATACATGCCAACTGGAAACTGAAGGGAGAGGCACTGCTCCAAACACCT - UNI32138 - - UNI33036 - - UNI35899 - GAATGT

GAAATTAAAGAAGAAGGCAAGATCCACGTCCTTATCTTACACAACTGCCGCCTAGACCAGACTGGAGGTGTAGATTTCCAAGCTGCCAATGTCAAATCTA

GTGCCCACCTCCGAGTTAAAC - UNI32138 - - UNI32541 - - UNI33036 - CACGGGTAATTGGTCTGCTGAGGCCTCTAAAGGATGTTA

CAGTGACCGCAGGGGAAACGGCCACCTTTGACTGCGAGCTCTCCTATGAGGATATCCCAGTGGAATGGTACCTCAAAGGGAAGAAGCTGGAGCCTAACGA

TAAG - UNI14991 - - UNI16643 - - UNI32541 - - UNI33036 - GTGGTGACACGTTCAGAAGGAAGAGTTCACACGCTCACCCTGA

GGGATGTGAAGCTAGAAGATGCTGGCGAAGTCCAACTAACTGCAAAGGATTTCAAAACTCAGGCCAATCTCTTTGTGAAAG - UNI14991 - - UNI

16643 - - UNI32541 - AACCCCCGGTTGAGTTCACTAAGCCTCTTGAGGACCAGACGGTCGAAGAGGAGGCCACTGCAGTACTGGAGTGTGAAGT

ATCCAGAGAAAATGCCAAAGTGAAATGGTTCAAAAATGGGACAGAAATCCTCAAAAGCAAGAAGTATGAAATCGTTGCTGATGGCAGGGTCAGGAAGCTC

ATTATTCATGGTTGTACCCCAGAGGATATCAAAACGTACACTTGTGATGCTAAAGATTTTAAGACCTCCTGTAACCTGAATGTTGTTC - UNI14991 

- CTCCTCATGTGGAATTCTTAAGACCACTCACAGACCTCCAAGTCAAAGAAAAAGAAACTGCTCGGTTCGAGTGCGAAATTTCCAAAGAAAATGAGAAG

 GTTCAGTGGTTTAAAGATGGTGCTGAAATTAAAAAGGGCAAAAAGTATGACATCATTTCTAAGGGAGCAGTACGAATTCTTGTCATCAACAAATGTCTA

CTGAATGATGAAGCAGAATATTCCTGTGAAGTGAGGACAGCAAGAACTTCCGGCATGCTGACAGTCCTAG AAGAAGAAGCTGTCTTCACAAAAAATCTT

GCCAACCTTGAAGTTAGTGAAGGAGACACTATCAAACTGGTGTGTGAAGTCTCCAAGCCTGGGGCAGAAGTGATTTGGTACAAAGGGGATGAGGAGATCA

TCGAAACAGGGAGATTTGAAATACTTACTGATGGAAGGAAGAGAATCTTGATCATTCAGAATGCGCAGCTTGAGGATGCAGGCAGCTACAACTGTCGACT

CCCAAGTTCTCGAACGGACAGCAAAGTCAAAGTACACG AACTTGCTGCTGAGTTCATCTCGAAGCCTCAAAACCTTGAAATTCTTGAAGGAGAAAAGGC

TGAGTTTGTCTGCACTATCTCAAAGGAAAGCTTCGAAGTTCAGTGGAAGAGGGATGATCAGACACTTGAATCTGGAGATAAATATGACATCATTGCTGAT

GGCAAAAAGAGAGTCCTAGTTGTAAAGGATGCCACATTACAAGACATGGGCACTTACGTAGTCATGGTTGGGGCTGCCAGAGCCGCAGCTCACCTGACAG

TCATTG AAAAACTCAGGATCATAGTTCCTCTTAAGGACACCAAGGTGAAGGAACAACAAGAGGTTGTCTTCAACTGCGAAGTCAATACTGAAGGTGCCA

AAGCCAAATGGTTCAGAAATGAAGAAGCCATATTTGATAGTTCAAAATACATCATTCTCCAAAAAGACCTGGTCTACACCCTCAGAATCAGAGATGCACG

GTTAGATGACCAAGCCAACTTTAATGTGTCTTTGACCAATCACAGAGGTGAAAATGTTAAAAGTGCAGCCAATCTAATAGTGGAAG AGGAAGATCTTAG

GATTGTTGAACCTCTTAAAGATATTGAAACAATGGAGAAGAAGTCAGTCACATTCTGGTGCAAGGTGAATCGTCTCAATGTGACACTGAAGTGGACCAAA

AATGGAGAAGAAGTGGCTTTTGACAACCGTATATCATACCGAATTGATAAGTACAAACACTCTCTAATCATCAAGGACTGTGGCTTCCCAGATGAAGGTG

AATACGTCGTCACTGCTGGGCAAGATAAATCCGTGGCAGAGCTGCTCATCATAGAAGCCCCAACAGAATTCGTGGAGCACCTGGAAGACCAGACGGTCAC

AGAGTTTGATGACGCTGTCTTCTCCTGCCAGCTCTCCAGAGAGAAAGCGAATGTAAAATGGTACAGAAATGGAAGAGAAATCAAGGAAGGCAAAAA ATA

CAAGTTTGAGAAGGATGGGAGCATCCACAGGCTCATCATAAAAGACTGCAGGCTGGAGGATGAGTGTGAATACGCTTGTGGTGTAGAGGACCGCAAGTCC

CGAGCTAGACTTTTTGTAGAAG AAATTCCAGTTGAGATTATCAGGCCTCCTCAAGACATTCTTGAAGCCCCTGGTGCAGACGTTATCTTCTTGGCTGAG

CTCAACAAAGATAAAGTGGAGGTCCAATGGCTTAGAAATAACATGATCGTCGTCCAGGGTGACAAGCACCAGATGATGAGTGAAGGAAAGATACACAGGC

TACAGATTTGTGATATTAAGCCACGTGACCAGGGCGAATACAGATTCATTGCCAAAGATAAAGAAGCCAGGGCTAAACTTGAATTAGCAG CTGCACCTA

AAATCAAGACAGCTGATCAAGATCTCGTCGTTGATGCTGGCCAGCCTCTGACAATGGTGGTACCCTATGATGCCTACCCCAAAGCAGAAGCTGAATGGTT

TAAAGAGAACGAACCTCTATCTACAAAAACCGTTGACACTACGGCTGAGCAGACTTCTTTCAGAATCTCAGAAGCCAAGAAGGACGACAAGGGGAGGTAT

AAAATCGTGCTTCAGAACAAGCATGGGAAAGCAGAGGGCTTCATCAATTTACAAGTTATTG ATGTTCCCGGGCCAGTTCGTAACTTAGAAGTGACAGAA

ACATTTGATGGTGAAGTAAGCCTCGCCTGGGAGGAACCACTAACGGATGGTGGGAGCAAAATCATAGGCTATGTTGTTGAAAGGCGTGATATCAAGAGAA

AGACCTGGGTTCTGGTCACTGACCGAGCGGACAGCTGTGAGTTCACTGTCACTGGACTACAGAAAGGAGGAGTGGAGTACCTGTTCCGTGTGAGTGCAAG

GAACAGAGTTGGCACTGGAGAACCCGTAGAAACTGACAGTCCTGTAGAAGCAAGGAGTAAATATG ATGTTCCAGGCCCTCCTTTGAATGTAACCATCAC

CGATGTGAATAGATTTGGTGTCTCACTAACATGGGAGCCACCAGAGTACGATGGAGGTGCTGAAATCACAAACTATGTGATTGAGCTGAGAGACAAGACT

TCTATCAGATGGGACACTGCCATGACCGTAAGAGCTGAAGACCTGTCAGCAACTGTCACTGATGTGGTTGAAGGACAGGAGTATAGTTTCCGTGTCAGAG

CCCAGAACCGAATCGGAGTTGGGAAACCAAGTGCAGCCACACCCTTTGTCAAAGTTGCTGATCCAATAG AGAGACCAAGTCCTCCTGTGAACCTAAACG

CCTCAGAACAGACACAGTCATCAGTTCAGCTCACCTGGGAGCCTCCTCTGAAAGATGGAGGCAGCCCCATACTGGGCTACATAATTGAAAGACGTGAAGA

GGGAAAAGACAATTGGATTCGCTGCAATATGAAACCTGTCCCTGAACTGACTTACAAG GTCACTGGATTGCAAAAAGGGAACAAATATTTATATAGAGT

GTCTGCAGAAAATGCAGCTGGTGTTTCAGATCCATCTGAGATCCTCGGTCCTCTCACTGCTGATGATGCGTTTG TTGAACCAACGATGGATTTAAGTGC

ATTCAAAGATGGTTTGGAAGTCATAGTTCCCAATCCCATCAAGATCCTGGTCCCAAGCACAGGCTATCCAAGACCAAAAGCAACCTGGACTTTTGGAGAT

CAAGTACTTGAAGAGGGGGATCGTGTGAAAATGAAGACCATATCAGCCTATGCCGAGCTTGTCATTTCTCCAAGCGAACGAACAGACAAAGGCATTTACA

CACTCACGTTAGAAAATCCTGTGAAGTCAATTTCTGGAGAAATCAATGTCAATGTAATTG CTCCTCCAAGTGCGCCCAAAGAACTGAAATTTAGTGATA

TAACAAAGGATTCTGTACATTTGACTTGGGAACCACCAGATGATGATGGAGGGAGTCCACTAACTGGATATGTTGTTGAAAAGAGAGACATGAGCCGGAA

AACATGGACTAAA GTTATGGACTTTGTTACTGATCTAGAATTCACAGTTCCTGATCTTGTTCAAGGAAAGGAGTATCTATTCAAAGTCTGTGCCCGAAA

TAAGTGTGGCCCTGGAGAACCTGCATATACTGATGAACCTGTAAATATGTCTGCCCCTGCAA CGGTACCTGACCCACCAGAGAATGTTAAATGGAGAGA

CAGGACAGCCAACAGCATCTTCCTAACATGGGATCCTCCTAAAAATGATGGTGGCTCTCGTATCAAAGGATATATAGTTGAAAAATGTCCACGTGGTTCT

GATAAATGGGTTGCCTGTGGAGAACCTGTTCCAGATACAAA AATGGAAGTGACAGGTCTTGAGGAAGGCAAATGGTATGCCTACCGTGTGAAGGCCTTG

AACAGGCAAGGTGCTAGCAAGCCAAGCAAACCCACTGAAGAGATCCAGGCGGTGGACACACAGG AGGCCCCTGAGATCTTCCTGGATGTGAAGCTCCTG

GCTGGGATCACTGTGAAAGCTGGAACGAAGATCGAACTTCCCGCCACGGTGACTGGAAAACCGGAACCGAAAATAACTTGGACCAAGGCTGACACCCTTC

TGAAGCCAGACCAGAGAATCACCATTGAAAACGTTCCTAAAAAATCCACAGTGACAATCACAGACAGTAAGAGAAGTGACACAGGCACATATATCATAGA

AGCCGTGAACGTCTGTGGCCGGGCCACTGCTGTGGTAGAAGTGAATGTCTTAG ATAAACCTGGACCACCAGCTGCCTTTGACATCACAGATGTAACCAA

TGAGTCGTGTCTTCTGACCTGGAACCCACCAAGAGACGATGGCGGGTCTAAGATCACAAACTATGTGGTGGAGAGAAAAGCAACAGACAGTGATGTGTGG

CATAAGCTCTCATCAACCGTTAAGGACACAAACTTCAAGGCAACCAAATTAACACCCAACAAAGAGTACATCTTCAGAGTTGCTGCAGAAAATATGTATG

GTGTTGGTGAGCCGGTTCAAGCTGCTCCAATAATAGCCAAATACCAGTTTG ATCCACCCGGACCTCCAACTCGCCTAGAACCTTCCGACATCACTAAAG

ATGCGGTGACGCTCACATGGTGTGAGCCAGATGATGATGGTGGCAGTCCCATCACTGGATACTGGGTTGAAAGATTAGATCCTGACACTGATAAATGGGT

TCGATGCAATAAGATGCCAGTGAAGGACACAACATACAG GGTAAAAGGTCTCACCAATAAGAAAAAGTACAGATTCCGCGTGCTTGCTGAAAATTTGGC

AGGGCCAGGAAAACCAAGTAGATCAACTGAACCAATCTTAATAAAGGATCCCATAG ATCCTCCATGGCCCCCTGGAAAACCAACTGTAAAGGATATAGG

CAAAACCTCCTTAGTATTGAACTGGACCAAGCCAGAACACGATGGAGGGGCAAAGATTGAGTCTTACGTCATTGAGATGCTAAAGACCGGAACAGACGAG

TGGGTCAGGGTGGCTGAGGGAGTTCCGACCACTGAGCATTTGCTCACAGGGCTAATGGAAGGCCAGGAATACTCATTCCGAGTGAGAGCCGTGAACAAGG

CTGGAGAGAGTGAGCCCAGTGAACCCAGCGACCCTGTGCTTTGCCGGGAGAAACTAT ATCCTCCATCACCACCTCGCTGGCTCGAAGTGATTAATATCA

CAAAAAATACAGCTGACCTAAAATGGACAGTTCCAGAGAAAGATGGAGGGTCACCCATCACCAACTACATTGTGGAAAAGAGAGATGTGAGACGGAAAGG

CTGGCAAACAGTGGACACCACTGTCAAGGACACCAAGTGCACGGTCACCCCACTGACAGAGGGGTCTCTGTATGTGTTCCGAGTTGCTGCAGAAAATGCC

ATAGGACAAAGTGACTACACAGAAATCGGAGATTCTGTCCTGGCCAAAGACACCTTCA CCACCCCTGGACCACCCTATGCCCTGACAGTGGTTGATGTG

ACAAAACGACATGTTGACCTAAAGTGGGAGCCACCTAAAAATGATGGCGGAAGACCAATACAGAG ATACATCATTGAGAAGAAAGAAAAATTAGGTACC

CGTTGGGTGAAAGCCGGGAAGACCTCAGGCCCTGACTGTAACTTCAGAGTAACTGATGTCATTGAAGGAACAGAAGTCCAGTTTCAAGTTCGGGCAGAAA

ATGAAGCAGGAGTTGGTCACCCAAGTGAGCCCACAGAAATTCTGTCAATCGAAGACCCAACAA GTCCTCCTTCACCTCCGCTTGATCTACATGTGACTG

ATGCTGGGAGAAAACACATTGCCATTGCTTGGAAACCACCAGAGAAAAATGGCGGAAGTCCTATCATAGGCTACCATGTTGAAATGTGTCCAGTAGGCAC

AGAGAAATGGATGCGAGTTAATTCTCGCCCAATAAAAGATCTGAAGTTCAAGGTTGAAGAGGGTATTGTTCCGGACAAAGAATATGTTCTGAGAGTGAGA

GCTGTCAATGCTGTCGGTGTCAGTGAGCCATCTGAAATCTCCGAAAACGTGGTCGCCAAAGACCCAGACT GCAAACCAACTATTGATCTAGAGACTCAC

GACATTGTTGTTATCGAAGGAGAAAAGTTAAACATCCCTGTGCCCTTCAGGGCTGTCCCAGTGCCAACCGTGAGCTGGCATAAAGATGGCAAAGAAGTTA

AAGCAAGTGACAGATTGACAATGAAGAACGACCACATCTCTGCACACCTCGAGGTTCCCAAGAGTGTCCATGCAGATGCTGGAGTGTACACCATCACCCT

GGAGAATAAGCTCGGCTCAGCAACGGCTTCAATCAATGTCAAAGTCATAG GTCTACCTGGTCCATGCAAAGATATTAAAGCAAGTGACATAACCAAAAG

TTCTTGTAAGTTAACATGGGAACCTCCAGAGTTTGATGGTGGAAGCCCGATTCTTCATTATGTCCTGGAACGGAGAGAAGCAGGGAGGAGGACATATATC

CCAGTCATGTCTGGTGAGAACAAACTGTCTTGGACCGTAAAAGATCTCATACCAAATGGTGAATACTTCTTCCGAGTAAAAGCAGTCAACAAGATTGGCG

GAGGAGAATACATTGAACTCAAGAATCCTGTCATTGCTCAAGATCCAAAGC AACCACCTGATCCACCTGTAGATGTTGAGGTTCATAATCCTACAGCTA

AGGCAATGACTATCACGTGGAAGCCACCCTTGTATGATGGAGGAAGCAAGATAATGGGTTACATCATAGAAAAGATCACTAAGGGTGAGGATAGATGGAA

GAGATGCAATGAACATCTGGTCCCTGTCCTGACCTACACAGCGAAAGGACTCGAGGAGGGGAAAGAGTACCAATTCCGTGTGCGAGCGGAGAACGCTGCT

GGTATTGGTGAACCTTCCCGGGCCACTCCCCCAACCAAAGCTGTCGACCCTATTG ATGCCCCAAAAGTCATCCTCAGAACAAGCCTGGAAGTAAAGCGG

GGTGATGAAATAGCACTTGATGCAACCATCTCTGGCTCACCATACCCAACAATCACATGGATAAAAGATGAAAATGTCATTGTTCCAGAGGAAATTAAGA

AGCGAGCGGCACCCCCAGTTAGGAGGAAGAAGGGCGAGGCTGAAGAGGAGGAGCCCTTTTCCCTCCCTCTGACAGAACGTCTGAGCATCAACAATAGCAA

ACAGGGAGAATCTCAGCTGCGCATCCGTGACTCTCTGCGGCCTGACCATGGCCAGTACATGATCAAAGTTGAGAATGATCACGGTGTTGCAAAAGCTCCT

TGCTCCGTCAGTGTGTTAG ATACACCAGGACCACCAATCAACTTTGTATTTGAGGATATTAGAAAGGACTCTGTCCTGTGTAAGTGGGAACCACCGCTT

GACGATGGTGGCAGTGAAATCATTAACTATACCTTGGAAAAGAAAGACAAGACCAAGCCCGACTCAGACTGGATTGTTATCACATCAACACTCAGAAACT

GCAAATATTCAGTAACAAAACTGATTGAAGGAAAAGAGTACCTCTTCCGTGTAAGAGCTGAAAATAGGTTTGGACCTGGGCCACCATGTGTTTCAAAGCC

ACTTTTAGCCAAAGATCCATTTG AACCACCTGATGCACCAGATAAACCCATTGTGGAAGATGTCACCAGCAACAGTATGCTAGTAAAATGGAATGAACC

GAAAGATAATGGAAGCCCCATCTTGGGTTACTGGCTTGAAAAACGTGAGGTCAATAGTACACACTGGTCTCGTGTCAACAAAACCCTTCTCAGTTCTTTG

AAAACCAAGGTAGATGGCTTGCTGGAAGGACTCACCTATGTCTTCCGAGTTTGTGCTGAAAACGCTGCTGGACCTGGAAAGTTCAGCCCACCTTCGGATC

CTAAAACAGCTCGCGATCCAATCT CTCCACCTGGGCCGCCTGTCCCGAGAGTTGCTGATACAAGCTCTACAACCATTGAGCTGGAGTGGGAACCCCCAG

CTTTCAATGGTGGTGGGGAAATTATGGGCTACTTTGTTGATAAGCAGCTGGTTGGCACAAATGAGTGGTCACGCTGCACAGAGAAGATGATCAAAGTCCG

TCAGTTCACTGTCAAAGAAATCCGAGAGGGTGCCGACTACAAACTTCGAGTGAGTGCTGTCAATGCAGCAGGCGAAGGACCACCTGGAGAAACAGAACCT

GTTACTGTGGCTGAGCCACAAG CAGAGCCTCCAACTGTGGAACTAGATGTTTCTGTCAAGGGTGGAATACAAATCATGGCTGGGAAGACTCTCAGAATC

CCAGCGGAGGTGACTGGCCGTCCTGTGCCCACAAAAGTATGGACCATCGAAGAAGGGGAGCTAGATAAAGAGCGTGTTATAATAGAGAATGTCGGAACCA

AATCTGAACTAATTATCAAGAACGCATTGAGAAAAGACCATGGCAGATACGTGATCACGGCAACAAACAGCTGTGGTTCCAAATTTGCCGCAGTCCGGGT

TGAAGTGTTCG ATGTCCCTGGCCCAGTTCTTGACCTCAAACCGGTTGTAACAAACAGAAAGATGTGTCTGCTTAATTGGTCCGATCCAGCAGATGATGG

CGGAAGTGACATCACAGGGTTTATAATTGAAAGGAAGGATGCTAAGATGCACACTTGGAGACAGCCCATCGAGACTGAGAGATCCAAGTGTGACATCACA

GGCCTTATAGAGGGACAAGAATACAAGTTCCGTGTCATTGCCAAGAACAAGTTTGGCTGTGGGCCTCCTGTTGAAATAGGACCAATTCTTGCAGTTGATC

CACTAG GCCCTCCAACATCTCCTGAAAGGCTCACATACACAGAAAGAACAAAATCCACCATCACACTTGACTGGAAAGAGCCACGCAGCGATGGTGGCA

GTCCCATTCAAGGATATATCATTGAAAAACGCCGCCATGACAAACCCGACTTTGAAAGAGTTAACAAGAGACTCTGCCCAACCACATCATTTCTGGTTGA

AAATCTTGATGAACACCAAATGTATGAGTTCCGTGTCAAAGCCGTCAATGACGTTGGTGAAAGTGAACCATCTCTGCCTCTTAACGTAGTCATACAGGAT

GATGAAG TCCCTCCCACTATTAAGTTGCGCCTGGCTGTTCGAGGAGACACTATCAAAGTTAAGGCAGGGGAGCCAGTTAACATCCCTGCAGACGTGACC

GGCCTCCCCATGCCTAAGATTGAGTGGTCCAAGAATGAAAAGGTGATTGATAAACCTACGGATACACTGAATATAACCAAAGAAGAAGTCTCCCGAAGTG

AGGCAAAGACTGAGCTTAGCATCCCTAAAGCAGCCCGAGAGGACAAGGGCACGTACACAATCACAGCTTCCAATCGTCTTGGCTCCGTATTCCGCAACGT

TCATGTGGAGGTTTATG ATCGTCCATCTCCACCCAGAAACCTCGCTGTTACTGACATCAAAGCTGAGTCTTGCTATTTGACGTGGGATGCCCCTCTAGA

CAATGGAGGCAGTGAAATTACTCATTACATCATTGACAAGCGTGATGCCAGCAGGAAGAAGTCCGAATGGGAAGAAGTCACTAACACTGCTGTTGAGAGA

AGATACGGG ATCTGGAAGCTTATCCCCAATGGTCAGTACGAGTTCCGAGTGAGGGCAGTGAATAAATATGGAATCAGTGATGAATGCAAATCAGACAAG

GTCGTCATTCAAGATCCCTACCGCCTCCCCGGGCCTCCTGGAAAACCGAAAGTCTTAGAACGTACCAAAGGATCTATGCTTGTGAGCTGGACCCCTCCTC

TGGACAACGGAGGGTCTCCAATTACTGGCTACTGGCTAGAGAAGAGAGAGGAAGGTGGTACCTACTGGTCACGTGTTAGCAGAGCACCAATAACCAAAGT

AGGACTGAAGGGTGTGGAATTCAATGTTCCGCGGTTGATTGAAGGCGTCAAATATCAATTTAGAGCCATGGCAATAAATGCTGCAGGAATTGGCCCTCCC

AGTGAACCATCAGACCCAGCTGTTGCAGGAGATCCTATAT ACCCTCCTGGGCCACCTTCTTGCCCAGAGGTCAAAGATAAAACAAAATCAAGCATCTCA

CTAGCATGGAAACCTCCAGCCAAAGACGGTGGCAGCCCAATCAAAGGCTACATTGTAGAGATGCAAGAGGAGGGAACCACGGACTGGAAGCCAGTCAATG

AACCCGATAAACTTCTCACTGCCTGTGAATGTGTGGTGCCTAATCTGAAAGAGCTCAGGAAGTACAGGTTCAGAGTGAAAGCTGTCAATGAAGCTGGAGA

GTCTGAACCAAGTGACACGACCGGAGAGATCCCTGCCACTGATATCCAAG AAGTTCCAGAGGTTTTCATTGACATTGGCGCACAAGACTGCCTGGTTTG

CAAAGCTGGCTCACAGGTCAAAATTCCTGCTGTGATCAAGGGACGCCCCACACCAAAATCATCTTGGGAATTTGATGGAAAAGCAAAGAAGGCAATGAAG

 GATGGAGTTCATGATATACCTGAAGATGCACAG CTGGAGACGGCCGAAAACTCATCGGTCATCATTATCCCAGAGTGTACTCGAGCTCACTCGGGCAA

ATACAGCATCACAGCCAAGAACAAAGCAGGACAGAAAACTGCCAACTGCAGAGTTAAAGTCATGG ACGCACCAGGCCCTCCCAAAGATTTGAAGGTCAG

TGACATCACAAGGGGTAGTTGCCGCCTCTCATGGAAGATGCCAGATGATGATGGAGGTGATAGGATCAAAGGCTACGTCATTGAGAAGAAGACCATCGAC

GGGAAAGCCTGGACGAAAGTCAATCCAAATTGTGGAAGCACCACATTTGTGGTACCAGATCTTATCTCTGAGCAGCAATACTTCTTCCGTGTTCGAGCAG

AAAACCGTTTTGGAATTGGCCCACCTGCAGAAACCATCCAGAGGACCACTGCCAGAGACCCAATAT ATCCTCCTGATCCCCCTATCAAACTCAAGATTG

GTCTCATAACAAAGAACACAGTGCACCTGTCGTGGAAACCTCCAAAGAATGATGGTGGCTCTCCTGTCACCCATTATATTGTTGAGTGTTTGGCTTGGGA

CCCTACCGGGAAAAAGAAAGAAGCCTGGAGGCAGTGCAATAGGCGTGATGTGGAAGAACTGGAGTTCACCGTGGAAGACCTCATAGAGGGAGGGGAATAT

GAATTCAGAGTCAAAGCCGTCAACGAGGCCGGGGTCAGCAAGCCTTCAGCCACTGTTGGTCCTGTGATTGTCAAAGACCAGACAT GCCCACCAGCCATT

GAGCTAAAAGAATTCATGGAAGTTGAAGAAGGAACTGATGTTAACATTGTGGCCAAAATCAAAGGTGTGCCGTTCCCAACTCTCACCTGGTTCAAGGCTC

CGCCAAAGAAACCCGACAGCAAAGAGCCTGTTGTTTATGACACCCATGTCAACAAACAGGTGGTGGATGACACTTGCACTTTAGTCATTCCTCAGTCTCG

CCGGAGTGACACTGGCTTATATTCTATCACAGCCGTAAACAACCTGGGGACAGCATCAAAGGAGATGAGACTCAATGTCCTTG GTCGTCCTGGCCCCCC

TGTGGGACCCATAAAGTTTGAATCTATTTCAGCGGATCAGATGACATTATCTTGGCTTCCACCTAAAGATGACGGTGGGTCTAAGATTACAAACTATGTC

ATTGAGAAAAGAGAAGCCAACAGAAAGACATGGGTACGTGTCTCCAGTGAACCTAAAGAATGCATGTACACAATTCCCAAATTGCTAGAAGGCCATGAAT

ACGTCTTCCGAATCATGGCCCAGAATAAGTACGGCATTGGAGAGCCACTTGACAGTGAACCTGAGACAGCACGGAACCTCTTCT CTGTCCCTGGAGCTC

CAGATAAACCAACAGTGAGCAGCGTCACTCGCAACTCCATGACTGTCAACTGGGAAGAGCCGGAATATGATGGAGGCTCTCCTGTGACAGGGTACTGGTT

AGAAATGAAAGACACCACTTCAAAGAGATGGAAGAGAGTTAACCGAGATCCCATCAAAGCCATGACTCTAGGTGTTTCTTACAAAGTGACTGGCCTTATT

GAAGGATCAGACTATCAGTTCCGGGTATATGCAATCAATGCCGCTGGTGTGGGTCCAGCAAGTCTTCCCTCAGATCCAGTGACTGCTAGAGATCCAGTTG

 CTCCCCCTGGTCCTCCATTCCCCAAAGTGACAGACTGGACAAAATCATCTGTGGACTTAGAATGGTCTCCTCCACTAAAAGATGGCGGATCCAAAATCA

CTGGCTACATTGTTGAGTATAAGGAAGAAGGAAAAGAAGAATGGGAAAAG GGTAAAGATAAAGAAGTGAGGGGGACAAAACTGGTTGTTACTGGATTAA

AAGAAGGAGCCTTCTACAAATTCCGTGTGAGAGCAGTCAATGTTGCTGGTGTTGGGGAACCTGGAGAAGTCACGGACGTTATTGAAATGAAGGACAGAAT

TG TGTCGCCTGACCTTCAGCTTGATGCCAGTGTCAGAGACAGAATAGTGGTCCACGCCGGAGGGGTGATCCGTATCATTGCCTATGTATCTGGGAAGCC

ACCTCCCACTGTCACCTGGAGTATGAATGAAAGAGCCTTGCCTCAAGAGGCCGCCATTGAGACCACAGCAATTAGCTCATCCATGGTCATCAAGAACTGC

CAGAGGAGCCACCAAGGCGTCTACTCTCTTCTTGCCAAAAATGAAGGCGGAGAAAGAAAGAAGACAATTATTGTTGATGTACTAG ATGTCCCAGGACCT

GTTGGAATACCATTCCTCTCTGACAACCTAACCAATGACTCCTGCAAACTGACATGGTTCTCTCCAGAAGATGATGGTGGCTCTCCAATCACCAATTATG

TCATTCAGAAGCGGGAAGCTGACCGCAGGGCATGGACCCCTGTGACATACACAGTCACTCGACAAAATGCTACTGTTCAGGGCCTTATTCAAGGAAAATC

CTACTTTTTCCGAATTGCAGCTGAGAATAGCATTGGCATGGGCCCATTTGTTGAGACACCAAATGCACTTGTCATTAGAGACCCAATAA CTGTGCCAGA

GAGACCTGAGGACCTGGAAGTCAAAGAAGTCACTAAAAATACTGTGTCTTTGACTTGGAACCCTCCCAAGTATGATGGCGGGTCAGAAATTATAAACTAT

GTCCTAGAAAGCCGCCTCATTGGTACTGAGAAGTTCCACAAAGTTACAAATGACAACCTGCTTAGCAGGAAATACACTGTGAAAGGCTTAAAAGAAGGCG

ATACATATGAGTACCGCGTCAGTGCCGTCAATATCGTTGGACAAGGCAAGCCATCATTTTGCACCAAGCCAATCACTTGCAAGGATGAACTGG CTCCAC

CTACACTTGACCTCGACTTCAGAGATAAGCTTACCGTCCGAGTTGGTGAATCTTTCGCCCTCACTGGCCGATACTCAGGCAAACCAAAGCCTAAGATTGA

TTGGTTCAAAGATGAAGCTGATGTACTGGAAGATGATCGTACTCACATAAAGACCACTCCCACGACACTTGCTCTTGAGAAGACAAAGGCCAAACGCTCA

GATTCTGGGAAATACTGTGTAGTTGTGGAGAACAGTACAGGCTCCAGGAAAGGTTTCTGTCAAGTCAATGTTGTTG ATCGTCCTGGACCACCAGTAGGA

CCTGTCATTTTTGATGAGGTGACCAAAGAATACATGGTTATTTCTTGGAAGCCACCTCTAGATGATGGAGGAAGTGAAATTACCAATTATATTATTGAGA

AGAAGGAGCTCGGTAAAGACATCTGGATGCCTGTGACATCTGCCAGTGCCAAAACTACATGCAAGGTCCCTAAACTGCTTGAAGGAAAAGATTACATCTT

CCGGATTCATGCGGAAAATCTATATGGAATAAGTGACCCTCTGGTGTCTGATTCAATGAAAGCCAAAGATCGATTCA GAGTCCCTGATGCACCTGAGCA

GCCAGTTGTCACAGAGGTCACCAAAGACTCGGCATTAGTAACCTGGAACAAGCCAAATGACGGAGGAAAGCCCATCACAAACTACATCCTGGAAAAGAGG

GAAACTATGTCTAAAAGATGGGTTCGAGTTACCAAAGAGCCTATTCATCCATACACTAAGTATAGGGTTCCTGATCTTCTAGAAGGATGCCAGTATGAAT

TCCGTGTTTCTGCAGAGAATGAAATTGGTATTGGAGATCCAAGTCCACCATCCAAACCAGTCTTTGCTAGAGACCCAATTG CTAAACCAAGTCCACCTA

TTAATCCTGAGGCAATAGATACAACATGTAATTCAGTTGAGCTAACTTGGCAGCCACCACGTCACGACGGTGGTAGCAAGATCCTGGGTTATATCGTGGA

GTACCAGAAAGTTGGGGATGAAGAGTGGAGACGAGCCAATCACACTCCTGAATCATGCCCTGAAACTAAATATAAAGTCACTGGCCTCAGGGATGGTCAG

AGCTACAAGTTCCGAGTACTGGCAGTCAACGAGGCTGGTGAATCGGACCCAGCCCACGTTCCTGAACCAGTTCTAGTAAAGGACCGACTTG AACCTCCT

GAGCTTATACTTGATGCTAACATGGCAAGAGAACAACACATTAGAGTTGGTGACACCCTAAGACTTAGTGCCATCATCAAAGGTGTGCCATTCCCCAAAG

TAACCTGGAAAAAAGAAGACAGAGAGGCTCCAACAAAAGCCCAAATTGATGTTACTCCAGTTGGGAGCAAGCTTGAAATCCGTAATGCTGCCCACGAAGA

TGGTGGTATTTATTCCCTAACTGTGGAGAATCCGGCGGGTACAAAGACAGTCTCAGTCAAAGTATTGGTCTTAG ATAAACCTGGGCCACCTAGAGATCT

GGAAGTCAGTGAAATTAGGAAAGATTCTTGTTACCTGACTTGGAAGGAACCACTGGACGACGGTGGTTCTGTTGTAACCAATTATGTGGTTGAGAGGAAA

GATGTTGCCACTGCCCAGTGGTCCCCTCTTTCCACCACGTCAAAGAAGAAGAGCCATATGGCTAAACATCTGACTGAGGGCAATCAGTACCTCTTCCGAG

TAGCTGCTGAGAACCAATACGGACGTGGTCCTTTTGTTGAAACACCTAAGCCCATCAAGGCTCTGGATCCTCTCC ATCCCCCAGGGCCACCCAAGGATC

TGCACCACGTAGATGTCGACAAGACTGAAGTCTCTCTCGTTTGGAATAAGCCAGATCGTGATGGTGGTTCTCCAATCACAGGATACTTAGTGGAATATCA

AGAAGAGGGTGACAAGGACTGGATCAAGTTCAAGACTGTGAAAAATTTAGACTGTGTTGTTACAGGCTTACAACAAGGAAAGACCTATAGATTCCGTGTA

AAAGCTGAAAATATCATAGGTCTTGGTCTTCCTGATACAACTATCCCAATAGAATGTCAAGAGAAACTAG TGCCTCCATCTGTGGAATTAGATGTGAAG

TTAATTGAAGGGCTTGTGGTGAAGGCTGGTACCACAGTTAGATTCCCTGCCATCATAAGAGGTGTACCTGTTCCTACTGCAAAATGGACAACTGATGGGA

CTGAGATTAAAACAGATGACCACTACACAGTTGAGACTGACAGCTTCTCATCCGTGCTGACCATTAAGAATTGTTTAAGGAAGGATACTGGGGAATACCA

ACTCACAGTTTCCAATGCAGCGGGTACCAAAACAGTAGCTGTCCATCTTACTGTTCTTGATGTACCTGGTCCACCAACAGGTCCTATTAATATCCTGGAT

GTCACACCTGAATACATGACTATCTCATGGCAACCGCCTAAGGATGATGGAGGAAGCCCAGTGATAAATTACATTGTTGAGAAACAAGATACAAGGAAAG

GTACATGGGGTGTCGTCTCTGCAGGAAGCAGTAAGCTGAAGCTGAAGGTCCCACATCTCCAAAAAGGCTGTGAATACGTTTTCAGAGTCAAAGCAGAGAA

CAAGATGGGTGTCGGTCCTCCCCTTGACTCCATACCTACTGTTGCTAAGCACAAGTTCAGTCCTCCATCTCCTCCTGGTAAACCAGTGGTAACTGACATT

ACTGAGAATGCTGCAACGGTGTCTTGGACACTGCCAAAATCTGATGGTGGCAGTCCAATAACTGGCTATTATGTAGAGCGCAGAGAAATAACCGGCAAAT

GGGTGAGGGTCAACAAAACGCCTATTGCTGACCTGAAGTTCAGGGTGACTGGACTCTATGAGGGAAATACATACGAGTTTAGAGTTTTTGCTGAAAATCT

TGCAGGTTTAAGCAATCCATCACCCAGTTCTGACCCAATCAAAGCTTGCCGGCCCATCAAACCACCAGGGCCACCTATAAATCCTAAGCTGAAAGACAAG

AGCAAAGAATCTGCTGACTTGGTGTGGACAAAGCCCCTCAGTGATGGTGGCAGCCCCATTTTGGGGTATGTAGTAGAGTATCAGAAACCTGGCACAGCGC

AGTGGGATAGGATTAATAAAGACGAACTCATCAGGCAATGTGCCTTCCGGGTCCCCGGACTGATTGAAGGAAATGAGTACAGATTTCGCATTAGAGCAGC

TAACATTGTGGGTGAGGGAGAGCCAAGGGAGCTTGCAGAATCTGTGATTGCAAAAGACATCCTTCATCCCCCGGAAGTGGAACTTGACGTTACATGCCGT

GATGTCATTACCGTCCGGGTGGGTCAAACTATCCGCATTCTTGCCCGAGTCAAAGGCAGACCTGAGCCAGACATAACTTGGTCCAAGGAAGGAAAAGTAC

TGGTCAAAGACAAGCGGGTTGACCTAATTCATGATCTGCCTCGTGTTGAGCTACAAATTAAAGAAGCTGTCAGAGCTGACCATGGCAAGTATATCATCTC

TGCTAAGAACAGCAGTGGGCATGCCCAAGGGTCAGCCATTGTTAATGTCCTTGACAGACCTGGGCCTTGCCAGAATCTGAAGGTTAGCAACGTAACCAAG

GAAAACTGCACCATTTCTTGGGAAAACCCACTAGATAATGGTGGCTCAGAAATTACAAATTTCATAGTGGAATATCGTAAACCAAATCAGAAAGGCTGGT

CAATCGTTGCCTCAGATGTCACCAAGAGACTGGTCAAGGCCAACCTGTTAGCCAATAATGAATACTATTTCCGTGTTTGTGCAGAGAATAAAGTAGGTGT

TGGGCCAACCATTGAAACAAAGACTCCAATTTTGGCCATCAATCCTATTGACAGGCCAGGGGAGCCTGAAAACCTTCATATTGCAGATAAAGGAAAGACC

TTTGTCTATCTAAAGTGGCGACGGCCTGATTATGATGGTGGTAGCCCGAATCTATCATATCATGTTGAGAGGAGACTGAAGGGCTCTGCAGACTGGGAAA

GAGTGCACAAAGGAAGCATTAAGGAAACCCACTACATGGTTGACAAGTGTGTTGAAAACCAGATTTATGAGTTCAGAGTACAAACTAAGAATGAAGGTGG

AGAAAGTGATTGGGTGAGGACAGAGGAAGTTGTTGTGAAGGAAGATTTACAGAAGCCAGTACTTGATCTAAAATTAAGTGGGGTGCTAACTGTCAAAGCA

GGGGACACCATTAGACTCGAGGCAGGTGTGAGAGGCAAACCATTCCCAGAGGTTGCCTGGACCAAAGACAAAGATGCTACAGATTTAACAAGATCACCAA

GGGTCAAGATTGATACCAGTGCCGAATCATCGAAATTCTCTCTTACCAAAGCCAAGCGAAGCGATGGCGGTAAATACGTAATCACCGCAACTAACCCAGC

TGGCAGTTTTGTGGCCTATGCGACTGTCAATGTTTTAGATAAACCTGGTCCTGTAAGAAACCTGAAAATCACTGATGTGTCCAGTGACAGGTGTACTATC

CGCTGGGATCCACCAGAAGATGATGGCGGCTGTGAAATCCAAAATTATATCCTAGAAAAATGTGAGAGCAAGAGAATGGTATGGTCTACCTATTCTGCTA

ATGTCTTGACACCCAGTGCTACAGTGACTCGTCTCATAGAAGGAAATGAGTATATTTTCAGAGTTCGTGCAGAAAACAAAATAGGCACAGGGCCTCCAAC

AGAAAGTAAACCAGTCATTGCAAAAACCAAGTATGACAGACCTGGCCGCCCTGATCCTCCAGAAGTCACTAAAGTAAGCAAAGAAGAGATGACCGTGGTT

TGGAACGCCCCTGAATATGATGGTGGGAAGTCTATCACAGGATACTATTTAGAGAAAAAAGAAAAGCATGCAGTCCGCTGGGTCCCTGTTAACAAGAGTG

CCATCCCTGAGCGACGCTTGAAAGTACAGAATCTCCTCCCAGGGCACGAGTACCAGTTCCGTGTCAAAGCAGAAAATGAAGTTGGCATTGGAGAACCAAG

CTTACCATCAAGACCAGTGGTGGCAAAAGATCCCATAG AACCACCTGGGCCACCAACCAATTTCAAAGTGGTTGATACAACCAAAAGTTCCATAACTCT

CGCATGGGGAAAACCAGTCTATGATGGTGGTGCACCGATAATTGGATATGTCGTAGAGATGAGACCCAAAATAGCAGACGCATCACCTGACGAAGGCTGG

AAAAGGTGCAACGCTGCAGCTCAACTTATTCGCATGGAATTCACAGTCACCAGCTTGGATGAGAACCAGGAGTACGAGTTCAGGGTGTGTGCCCAGAATC

AAGTTGGCATTGGGCGCCCTGCAGAGCTAAAGGAAGCCATCAAACCTAAAGAAATCCTAG AGCCTCCAGAGATTGACTTGGATGCCAGCATGAGAAAAC

TGGTCGTAGTGAGAGCTGGCTGCCCTATTCGACTATTCGCAATAGTGAGAGGACGACCTGCCCCCAAAGTCACATGGCGCAAAGTGGGCATTGATAATGT

GGTCAGAAAAGGACAAGTCGATCTAGTTGACACTATGGCCTTCCTTGTCATCCCCAACTCTACCCGTGATGACTCTGGAAAATACTCCCTGACCCTTGTG

AACCCAGCAGGAGAAAAGGCTGTTTTTGTGAATGTCAAAGTACTAG ATACTCCTGGACCTGTGGCTGATTTAAAAGTTTCAGATGTCACTAAAACATCA

TGTCACGTGTCCTGGGCACCTCCTGAAAATGATGGTGGAAGCCAAGTGACACATTATATTGTGGAGAAACGTGAGGCAGAAAGAAAAACATGGTCAACAG

TTACCCCTGAAGTGAAGAAAACAAGCTTCAATGTAACCAACCTTGTCCCTGGGAACGAGTATTTCTTCCGAGTAACTGCTGTCAATGAATATGGCCCTGG

TGTCCCGACAGACATCCCCAAACCTGTGCTTGCATCAGATCCTCTCA GTGAGCCAGATCCTCCAAGAAAACTGGAGGTGACCGAAATGACAAAGAACAG

TGCTACACTGGCCTGGTTACCTCCGTTGCGTGATGGAGGCGCTAAAATCGATGGCTATATCATTAGTTACAGAGAAGAAGACCAACCTGCAGATCGCTGG

ACAGAGTACTCAGTGGTCAAAGACCTCAGCCTTATTGTTACTGGCCTAAAGGAAGGAAAGAAATATAAATTTAGAGTTGCAGCTAGAAATGCTGTTGGAG

TCAGCATGCCAAGAGAGGCCGAAGGCGTCTACGAAGCAAAAGAACAGCTAT TGCCACCAAAGATCCTCATGCCTGAGCAAATCACTATCAAAGCCGGGA

AGAAACTTCGAGTTGAGGCGCATGTGTATGGAAAGCCTAACCCCATCTGCAAATGGAAGAAAGGAGACGACGAAGTTGTTACATCCAGCCACCTGGCCAT

CCACAAGGCAGACGGCTCCTCAGTTCTGATCATAAAAGACGTTACTAGAAAAGACAGTGGTTACTATAGCCTCACGGCAGAGAATAGCTCCGGGTCAGAC

ACTCAGAAAATCAAAGTTACAGTCATGG ATGCTCCTGGGCCCCCTCAGCCTCCATTTGACATTTCTGAAATAGATGCTGATGCTTGCTCCCTGTCTTGG

CACATCCCTCTGGAGGATGGAGGCAGCAACATTACCAATTACATAGTAGAGAAATGTGATGTAAGCCGTGGCGATTGGGTCACAGCTCTAGCATCAGTCA

CCAAGACTTCCTGCAGGGTTGGAAAGCTGATCCCAGGCCAGGAGTATATCTTCCGGGTCCGAGCTGAAAACAGATTTGGCATTTCAGAGCCTCTCACATC

TCCAAAGATGCTTGCTAAGTTCCCATTTG ATGTTCCTAGTGAGCCAAAGAATGCACGTGTCACTAAAGTCAACAAAGACTGCATATTTGTCGCGTGGGA

CAGACCAGACAGTGATGGAGGAAGCCCCATCACTGGTTACCTGATTGAACGCAAAGAAAGAAACAGTTTGCTCTGGGTGAAAGCTAATGACACTATTGTC

CGGTCAACTGAGTATCCTTGTGCTGGCCTCGTAGAAGGTCTAGAATATTCATTCAGAATCTATGCTCTAAACAAAGCTGGGTCCAGCCCACCTAGCAAAC

CAACTGAGTATGTGACTGCAAGGATGCCGGTTG ATCCACCAGGGAAACCTGAAGTTGTTGACGTCACCAAGAACAGCGCATCGCTTATCTGGGCCCGGC

CAAAGCATGATGGAGGCAGCAGAATTATCGGCTATTTTGTAGAGGCTTGCAAACTTCCTGGTGATAAATGGGTTCGGTGCAATACCACACCTCACCAGAT

TCCCCAGGAAGAGTACACAGCTACTGGGTTAGAAGAGAATGCTCAGTATCAGTTCAGAGCGATTGCCAAGACTGCTGTGAACATCAGCCAGCCTTCCGAG

CCTTCTGATCCAGTGACCATTCTTGCAGAAAATG TTCCTCCACGGATAGAACTCAGTGTTGAGATGAAGTCTTTGCTTACCGTGAAGGCTGGGACTAAT

GTCTGCTTGGATGCTACTGTCTTCGGGAAACCGATGCCAACGGTTTCTTGGAAGAAAGACACCACACCAATAAAACAAGCCGAAGGCATAAAGATGGCAA

TGAAGCGGAACTTGTGTACCTTGGAGCTGTTCAGTGTGAACCGGAAAGACTCAGGAGACTATACCATTACTGCCGAAAATTCCAGTGGTTCCAAATCAGC

CACCATTAAGCTGAAAGTACTAG ATAAGCCAGGTCCTCCAGCATCTGTGAAAATCAACAAGATGTATGCAGACCGTGCAATGCTGTCCTGGGAACCTCC

TCTCGAGGATGGAGGCTCAGAAATCACCAACTACATCATTGACAAGCGTGAAACAAGCAGGCCCAACTGGGCCCAGGTCTCTGCTACTGTGCCCATCACC

AGCTGCACTGTGGAGAAACTTATAGAGGGCCATGAATACCAGTTCCGTATCTGTGCCGAAAACAAATACGGAGTCGGCGATCCCATCCTCACTGAGCCAG

CGATTGCCAAAAACCCATATG ACCCGCCTGGACGCTGTGACCCTCCTGTCATTAGCAACATCACTAAAGATCACATGACCGTCAGCTGGAAAGCCCCAG

CGGATGATGGTGGCTCACCTATCACCGGATACTTGGTTGAAAAGCGGGAAACTCAGGCAGTCAACTGGACTAAAGTCAACAGAAAACCTGTTATAGAAAG

GACATTAAAAGCAACGGGTCTCCAGGAAGGCACGGAGTATGAATTCCGAGTTACGGCTATCAATAAAGCTGGACCCGGCAAACCCAGTGATGCATCCAAA

GCCGTGTATGCTCAAGACCCACTGT ATCCTCCTGGCCCGCCAGCTTTCCCTAAAGTCTATGATACCACCCGTAGTTCTGTGAGTCTATCATGGGGCAAG

CCGGCCTATGATGGCGGCAGCCCTATCATTGGTTATCTTGTGGAAGTAAAGCGAGCTGATTCTGATCACTGGGTGAGGTGCAATTTGCCAGAGAAGCTCC

AGAAGACCCGCTTCGAGGTGACTGGCCTGATGGAAAACACCGAGTATCAGTTCCGAGTGTATGCCGTTAACAAGATTGGGTACAGCGACCCCAGCGATGT

GCCAGATAAACACTGCCCCAAGGACATCCTAA TTCCACCTGAGGGAGAACTTGATGCTGAACTAAGGAAAACACTTATCTTACGTGCTGGAGTTACAAT

GAGACTCTACGTGCCAGTAAAAGGACGGCCACCTCCAAAGATTACTTGGTCTAAACCGAACGTCAATCTAAGAGAAAGGATTGGCCTGGATATAAAGTCG

ACAGACTTTGACACCTTCTTGCGCTGCGAAAATGTGAACAAATATGATGCAGGAAAATATATCTTAACCTTGGAGAACAGCTGCGGCAAGAAGGAGTACA

CTATTGTGGTGAAAGTGCTGG ACACTCCTGGTCCACCTGTCAATGTGACTGTTAAGGAGGTATCCAAGGACTCTGCATATGTTACCTGGGATCCTCCCA

TTATTGATGGTGGGAGCCCCATCATAAACTATGTGGTTGAGAAACGGGATGCAGAGAGGAAGTCCTGGTCGACAGTGACAACCGAGTGCTCGAAGACAAG

CTTCAGAGTCTCTAACTTGGAGGAGGGGAAATCCTACTTCTTCAGAGTGTTTGCCGAAAATGAATACGGCATCGGGGATCCGGGGGAGACACGTGATGCT

GTCAAAGCTTCTG AAACCCCGGGACCTGTGGTCGACCTGAAAGCACTGGCTATAACTAAGTCATCTTGTACCATCGGCTGGAAGAAGCCTCGAAGTGAT

GGCGGAAGCAGAATTACTGGCTATGTGGTGGATTTCCTGACAGAAGAAAATAAGTGGCAACGGGTCATGAAATCACTGAGCCTTCAGTACTCCACAAAGG

ATCTGAAGGAGGGGAAGGAGTACACCTTCAGAGTGAGTGCAGAGAATGAAAACGGAGAAGGAACCCCAAGTGAAATTGTGGTTGTGGCCAAGGACGATGT

TG TGGCTCCCGATCTTGACTTGAAGGATCTACCTGATCTGTGCTACTTGGCTAAAGAAAACAGCAACTTCCGTCTCAAGATCCCCATAAAAGGCAAACC

AGCACCATCGGTGTCTTGGAAGAAGGGGGAAGATCCCCTAGCAACAGACACAAGAGTCAGTGTCGAATCAACTGCAGTTAACACAACCCTTGTAGTATAT

GACTGCCAAAAATCCGATGCTGGAAAATACACAATCACACTCAAGAATGTTGCTGGCACCAAGGAAGGAACTCTTTCTATAAAGGTTGTTGGCAAGCCTG

GCATCCCCACCGGACCAATCAAATTTGATGAAGTCACAGCAGAAGCCATGACCTTGAAGTGGGGTCCTCCAAAGGATGATGGAGGTTCTGAAATCACCAA

CTATGTACTAGAGAAGAGAGACTCTGTGAATAACAAGTGGGTGACATGTGCTTCCGCTGTCCAGAAAACCACCTTTAGAGTAACCAGACTTCACGAGGGC

ATAGAATACACCTTCAGGGTCAGTGCTGAAAATAAATATGGTGTAGGAGAAGGCCTAAAGTCAGAGCCAATTGTTGCCAAACATCCATTTG ATGTGCCT

GATGCTCCCCCACCTCCCAATATTGTGGATGTCAGACATGATTCAGTATCTCTAACATGGACTGATCCCAAAAAGACTGGTGGCTCACCAATTACAG GG

TATCATATTGAATTCAAGGAAAGAAACAGCCTTCTGTGGAAGAGAGCTAACAAGACTCCTATAAGGATGAAAGATTTTAAAGTGACAGGATTAACTGAAG

GTCTTGAATATGAATTCAGAGTTATGGCTATCAATCTAGCTGGAGTGGGCAAGCCAAGCCTGCCATCAGAGCCAGTTGTGGCACTTGATCCAATTG ATC

CTCCTGGAAAACCTGAGGTTATCAGCGTAACAAGGAATTCAGTGACTCTCATCTGGACAGAACCTAAATACGATGGTGGCCATAAATTAACAGGATATAT

CGTGGAGAAGCGGGATCTACCCTCTAAGTCTTGGATGAAAGCCAACCATGTTAATGTCCCAGACTGTGCCTTTACTGTAACTGATCTTGTTGAAGGTGGA

AAATATGAATTCCGAATCAGAGCAAAGAATACAGCGGGTGCTATTAGTGCTCCATCAGAGAGCACAGGAACCATTATTTGCAAGGATGAATACG AGGCA

CCAACCATTGTCCTTGATCCAACAATTAAAGATGGGCTAACAGTCAAGGCAGGGGATAGCATTGTTTTAAGTGCCATTAGCATTCTCGGCAAACCCCTTC

CAAAGTCAAGCTGGTCCAGGGCAGGAAAAGATATCAGACCATCAGACATAGCTCAAATAACTTCAACCCCAACATCTTCTATGCTGACAGTTAAGTATGC

CACAAGAAAGGATGCTGGCGAGTATACCATCACCGCTACCAATCCTTTTGGCACAAAGGAGGAACATGTGAAGGTATCAGTCCTTGATGTACCTGGTCCC

CCAGGTCCCATTGAAATCAGTAATGTTTCAGCTGAAAAAGCAACACTTACTTGGACACCTCCCTTAGAAGATGGGGGCTCACCGATTAAAGCTTATGTTC

TTGAGAAGAGAGAAACCAGCCGGCTTTTGTGGACAGTGGTTTCTGAAGATATTCAGGCATGCAGACATGTGGTAACCAAACTCATCCAAGGAAATGAATA

CCTCTTCCGTGTGTCAGCAGTAAACCATTACGGCAAAGGAGAACCCGTTCAGTCTGAGCCTGTCAAAATGGTGGACAGATTTG GTCCTCCTGGCCCTCC

TGGAAAACCCGAGATCTCAAATGTCACCAAGAACACTGCCACTGTCAGCTGGAAGAGGCCAACTGATGATGGTGGCAGCGAGATCACAGGATATCATGTA

GAAAGGAGAGAAAAGAAAGGCCTGCGGTGGGTGAGAGCAACCAAAACACCAGTTTCCGATCTCAGGTGCAAAGTAACTGGACTGCAAGAAGGAAATACCT

ATGAGTTCCGTGTCAGTGCAGAAAACAGAGCCGGGATTGGTCCTCCCAGTGACGCCTCGAATCCTGTTCTGATGAAAGATGTTGCAT ATCCCCCAGGAC

CACCTTCAAATGCACATGTCACTGATACCACCAAGAAATCGGCTTCTTTAGCATGGGGCAAGCCTCATTATGATGGTGGGCTTGAAATCACTGGCTATGT

GGTAGAGCATCAAAAAGTAGGAGATGATGCCTGGATCAAAGACACAACAGGAACAGCCCTCAGAATCACTCAGTTTGTGGTTCCTGATCTTCAGACTAAG

GAAAAATACAATTTTAGAATTAGTGCCATCAACGATGCAGGTGTGGGGGAACCAGCTGTGATTCCAAATGTTGAAATTGTAGAGAAGGAAGTGGCTCCTG

ATTTTGAGCTAGATGCTGAGCTGCGAAGAACACTTGTGGTTAGGGCAGGGCTCAGTATTAGGATTTTTGTGCCAATTAAAGGTCGTCCTGCACCTGAAGT

GACATGGACCAAAGATAATATCAACCTGAAGCACCGAGCCAACATCGAAAACACAGAGTCATTTACTCTTCTCATTATTCCAGAATGTAACAGATATGAC

ACTGGTAAATTTGTGATGACCATCGAAAACCCAGCTGGGAAGAAAAGCGGCTTCGTTAACGTCAGAGTCCTAGACACACCAGGCCCTGTCCTTAACCTAA

GGCCTACAGACATCACAAAGGACAGTGTCACCCTACACTGGGACCTACCTCTGATAGATGGGGGCTCACGTATAACAAATTATATTGTGGAGAAACGTGA

AGCAACCAGGAAATCCTACTCCACAGTCACTACTAAGTGCCATAAATGTACATATAAAGTGACTGGCTTGACAGAAGGCTGTGAATATTTCTTCAGAGTG

ATGGCAGAAAATGAATATGGGGTTGGTGAGCCAACGGAAACCACAGAACCTGTGAGAGCCTCTGAGGCACCGTTACCCCCAGATAGCCTTAACATTATGG

ACATTACCAAGAACACAGTCAGCCTGGCGTGGCCTAAGCCAAGGCATGATGGTGGGAGCAAGATCACTGGCTATGTGATTGAAGCCCAGAGAAAAGGGTC

TGACCAGTGGACCCACATCTCAACAGTGAAAGGGTTAGAATGTGTGGTGAGGAACCTAACCGAAGGAGAGGAATATACCTTCCAAGTGATGGCGGTAAAC

AGTGCAGGCAGGAGTGCCCCTAGAGAGAGCAGACCTGTCATTGTCAAAGAGCAGACGATGCTCCCAGAGCTGGATCTCCGTGGCATCTATCAGAAGCTAG

TCATTGCCAGAGCTGGTGACAACATCAAAGTTGAAATCCCAGTACTTGGTCGACCCAAGCCCACAGTCACATGGAAAAAGGGAGACCAAATCCTTAAACA

GACACAGAGAGTTAATGTTGAAAACACAGCAACGTCAACCATCTTAAATATCAATGAGTGTGTCAGAAGTGACAGTGGACCCTATCCATTAACAGCAAAG

AACACTGTAGGAGAGGTTGGTGACGTTATAACCATTCAAGTCCATGATATTCCAGGACCACCTACTGGACCCATTAAATTTGATGAAGTTTCATCTGACT

TTGTAACCTTCTCTTGGGAGCCACCAGAGAATGATGGAGGTGTACCAATAAGCAACTATGTAGTAGAGATGAGACAGACAGACAGTACTACATGGGTGGA

GTTAGCAACAACTGTTATACGTACTACCTATAAAGCAACTCGTCTGACCACAGGAGTGGAGTATCAATTCCGTGTAAGGGCTCAAAACAGATATGGAGTT

GGACCGGGCATCACATCTGCATCTGTAGTTGCAAACTATCCATTCAAGGTGCCCGGGCCTCCCGGTACCCCTCAGGTTACTGCAGTCACCAAAGACTCCA

TGACAATCAGCTGGCATGAACCACTTTCTGATGGTGGAAGCCCCATTTTAGGATATCACATTGAAAGGAAAGAACGGAATGGCATCCTCTGGCAGACTGT

GAGCAAAGCATTAGTACCAGGCAACATTTTCAAATCAACTGGACTTACCGATGGCATTGCTTATGAATTCCGAGTAATTGCAGAAAACATGGCAGGCAAG

AGCAAGCCAAGCAAGCCATCTGAACCAATGTTTGCTTTGGATCCCATTGACCCACCCGGGAAACCAGTTCCTCTAAACATTACAAGACACACAGTGGCAC

TGAAGTGGGCTAAGCCTGAATATACCGGAGGCTTTAAAATTACTAGCTATGTGGTTGAAAAGAGGGACCTTCCTAATGGACGATGGCTGAAGGCCAACTT

CAGCAACATTTTAGAGAATGAATTTACGGTCAGCGGCCTAACTGAAGATGCTGCATACGAGTTCCGTGTGATTGCCAAAAATGCTGCCGGTGCCATCAGT

CCACCGTCTGAGCCATCAGATGCCATCACATGCAGGGACGACCTGGAGGCACCAAGAATAATGGTGGATGTTAGATTTAAGGATACCATCACATTAAAAG

CTGGCGAAGCATTCAAGTTGGAAGCTGATGTTTCAGGTCGCCCACCTCCAACAATGGAATGGACTAAAGATGGAAAGGAGCTTGAAGGCACAGGGAAATT

AGAAATAAAAATTGCAGACTTCTCCACTCATCTGATAAACAAGGATTCCTCAAGAACGGATAGTGGGGCTTACATCCTGACAGCAACCAATCCTGGTGGC

TTTGCCAAACACATTTTCAATGTCAAAGTTCTTGATAGACCGGGACCACCTGAGGGACCTTTGGCTGTGTCTGATGTGACATCAGAGAAGTGTGTGTTGT

CATGGTTGCCTCCACTGGACGATGGAGGTGCCAAAATTGATCATTACATCGTACAGAAACGTGAAACCAGCAGGTTGGCATGGACAAATGTTGCCACAGA

AGTCCAAGTAACAAAGCTGAAGGTTACTAAGCTCCTGAAAGGGAATGAATACATATTCCGTGTCATGGCAGTAAATAAATACGGGGTTGGAGAGCCACTT

GAATCAGAACCTGTGCTTGCAGTGGATCCATATGGACCACCTGACCCACCCAAGAACCCGGAAGTTACAACTATCACCAAGGACTCCATGGTCGTCTGCT

GGGGGCATCCTGACTCTGATGGTGGAAGTGAAATTATCAACTACATTGTGGAGCGGCGTGATAAAGCTGGCCAGCGCTGGGTAAAATGCAACAAAAAAGC

TCTGACTGACTTAAGATTTAAAGTATCTGGGCTGACAGAAGGACATGAATACGAGTTCAGAATTATGGCAGAAAACGCAGCTGGAATCAGTGCTCCGAGT

GCTACCAGCCCGTTTTATAAAGCTTGCGACACTGTGTTTAAACCTGGCCCACCGGGTAACCCACGTGTCCTTGATACAAGCAGGTCGTCCATTTCAATTG

CGTGGAATAAACCCATTTATGATGGAGGTTCAGAAATCACTGGGTATATGGTTGAGATTGCCCTGCCTGAAGAAGATGAATGGCAGGTTGTCACTCCACC

AGCTGGGCTCAAGGCAACTTCCTATACCATCACCAGCCTCATAGAGAATCAGGAATATAAAATCCGCATTTATGCCATGAATTCTGAGGGACTTGGGGAA

CCTGCCCTTGTTCCCGGAACTCCAAAGGCAGAAGAAAGAATGTTGCCTCCAGAGATAGAACTGGATGCTGACTTACGCAAAGTTGTCACTATACGAGCCT

GCTGCACCTTGAGGCTCTTTGTTCCCATCAAAGGGAGACCAGCACCTGAGGTCAAGTGGGCCCGAGAGCATGGAGAATCTCTGGACAAGGCTAGCATTGA

ATCCACAAGCTCTTACACCCTGCTTGTTGTTGGAAATGTTAACAGATTCGACAGTGGCAAGTACATACTAACGGTAGAAAACAGCTCTGGCAGCAAGTCG

GCGTTTGTCAATGTTAGAGTGCTAGATACGCCAGGCCCTCCACAGAATCTAAAGATAAAGGAGGTCACAAAGACATCTGTCACATTGACGTGGGAGCCTC

CTCTCCTGGATGGAGGCTCAAAAATAAAGAACTATATTGTTGAGAAGCGAGAGTCCACAAGAAAGGCATATTCAACCGTGGCAACGAATTGCCATAAGAC

GTCCTGGAAGGTAGACCAGCTGCAAGAAGGCTGCAGTTACTATTTCCGTGTCCTCGCTGAAAACGAATATGGCATTGGACTGCCCGCCGAAACAGCTGAG

TCTGTGAAGGCATCGGAGCGACCTCTTCCTCCAGGGAAGATAACTTTGACGGATGTCACACGAAACAGTGTGTCTCTCTCTTGGGAGAAGCCAGAACATG

ACGGGGGCAGCCGAATTCTAGGCTACATTGTAGAGATGCAGAGCAAAGGCAGTGACAGATGGGCCACGTGTGCCACAGTGAAAGTCACAGAAGCCACCAT

CACCGGCCTGATCCAGGGTGAGGAATACTCTTTCCGTGTTTCAGCGCAGAATGAAAAGGGCATCAGTGACCCCAGACAACTGAGTGTGCCAGTAATTGCT

AAAGACCTTGTTATCCCACCAGCCTTCAAACTCCTCTTCAATACATTCACGGTACTGGCAGGTGAAGACCTGAAAATTGATGTACCATTCATTGGACGCC

CTCCACCAGCTGTCACCTGGCATAAAGATGACATACCTCTGAAGCAAACAACTAGAGTGAATGCAGAGAGCACGGAAAACAATTCTCTACTGACAATAAA

GGAAGCCTGCCGAGAAGATGTTGGACATTACACGGTTAAACTGACTAACTCGGCAGGTGAAGCCACTGAAACCCTTAATGTTATCGTTCTTGACAAGCCA

GGGCCCCCAACAGGACCAGTGAAGATGGATGAAGTGACAGCAGACAGTGTCACTCTTTCCTGGGAACCACCAAAGTATGATGGCGGAAGCTCTATCAATA

ATTACATTGTAGAGAAACGAGACACATCCACAACCGCCTGGCAAATCGTGTCAGCTACGGTTGCAAGAACAACCATAAAGGCCTGCAGACTAAAGACTGG

CTGTGAGTATCAGTTCAGAATTGCAGCAGAAAACAGATATGGGAAGAGTACCTACCTCAACTCAGAGCCTGTTGTTGCCCAGTACCCATTCAAAGTGCCA

GGGCCACCGGGCACACCATTCGTCACGCTTGCCTCCAAAGACAGCATGGAGGTACAATGGCATGAGCCAGTCAGTGATGGTGGGAGCAAAGTCATTGGCT

ACCATCTAGAGCGCAAGGAAAGAAATAGCATCCTCTGGGTCAAGCTGAATAAGACACCTATTCCTCAAACCAAGTTCAAGACAACTGGCCTTGAAGAAGG

CATTGAATATGAATTTAGAGTGTCTGCAGAGAACATCGTAGGCATCGGCAAGCCAAGTAAGCCATCAGAATGTTATGCTGCTCATGACCCATGCGATCCA

CCAGGTCGGCCAGAGGCAATCATTGTCACAAGGAACTCTGTGACTCTTCAGTGGAAGAAACCCACCTACGATGGTGGAAGCAAGATCACTGGTTACATTG

TTGAGAAGAAAGAATTGCCTGATGGCCGCTGGATGAAAGCCAGTTTTACAAATATCATTGACACCCAGTTTGAGGTAACTGGCCTACTGGAAGATCATAG

ATATGAGTTTCGAGTTATAGCTCGAAATGCTGCAGGAGTTTTCAGTGAGCCCTCAGAAAGTACAGGGGCAATCACAGCAAGAGATGAGGTTGAGCCACCC

AGAATAAGCATGGACCCCAAATACAGGGACACGGTTGTGGTTCAAGCTGGTGAGTCATTCAAGATCGATGCAGATATATATGGCAAACCAATACCGACCA

CTCAGTGGGTAAAGGGTGACCAGGAGCTTTCAAGCACAGCTCGGTTAGAAATTAAGAGCACCGACTTTGCCACCAGTCTCAGTGTCAAAGATGCGGTACG

TGTGGATAGTGGCAATTATATCCTAAAGGCCAAAAACGTTGCAGGGGAGAAATCAGTTACTATCAATGTCAAAGTTCTCGATAGACCAGGGCCACCTGAG

GGACCTGTTGCTATATCAGGGGTTACAGCAGAAAAATGTACTCTAGCTTGGAAACCCCCACTTCAGGATGGTGGGAGTGACATCACAAATTACATTGTGG

AAAGGCGAGAAACCAGCCGCCTCGTCTGGACTCTGGTTGATGCCAATGTGCAAACGCTCAGCTGTAAAGTCCTGAAGCTTCTTGAGGGCAATGAATATAT

TTTCCGTATAATGGCTGTGAACAAATACGGTGTTGGTGAACCTCTTGAATCTGAGTCATTGATTGCCAAGAATCCATTTGTAGTCCCAGATGCACCCAAA

GCTCCAGAAGTTACAGCTGTGACCAAAGACTCAATGATTGTTGTATGGGAAAGGCCAGCGTCTGATGGTGGCAGTGAGATTCTAGGATATGTTCTAGAAA

AACGGGACAAAGAAGGCATAAGATGGACAAGATGCCACAAGCGTCTAATTGGAGAGCTGCGCCTGAGAGTGACTGGACTGTTAGAAAATCACAATTATGA

ATTCAGAGTCTCCGCTGAAAATGCTGCTGGACTTAGTGAACCAAGCCCCCCTTCTGCTTACCAGAAGGCATGTGACCCCATTTATAAGCCAGGCCCTCCA

AACAACCCCAAAGTCATGGATGTTACCAGATCTTCGGTTTTCCTTTCTTGGACCAAACCTATCTATGATGGTGGCTGTGAAATCCAAGGATACATCGTAG

AAAAATGTGATGTGAGTGTTGGTGAATGGACAATGTGTACGCCACCAACTGGAATCAATAAGACAAATCTAGAAGTCGAGAAGTTGTTGGAAAAGCATGA

ATACAACTTCCGGATCTGTGCCATTAATAAGGCCGGAGTAGGGGAGCATGCTGATGTCCCTGGGCCTGTAATGGTTGAAGAAAAACTTGAAGCACCTGAT

ATAGACCTTGACCTTGAACTAAGGAAAGTGATTAATATAAGGGCAGGTGGTTCCTTAAGGCTGTTTGTTCCTATAAAAGGCCGTCCTACACCAGAAGTCA

AGTGGGGGAAGGTTGATGGTGATATCCGGGACGCAGCTATAATTGATGTCACTAGCAGCTTCACCTCTCTTGTTCTTGACAATGTCAATCGATATGATAG

TGGAAAATACACTCTCACACTAGAAAACAGCAGTGGAACAAAATCTGCCTTTGTGACGGTAAGGGTCCTGGACACACCAAGCCCACCTGTCAACTTAAAA

GTCACAGAAATCACCAAGGACTCGGTATCAATTACATGGGAACCTCCTTTGTTGGACGGAGGATCAAAAATTAAAAATTACATTGTTGAGAAACGAGAAG

CCACAAGAAAATCCTATGCTGCAGTTGTAACAAACTGCCATAAGAATTCGTGGAAAATCGATCAGCTCCAAGAAGGTTGCAGTTACTACTTCAGGGTTAC

CGCTGAGAACGAATACGGTATTGGCTTGCCTGCCCGCACTGCAGATCCAATCAAGGTTGCAGAAGTCCCACAACCTCCAGGGAAAATAACTGTGGATGAT

GTCACCAGAAACAGTGTCTCTCTCAGTTGGACAAAGCCCGAACATGACGGTGGCAGTAAAATCATCCAGTATATCGTAGAAATGCAAGCTAAAAACACTG

ATAAGTGGTCAGAGTGTGCTAGGGTGAAGTCCCTTGACGCAGTTATTACCAACCTAACTCAGGGAGAAGAATACCTTTTCAGAGTCATTGCTGTAAATGA

AAAAGGAAGAAGCGACCCCAGGTCCCTTGCGGTTCCAATCATCGCCAAAGATCTGGTCATCGAGCCAGACGTGAGACCAGCATTCAGCAGTTACAGTGTA

CAGGTTGGCCAAGACTTGAAAATAGAAGTGCCAATTTCTGGACGTCCTAAACCAAGCATTTCCTGGACTAAGGATGGGATGCCATTGAAGCAGACCACAA

GAATCAATGTTACCGACTCCCTGGACCTCACCACACTCAGCATTAAAGAAACTCATAAGGATGATGGTGGACAGTATGGAATCACAGTTTCCAATGTGGT

GGGTCAGAAAACAGCAGCTATTGAAATCATAACTCTAGATAAACCTGATCCTCCAAAAGGGCCTGTTAAATTTGATGAGATCAGTGCTGAGAGCATCACA

TTATCCTGGAACCCTCCCTTATATACAGGGGGCTGTCAAATTACCAACTACATTGTTCAGAAAAGAGACACAACCACCACAGTATGGGATGTCGTCTCTG

CTACTGTTGCCAGAACGACCCTCAAAGTAACCAAGCTGAAAACGGGTACAGAATACCAATTCAGAATATTTGCTGAAAACCGATACGGACAAAGCTTTGC

TCTGGAGTCTGAGCCAGTTGTAGCTCAATATCCCTACAAAGAACCAGGCCCTCCAGGAACGCCATTTGTCACAGCCATCTCCAAAGAGTCTATGGTGGTA

CAGTGGCATGAACCGATCAATAATGGTGGAAGCCCAGTCATAGGTTACCACCTTGAGAGAAAGGAAAGGAATAGTATTTTGTGGACAAAAGTCAACAAAA

CCATTATTCATGACACCCAGTTTAAAGCACTGAACCTTGAAGAAGGCATTGAGTATGAATTTAGAGTTTATGCTGAAAATATTGTTGGGGTAGGCAAGGC

AAGCAAGAATTCTGAATGCTATGTAGCCAGAGACCCCTGTGACCCACCAGGTACCCCAGAAGCAATAATAGTTAAGAGAAATGAAATCACTTTACAGTGG

ACCAAGCCTGTGTACGATGGTGGCAGTATGATCACAGGTTACATCGTAGAGAAACGTGATTTACCCGAGGGTCGCTGGATGAAAGCCAGTTTCACAAATG

TCATTGAAACTCAATTCACCGTGTCAGGTCTTACTGAAGATCAAAGATATGAATTCAGAGTCATTGCAAAGAATGCAGCTGGGGCAATAAGTAAACCCTC

TGACAGTACTGGACCAATAACTGCCAAGGATGAGGTTGAACTCCCACGAATTTCAATGGATCCAAAATTCAGAGACACAATAGTGGTAAATGCTGGAGAA

ACATTCAGGCTTGAGGCCGATGTCCATGGAAAACCCCTACCCACCATTGAGTGGTTAAGAGGAGACAAGGAAATTGAAGAATCTGCCAGGTGTGAAATAA

AGAACACAGATTTCAAAGCTTTACTTATTGTAAAAGATGCCATTCGAATTGATGGTGGACAGTATATTTTAAGAGCCTCGAATGTTGCCGGGTCTAAGTC

ATTTCCAGTAAATGTGAAAGTGCTAGACAGACCAGGACCACCAGAAGGGCCAGTTCAGGTTACTGGAGTCACAGCTGAAAAGTGCACTTTGGCATGGTCT

CCACCACTTCAAGATGGTGGCAGTGACATTTCTCACTACGTGGTAGAAAAGCGAGAAACCAGTCGACTTGCATGGACTGTGGTTGCTTCAGAAGTTGTGA

CTAATTCTCTGAAAGTTACCAAGCTCTTAGAAGGGAATAAATATATTTTCCGAATAATGGCTGTCAACAAGTACGGTGTCGGGGAACCTTTGGAATCTGC

TCCAGTACTCATGAAAAATCCATTTGTGCTTCCTGGACCACCAAAGAGCTTAGAAGTCACAAACATTGCCAAAGACTCCATGACAGTCTGCTGGAATCGG

CCAGACAGTGATGGTGGCAGTGAGATCATTGGTTACATTGTGGAGAAGAGAGACAGAAGTGGCATTCGGTGGATCAAGTGTAACAAACGCCGCATTACAG

ATTTGCGACTCAGGGTGACAGGATTAACAGAAGACCATGAGTATGAATTCAGAGTCTCTGCAGAAAATGCTGCTGGAGTTGGAGAACCAAGTCCTGCTAC

CGTTTACTATAAGGCATGTGATCCTGTGTTCAAACCTGGCCCACCCACCAATGCACACGTTGTAGACACCACTAAAAATTCAATTACACTTGCCTGGAGC

AAACCTATCTATGATGGCGGCAGTGAGATCCTGGGCTACGTTGTAGAAATCTGTAAAGCTGATGAAGAAGAATGGCAAATAGTTACTCCACAGACTGGCC

TGAGAGTCACTCGATTTGAAATTGCCAAACTAATCGAACACCAAGAATATAAAATACGAGTTTGCGCCCTCAACAAAGTTGGTTTAGGTGAGGCTGCCTC

AGTTCCTGGTACGGTGAAACCGGAAGATAAACTCGAGGCACCTGAACTTGACCTTGACTCTGAGTTAAGGAAAGGGATCGTTGTCAGAGCTGGTGGATCT

GCCAGAATCCATATTCCATTCAAGGGTCGTCCAACGCCTGAGATCACTTGGTCAAAAGAGGAAGGTGAATTCACAGATAAGGTCCAAATTGAGAAGGGAA

TTAACTTCACCCAACTCTCAATAGATAACTGTGACAGAAACGACGCCGGGAAATACATCCTCAAGTTGGAGAACAGCAGCGGATCAAAGTCGGCTTTCGT

AACCGTGAAAGTACTTGACACACCAGGACCGCCACAGAATCTGGCTGTCAAGGAAGTGAGAAAAGACTCTGTCCTTCTGGTATGGGAGCCACCTATCATT

GACGGTGGGGCAAAGGTCAAGAACTATGTCATCGACAAGCGCGAGTCCACTCGAAAAGCATATGCTAACGTGAGTAGTAAATGCAATAAAACGAGCTTCA

GAGTCGAGAACCTGACCGAAGGAGCCATCTACTACTTTAGAGTCATGGCAGAGAATGAATTTGGGGTTGGTGTTCCCACGGAGACATCTGATGCTGTGAA

AGCTTCTGAGCCTCCTTCCCCACCAGGAAAGGTCACACTCACTGACGTGTCCCAGACCAGTGCATCCCTTATGTGGGAGAAACCCGAGCATGATGGAGGG

AGCAGAATTCTGGGCTATGTTGTTGAAATGCAGCCCAAAGGAACAGAAAAGTGGAGCGTTGTGGCTGAATCCAAAGTCTGTAATGCAGTGGTTAGTGGCC

TGAGCTCCGGGCAAGAATATCAGTTCCGTGTCAAAGCTTACAATGAGAAAGGAAAAAGTGACCCGAGAGTGCTTGGCATTCCTGTCATAGCCAAGGACTT

GACCATCCAGCCTAGTTTTAAGCTGCCATTTAATACATATAGTGTCCAAGCGGGAGAGGATCTGAAAATAGAAATTCCAGTCATAGGCAGACCAAGACCT

AAAATTTCTTGGGTCAAAGATGGTGAGCCTCTTAAACAGACCACCAGAGTAAATGTTGAAGAAACGGCTACTTCGACTATTTTACACATTAAAGAAAGCA

GCAAAGATGACTTCGGGAAATACAGTGTCACAGCAACAAACAGTGCAGGCACAGCAACAGAAAACCTCAGTGTTATTGTTTTAGAAAAGCCTGGTCCTCC

CGTTGGACCAGTGAAGTTTGATGAAGTTAGTGCAGACTTTGTGGTCATATCTTGGGAACCTCCCGCCTATACTGGTGGGTGCCAAATCAGCAACTACATT

GTAGAGAAGCGAGATACTACCACTACCAACTGGCAGATGGTGTCAGCAACAGTTGCCAGGACAACCATTAAAATAAGCAAACTGAAAACAGGCACCGAAT

ACCAGTTTAGGATTTTTGCTGAGAACAGGTATGGGAAAAGCACTCCCCTGGATTCTAAGCCCGTTGTTGTACAATATCCATTTAAAGAGCCTGGACCACC

TGGAACCCCTTTTGTAACATCTATCTCCAAAGATCAAATGCTTGTGCAGTGGCATGAGCCAGTTAATGATGGAGGCAGCAAAGTGACTGGCTACCATCTT

GAACAGAAGGAAAAGAATAGCATCCTGTGGGTCAAGTTGAATAAGATCCCCATCCAAGACACCAAATTCAAAACAACGGGGCTTGATGAAGGGCTTGAAT

ATGAGTTCAGGGTTTCTGCCGAGAACATTGTGGGCATTGGCAAGCCTAGCAAAGTGTCAGAGTGCTATGTTGCGCGTGATCCGTGTGACCCACCTGGTCG

ACCTGAAGCCATCGTCATTACAAGAAACAGCGTCACGCTGAAATGGAAGAAACCTGTTTATGATGGTGGCAGCAAGATAACGGGTTACATCGTAGAAAAG

AAAGACCTTCCTGACGGCCGGTGGATGAAAGCCAGCTTCACCAATGTTGTGGAAACTGAGTTTACAGTGACTGGGCTTGTAGAAGACCAAAGATATGAAT

TTAGAGTCATTGCAAGAAATGCGGCTGACAACTTTAGTGAGCCATCTGAAAGCAGTGGCGCCATCACTGCAAGGGATGAAATCGATGCACCAAATGCCTC

GCTGGATCCTAAATACAGAGATGTCATCATTGTTCATGCAGGAGAGACCTTTGTTCTCGAAGCTGATATCCGTGGCAAACCCATACCTGACATCATATGG

TCAAAAGATGGGAACGAACTCGAAGAAACAGCAGCTAGGATGGAAATTAAATCTACTCTGCAGAAAACGACTCTCATTGTCAAGGACTGTATACGCACCG

ATGGGGGACAGTATACCTTGAAACTCAGCAATGTCGGGGGCACCAAGACTATACCTATTACCGTGAAGGTGCTGGATAGGCCAGGGCCTCCCGAAGGACC

TCTGAAAGTTACTGGAGTTACAGCCGAAAAGTGTTACCTGGCATGGAACCCACCTTTGCAAGATGGTGGTGCTAGTATTTCACATTACATCATTGAAAAG

AGAGAGACAAGCAGACTCTCCTGGACCCAGGTTTCAAATGAAGTACAGGCCCTCAACTACAAAGTCACGAAGTTGCTTCCTGGGAACGAGTATATTTTCC

GGGTTATGGCAGTGAATAAATATGGAATTGGAGAGGCCCTGGAGTCTGAACCGGTGATAGCCTGTAACCCATACAAGCGTCCAGGTCCTCCTTCAACACC

CGAGGCCTCAGCCATCACCAAAGACTCTATGGTACTAACATGGACACGTCCAGTGGATGACGGAGGTGCTGAAATTGAGGGGTACATTCTTGAAAAGCGA

GATAAGGAAGGCATCAGATGGACCAAGTGCAACAAGAAAACATTAACAGACCTTCGGTTCAGGGTGACAGGCCTCACAGAAGGCCACTCCTATGAATTCA

GAGTTGCTGCTGAGAACGCAGCTGGTGTCGGGGAACCCAGTGAGCCGTCCGTTTTCTACCGTGCATGTGATGCCTTGTATCCACCAGGTCCACCAAGCAA

CCCCAAAGTGACAGACACCTCCAGGTCTTCTGTCTCCCTAGCATGGAATAAGCCAATTTATGATGGTGGTGCACCCGTTAGAGGATATGTGATTGAGCTC

AAAAAAGCTGCGGCTGACGAATGGACTACCTGTACGCCACCATCGGGATTACAAGGGAAGCAGTTCACAGTGACCAAGCTTAAGGAGAATACAGAGTACA

ACTTCCGCATCTGTGCTTTCAATACTGAAGGTGTAGGTGAGCCTGCAACGATACCAGGCTCCGTTGTTGCTCAGGAGAGGATGGAAGCACCAGAAATAGA

ACTGGATGCTGATCTCAGAAAGGTGGTCACTCTGCGTGCAAGTGCCACTTTGCGCCTATTTGTCACTATCAAAGGCCGCCCAGAACCTGAAGTTAAGTGG

GAAAAGGCTGAAGGCATTCTCACGGAAAGAGCCCAGATCGAGGTGACGAGTTCTTATACAATGCTGGTGATTGACAACGTGACCAGATTTGACAGTGGTA

GATACAACCTCACCCTAGAAAACAACAGTGGCTCCAAAACGGCTTTTGTCAATGTCAGAGTTCTTGACTCACCAAGCGCACCCGTGAATCTGACCATAAG

AGAAGTGAAGAAAGACTCGGTGACGCTGTCCTGGGAGCCACCACTTATTGACGGTGGAGCAAAGATTACAAATTATATCGTTGAAAAACGAGAAACTACA

AGAAAAGCTTACGCTACCATTACAAACAACTGCACTAAGAATACTTTCAAAATCGAAAATCTACAAGAAGGGTGTTCTTATTACTTCCGAGTCCTGGCTT

CTAATGAATATGGGATTGGTTTGCCAGCCGAAACAGCAGAGCCTGTCAAAGTGTCCGAACCACCACTCCCACCTGGAAGGGTAACCCTTGTAGATGTGAC

CCGTAATACAGCTACGATTAAGTGGGAGAAGCCAGAGAGCGATGGCGGCAGCAAGATCACTGGTTATGTTGTGGAAATGCAGACAAAGGGCAGTGAAAAG

TGGAGCGCATGCACACAAGTGAAGACTTTGGAGACAACTATATCTGGCCTAACTGCAGGGGAAGAGTATGTCTTCAGGGTAGCTGCAGTTAATGAAAAAG

GAAGAAGCGACCCAAGACAGCTTGGGGTGCCAGTCATTGCAAAAGACATTGAAATAAAGCCCTCCGTTGAGCTTCCTTTTAATACTTTCAACGTTAAGGC

TAATGACCAACTCAAAATTGACATACCATTTAAAGGAAGACCTCAAGCTACCGTGGCCTGGAAAAAAGATGGTCAGGTCCTTAGAGAGACAACTAGAGTC

AACGTAGCTTCCTCAAAGACCGTAACAACCCTATCTATTAAAGAAGCCTCAAGGGAAGATGTTGGAACTTACGAACTATGTGTTTCAAATACTGCTGGAT

CCATAACAGTTCCTATTACTGTCATTGTCCTTGACAGGCCAGGACCTCCAGGACCCATACGAATTGATGAAGTTAGTTGTGACAATGTGTCTATTTCTTG

GAATCCTCCAGAGTATGATGGTGGCTGCCAAATTAGCAACTACATTGTTGAAAAGAGAGAAACCACTTCTACAACGTGGCAGGTAGTTTCACAAGCAGTG

GCAAGAACATCCATTAAGATAGTCCGTCTGACAACAGGAAGTGAGTATCAGTTCCGTGTCTGTGCAGAGAATCGGTATGGAAAGAGTTCCTACAGTGAGT

CCTCAGCCGTTGTCGCTGAGTATCCATTCAGCCCTCCTGGGCCTCCTGGTACTCCTAAAGTTGTGCATGCCACAAAATCTACCATGGTTGTAAGCTGGCA

AGTACCAGTTAATGACGGAGGGAGCCAAGTGATTGGCTATCACCTTGAATACAAAGAAAGAAGCAGCATTCTCTGGTCAAAAGCAAACAAAGTCCTCATT

GCAGATACTCAGATGAAGGTCTCTGGTCTGGATGAGGGGCTGATGTACGAGTATCGTGTATATGCTGAGAATATCGCTGGAATTGGTAAATGCAGTAAAG

CCTGTGAACCGGTCCCTGCAAGAGACCCTTGTGACCCTCCTGGACAACCTGAAGTCACCAATATCACAAGAAAATCAGTGTCACTTAAGTGGTCTAAACC

ACGTTATGATGGTGGAGCGAAGATCACCGGATACATTGTTGAACGCAGAGAGCTACCGGACGGCAGGTGGCTGAAGTGCAATTTCACCAACGTTCAGGAA

ACATACTTTGAAGTAACTGAGCTAACTGAAGACCAGCGTTATGAATTCCGGGTTTTTGCAAGAAATGCTGCTGATTCAGTCAGTGAGCCATCTGAATCCA

CTGGACCTATCACGGTGAAAGACGACGTTGAGGCGCCAAGAATTATGATGGATGTCAAATTCCGAGATGTCATCATTGTCAAGGCCGGAGAAGTCCTTAA

GATAAATGCAGACATTGCAGGGCGACCTCTGCCGGTAATTTCCTGGGCCAAAGATGGGGTAGAAATTGAAGAAAGGGCAAAAACAGAAATTGTCTCAACA

GACTATACTACCACATTAACAGTTAAAGACTGTGTAAGAAGAGACACTGGGCAGTATGTCCTTACACTGAAGAATGTGGCAGGAACTCGGACTATGGCAG

TTAACTGTAAAGTACTTGATAAGCCTGGCCCGCCAGCAGGGCCACTTGAAATAAATGGCCTCACTGCTGAGAAGTGCTCCCTTTCCTGGGGACGTCCCCA

GGAAGATGGCGGTGCAGATATTGATTATTATATCGTAGAAAAACGTGAAACAAGCCGCCTTGCATGGACCATATGTGAAGCAGAGTTAAGGACAACATCT

TGTAAAGTGACCAAGCTACTCAAAGGCAACGAATATATCTTCAGAGTAACTGGTGTTAATAAATATGGTGTTGGTGAGCCCTTGGAGAGCATGGCCGTGA

AGGCGCTAGATCCATTCACCACTCCTAGCCCACCCACATCTTTGGAAATTACATCTGTGACCAAAGATTCCATGACACTTTGCTGGTCAAGACCTGAGAC

TGATGGAGGCAGTGACATCTCTGGATACATAATCGAAAGGCGTGAGAAAAACAGTCTACGGTGGATGCGTGTGAACAAGAAGCCAGTGTATGATCTGAGA

GTGAAGTCCACAGGACTCCGAGAAGGATGTGAATATGAGTATCGGGTTTTTGCTGAAAATGCTGCCGGCCTGAGTCTTCCAAGTGAAACTTCTCCCTTGG

TTCGAGCAGAAGACCCTGTGTTCTTGCCATCTCCTCCATCTAAACCCAAAATAGTGGACTCGGGCAAGACAACAATCACCATTGGCTGGGTTAAACCTTT

GTTTGACGGTGGGGCTCCAATAACGGGATATACCGTAGAATACAAAAAGTCTGAGGAAACCGACTGGAAAGTTGCCATTCAGAGCTTCAGAGGCACAGAA

TACACAATGAGTGGGCTAACAACAGGAGACGAGTATGTTTTTAGAGTGAGGTCACTCAATAAGATGGGTGCCAGTGACCCCAGTGATAGCTCCGATCCCC

AGGTAGCCAAAGAGAGAGAAGAAGAACCTGTATTTGACGTTGACAGTGAGATGAGGAAGACCTTGATTGTCAAGGCTGGGTCCTCGTTTACCATGACAGT

TCCTTTCAGAGGAAGACCAATCCCCAACGTCTCCTGGAGTAAGCCCGACACCGACCTCCGCACGAGAGCGTACATCGACTCCACAGATTCTCGTACATTA

CTTACTATTGAGAATGCCAACAGAAATGATTCTGGAAAATACACGCTGACAATTCAGAATGTGCTGAGCGCTGCTTCCATGACCTTCGTCGTCAAAGTCT

TAGATTCCCCGGGGCCTCCAGCCAATATTACTGTACGTGAAGTAACCAAGGAAACTGCTATGCTGTCCTGGGATGTTCCTGAAAATGATGGCGGAGCACC

GGTGAAGAATTACCACATAGAAAAACGTGAGGCCAGCAAGAAGGCGTGGGTGTCGGTCACTAACAACTGCAACCGCCTCTCTTACAAAGTGACCAACTTA

CAGGAAGGAGCTATCTACTACTTCCGAGTCTCTGGGGAGAACGAGTTTGGTGTTGGTGTGCCAGCTGAGACAAAGGAAGGAGTCAAAATAACAG AAAAA

CCAAGCCCACCAGAAAAGCTTGGTGTAACAAGTGTATCCAAAGACAGTGTCTCATTGAGCTGGCTGAAGCCAGAACACGACGGTGGTAGCAGAATCATAC

ACTATGTCGTCGAAGCACTTGAAAAAGGACAGAAAACGTGGGTTAAGTGCGCTGTGGTGAAGACAACCCACCACGTTGTTTCCGGTCTGAGAGAGAGTCA

TGAGTACTTCTTCCGGGTCTTTGCAGAAAACCAAGCTGGTCTGAGTGACCCCAGGGAGCTCCTGCTTCCTGTCCTCATCAAGGACCAGCTAG AACCACC

CGAAATTGATATGAAGAATTTCCCAAGTCACACTGTGTATGTAAGAGCTGGTTCCAACCTTAAAGTTGACATTCCAATTTCTGGAAAACCATTACCCAAA

GTGACCTTATCAAGAGATGGTGTACCACTGAAGGCCACCATGAGATTTAATACTGAGATTACCGCTGAGAACCTGACCATCAATCTCAAAGAAAGTGTTA

CCACTGACGCTGGAAGATATGAGATCACTGCTGCCAACTCCAGTGGAACCACCAAAACTTTCATTAACATCATTGTGCTGGACAGGCCTGGACCCCCTAC

TGGCCCTGTAGCCATTAGTGATATAACTGAAGAAAGTGTGACTCTCAAATGGGAGCCACCAAAGTATGATGGCGGAAGCCACGTCACCAATTACATTGTC

CTGAAGAGAGAAACAAGTACTGCAGTGTGGTCTGAAGTGTCAGCAACAGTAGCAAGAACCATGATTAAAGTCATGAAACTAACCACAGGAGAAGAATACC

AATTCCGCATCAAGGCAGAAAATCGCTTCGGCATCAGTGATCATATAGATTCAGTGTGTGTGGTTGTCAAACTACCATACA CTACACCTGGACCACCAT

CTACACCCTGGGTATCTAACGTTACTCGAGAAAGCATCACTGTGGGTTGGCACGAACCAGTGTCCAATGGAGGTAGTGCAGTCACGGGCTACCACCTGGA

AATGAAAGACAGAAATAGTATTTTGTGGCAGAAAGCCAACAAAATGATCATCCGTACAACTCACTTCAAAGTTACAACAATCAGCGCTGGACTTATTTAT

GAATTCAGGGTGTATGCAGAGAATGCTGCTGGTATCGGAAAGCCCAGTCACCCATCTGAACCAGTCTTGGCCATTGATGCCTGCG AACCCCCAAGAAAT

GTGCGGATCACTGATATCTCAAAGAACTCTGTCAACCTTTCATGGCAACAACCAGCTTTTGATGGAGGAAGCAAGATTACAGGCTACATTGTTGAGAGGC

GCGACCTTCCAGATGGGAGATGGACCAAGGCTAGCTTCACCAATGTTATTGAGACTCAATTCACTGTCTCTGGATTGACTCAGAATTCCCAGTATGAATT

CCGGGTCTTTGCTAGAAATGCTGTTGGTTCTGTCAGCAACCCATCTGAGGTTGTAGGCCCCATCACATGCATTGACTCTTATG GTGGGCCTGTGATTGA

CTTGCCTCTAGAATATACAGAAGTTGTCAAATATAGAGCAGGTACCTCCGTGAAGCTCAGAGCTGGTATTTCCGGCAAACCCGAGCCTACGATTGAGTGG

TACAAAGATGATAAAGAATTACAAACCAATGCATTGGTGTGTGTGGAAAATAGCACTGACCTTGCATCTATACTCATCAAAGATGCCAACCGCCTTAACA

GTGGAAGCTATGAGTTGAAACTGAGGAATGCCATGGGTTCCGCCTCAGCCACCATCAGAGTACAGATCCTTG ACAAACCAGGACCTCCAGGCGGACCAA

TTGAATTTAAGACTGTCACTGCAGAAAAGATAACTCTGCTCTGGAGGCCCCCAGCTGACGACGGTGGCGCAAAGATCACGCACTACATCGTGGAAAAACG

GGAGACAAGCCGAGTCGTGTGGTCTATGGTGGCTGAAAATCTGGAAGAGTGCATCGTTACAACTACCAAAATTATCAAAGGGAATGAGTACGTCTTCCGA

GTCCGAGCTGTGAATAAGTATGGAATTGGCGAGCCGCTAGAATCTGAGCCAGTTGTAGCCAAGAATGCCTTTG TTACACCTGGGCCTCCAAGCATCCCA

GAGGTGACAAAGATTACCAAGAATTCAATGACTGTTGTCTGGGACAGGCCAACTGTAGATGGTGGCAGTGAAATAAATGGCTATTTCCTTGAAAGACGAG

ACAAGAAGAGTCTAGCGTGGCTTAAAGTATTAAAGGAGACTATTCGTGACACCAGACAAAAGGTGACAGGACTCACGGAAAACAGTGACTATCAGTATCG

AGTCTGTGCTGTAAATGCTGCTGGAGTGGGTCCATTCTCAGAACCATCCGACTTCTACAAGGCTGCTGATCCAATTG ATCCTCCAGGACCACCTGCCAA

GATAAGAATTGCAGACTCGACCAAATCATCCATCACCCTTGGCTGGAGTAAGCCTGTCTATGATGGTGGCAGTGATGTTACTGGATATGTGGTTGAGATG

AAACAAGGAGATGAAGAAGAATGGACCATTGTCTCTACCAGGGGAGAGGTCAGAACTACAGAATATGTGGTCTCTAACCTGAAACCCGGAGTCAATTATT

ATTTCCAAGTATCAGCAGTAAACTGTGCCGGCCAAGGAGAACCTATAACAATGACTGAACCTGCACAGGCTAAAGATGTCCTTG AGGAACCAGAAATCG

ACCTAGATGTGGCTCTCAGAACATCTGTTATAGCTAAAGCTGGTGAAGATGTCCAACTACTGATTCCCTTTAAAGGCAGACCGCCACCTACTGTCACCTG

GAGGAAAGATGAGAAGAATCTTGGCAGCGATACCAGATACAGCATCCAAAACACTGATTCGTCTTCTTTGCTTGTTATTCCTCAAGTCACTCGCAATGAT

ACAGGAAAATACATCCTGACAATAGAAAACGGAGTAGGCCAACCAAAGTCTTCCACCGTGAGTGTTAAGGTGCTCGACACACCAGCTGCCTGCCAGAAGT

TACAGGTGAAACATGTTTCCCTAGGCACAGTCACATTGCTCTGGGATCCTCCTCTCATCGATGGAGGGTCTCCCATCATTAACTATGTCATCGAAAAGAG

AGATGCCACGAAGAGAACATGGTCTGTTGTGTCACACAAGTGTTCCGGCACATCCTTTAAAGTAACAGATTTATCAGAGAAGACTCCATTCTTCTTCAGG

GTTCTTGCAGAAAATGAAATTGGCATTGGTGAGCCTTGCGAGACCACGGAGCCCGTGAAGGCTGCTGAGGTGCCAGCACCTATCCGAGATCTCTCAATGA

AAGATTCCACAAAGACATCTGTTGTCCTGAGCTGGACCAAGCCTGACTTTGATGGTGGGAGCATCATCACAGACTATCTGGTGGAACGGAAAGGCAAAGG

TGAACAAGCATGGTCCCATGCTGGCATCAGTAAGACATGTGAGATTGAGATTGGACAACTTAAAGAGCAATCAGTCTTGGAATTCCGAGTGTCTGCTAGA

AATGAGAAAGGACAGAGCGACCCTGTCACTATTGGGCCACTTACAGTGAAGGAGCTTGTAATTACACCTGAAGTTGACTTGTCAGAAATCCCTGGGGCAC

AAATATCTGTGAGAATTGGACATAACGTACACCTTGAATTACCTTATAAAGGAAAACCCAAGCCATCCATCAGTTGGCTGAAAGATGGCTTGCCACTGAA

GGAAAGTGAATATGTTCGTTTCAGTAAGACAGAAAACAAAATCACCTTGAGTATTAAGAATTCGAAGAAAGAGCATGGAGGGAAATATACTGTTATTCTT

GATAATGCAGTGTGTAGAAACTCATTCCCCATTACAATCATCACCCTCGGCCCACCGTCAAAGCCCAAAGGACCCATTAGATTTGATGAAATCAAGGCTG

ACAGCGCCATCATGTCATGGGACATACCTGAAGATGACGGAGGAGGAGAAATCACCTGTTACAGCATTGAGAAGCGGGAAGCATCACAAACAAATTGGAA

GATGGTGTGTTCAAGTGTTGCCAGAACAACTTTCAAAGTTTCCAATCTGGTCAAAGATTCTGAATACCAGTTTAGAGTTAGAGCAGAAAATAGATATGGA

GTCAGTGAGCCACTTGCCTCAAATATCATCGTGGCAAAACACCAATTCAGGATTCCTGGTCCTCCAGGAAAGCCAGTCATCTACAATGTAACTTCGGATG

GCATGTCACTAACTTGGGATGCACCAGTTTATGATGGTGGTTCAGAAGTTACTGGATTCCATGTTGAAAAGAAAGAAAGAAACAGCATTCTTTGGCAAAG

GGTTAACACATCACCAATATCTGGGAGAGAATACAGAGCTACTGGCTTAATAGAAGGGCTGGACTATCAATTCCGTGTATATGCTGAGAATTCTGCTGGC

CTGAGCTCACCTAGTGACCCAAGCAAGTTTACATTAGCTGTTTCCCCAGTAG ACCCACCCGGCACTCCTGACTACATTGATGTCACCCGGGAAACCATC

ACACTTAAATGGAACCCACCATTACGTGATGGGGGCAGTAAGATCGTGGCCTACAGCATTGAGAAGCGGCAAGGAAGTGACCGCTGGGTGAGATGCAACT

TCACTGACGTCAGTGAGTGTCAGTACACAGTTACGGGACTCAGTCCTGGAGATCGATATGAGTTCAGAATAATTGCAAGAAATGCTGTTGGCACTATAAG

CCCCCCCTCACAGTCTTCTGGCCTCATTATGACAAGAGATGAAAACG TTCCACCAACAGTAGAATTTGGCCCTGAGTACTTCGATGGTCTTGTTATTAA

GTCTGGAGACAGTCTTAGGATCAAAGCTTTGGTTCAAGGACGACCGGTCCCACGAGTAACTTGGTTCAAAGATGGAGTTGAAATTGAGAGGAGAATGAAC

ATGGAAATAACTGATGTTCTTGGCTCTACCAGCCTCTTTGTCAGAGACGCAACTCGAGATCACCGTGGTGTTTACACCGTGGAAGCCAAAAATGTATCTG

GTTCCACAAAAGCAGAAGTTACAGTGAAAGTACAAG ATACACCAGGAAAAGTAGTCGGGCCAATAAGATTTACTAATATTACTGGTGAAAAGATGACCC

TGTGGTGGGAGGCACCTCTCAATGACGGCTGCGCTCCTGTCACGCACTACATCATTGAAAAGCGTGAAACCAGCAGACTTGCTTGGGCATTGATTGAGGA

TAATTGCGAAGCCCTAAGTTACACTGCCATTAAACTAATCACTGGCAATGAGTATCAGTTCCGGATTTCTGCAGTTAACAAGTTTGGTGTTGGCAGGCCA

CTTGAGTCCGACCCCGTGGTTGCTCAAATACAATACA CCATTCCAGATGCTCCCGGAGTTCCAGAACCTAGCAATGTCACAGGCAACAGCATTACCCTG

ACTTGGACGAGGCCAGAATCAGATGGTGGCAGTGAGATTCAACACTACATCCTTGAAAGGAGAGAAAAGAAAAGCACAAGATGGGTAAAAGTGATCAGCA

AACGACCAATCTCTGAGACAAGGTTCAAAGTCACAGGTCTGGTGGAAGGCAACGAGTATGAGTTCCATGTCATGGCTGAAAACGCTGCGGGCATAGGACC

AGCAAGTGGGATCTCAAGACTCATTAAATGCAGAGAGCCTGTTAACCCACCAAGTGCCCCCTCGGTAGTCAAAGTGACAGACACATCAAAGACAACTGTG

AGCTTGGAATGGGCCAGGCCAGTCTTTGACGGCGGGATGGAGATAATTGGATACATAATAGAAATGTGCAAAGCTGACTTAGGGGACTGGCACAAAGTAA

ACACAGAGCCATGTGTGAAAACAAGATACACGGTCACTGATCTACAGGCTGGTGAAGAATACAAATTCCGGGTCAGTGCGGTCAATGGTGCTGGGAAAGG

AGACAGCTGTGAGGTGACCGGCACAATAAAAGCAGTCGATCGGTTATCAGCTCCCGAGTTAGACATTGATGCAAACTTCAAGCAGACTCACATTGTTAGA

GCGGGAGTTAGCATTCGTCTCTTCATTGCCTACCAGGGTAGACCCACTCCTACAGCAGTATGGAGCAAGCCTGACTCTAACCTTAGCATCCGGGCTGATA

TCCACACAACAGACTCCTTCAGCACCCTCACCGTGGAAAACTGCAACAGAAATGATGCAGGGAAATACACACTCACGGTAGAAAACAACAGCGGTAAGAA

GTCGATAACATTCACTGTAAAGGTGCTGGACTCTCCAGGACCACCTGGTCCCATTACCTTCAAAGATGTGACCCGGGGATCTGCTACACTGATGTGGGAC

GCCCCTCTCCTTGATGGTGGTGCCCGGATCCATCACTATGTGATAGAGAAGCGGGAAGCGAGTCGCCGTAGCTGGCAGGTTGTCAGTGAAAAATGCACTC

GCCAGATCCTCAAGGTGAGTGAGCTGACAGAAGGTGTTCCGTACTATTTCCGTGTTTCTGCTGAAAATGAGTACGGTGTTGGTGAACCCTATGAAATGCC

AGAACCAATTGTAGCCACAGAACAGCCCGCTCCACCTAGGAGGCTTGATGTCGTTGACACTAGCAAATCCTCTGCGGTCCTAGCCTGGCTTAAACCCGAT

CATGATGGAGGTAGTCGGATCACTAGCTACCTGCTTGAAATGCGACAAAAGGGATCTGACTTCTGGGTTGAAGCTGGTCACACCAAACAGCTGACTTTCA

CAGTGGAGCGCCTCGTTGAGAATACTGAATATGAATTCCGGGTGAAAGCCAAGAACGACGCTGGCTACAGTGAACCCAGGGAAGCCTTCTCATCTGTCAT

TATCAAGGAGCCTCAAATTGAGCCCACTGCTGATCTCACTGGAATCACCAATCAGCTCATCACTTGCAAAGCAGGAAGCACATTTACCATTGACGTGCCA

ATCAGTGGTCGTCCTGCCCCCAAAGTAACATGGAAGCTAGAAGAAATGAGACTCAAGGAGACAGATCGAATGAGTATCGCAACAACAAAAGACAGGACCA

CCCTGACTGTAAAGGACAGTATGAGAGGTGACTCTGGCAGATACTTCCTGACCCTAGAAAACACAGCCGGTGTTAAAACATTTACTATCACAGTTGTGGT

CATTGGAAGACCAGGGCCAGTAACTGGTCCCATTGAGGTCTCATCTGTCTCGGCTGAATCATGTGTCCTATCATGGACTGAACCAAAAGACGATGGAGGC

ACTGAAATTACAAATTATATAGTTGAAAAGCGCGAGTCGGGTACCACCGCCTGGCAGCTTATCAATTCTAGTGTGAAGCGCACGCAGATTAAAGTCACAC

ACCTCACAAAATACAAAGAATACTGTTTCCGGGTCAGCTCAGAGAATAGATTCGGGGTCAGCAAGCCTCTGGAATCAGTGCCAATAGTTGCTGAACATCC

ATTTG TTCCACCAAGTGCTCCTACCAGGCCTGAGGTCTACTATGTGTCTGCCAATGCTATGTCAATTCGTTGGGAAGAACCCTACCATGATGGCGGTAG

TAAAATCGTTGGCTACTGGGTTGAGAAGAAAGAACGTAACACCATTCTTTGGGTGAAAGAAAACAAAGTGCCGTGCTTAGAGTGTAACTACAAAGTGACA

GGCTTGGTAGAAGGACTGGAGTATCAGTTCCGAACATATGCACTCAATGCTGCGGGCGTCAGCAAGGCCAGTGAAGCTTCAAGACCTATCATGGCTCAAA

ATCCAGTTG ATCCACCTGGTAGGCCAGAAGTGACAGATGTCACAAGATCAACAGTGTCACTAATTTGGTCTGCCCCAGTGTATGACGGAGGCAGCAAAG

TTGTGGGCTACATCATAGAACGGAAGCCAGTCAGTGAAGTTGGAGATGGTCGCTGGCTGAAGTGCAACTATACCATTGTCTCTGATAATTTCTTCACTGT

GACCGCTCTCAGCGAAGGGGACACTTATGAATTCCGTGTGTTGGCCAAGAACGCAGCAGGCGTAATTAGCAAAGGCTCTGAATCTACAGGCCCTGTAACT

TGCCGAGATGAATATG CTCCACCAAAAGCTGAATTGGATGCCAGGTTACAAGGCGATCTGGTGACCATCAGAGCAGGTTCAGATCTTGTTCTTGATGCT

GCTGTTGGTGGCAAACCTGAACCCAAAATCATCTGGACCAAAGGAGACAAGGAACTGGATCTCTGTGAAAAAATTTCTCTACAGTACACTGGCAAGCGAG

CCACTGCTGTGATCAAATACTGTGACCGGAGTGACAGTGGGAAATACACACTGACAGTGAAGAACGCTAGTGGGACCAAGTCCGTATCTGTCATGGTCAA

AGTTCTTG ATTCTCCTGGCCCATGTGGAAAACTCACTGTCAGCAGAGTGACCGAGGAGAAGTGCACCTTAGCCTGGAGCCTTCCACAGGAAGATGGAGG

AGCAGAGATAACTCACTATATTGTAGAGAGACGGGAGACTAGCAGGCTCAATTGGGTGATCGTGGAAGGGGAATGCCTGACCGCATCCTACGTGGTTACC

AGACTCATCAAGAACAATGAATACACATTCCGCGTGAGGGCAGTGAACAAGTACGGCCTCGGCGTGCCAGTTGAGTCAGAGCCTATTGTGGCCAGAAACT

CTTTCA CGATTCCATCACAACCTGGCATACCAGAAGAAGTTGGGGCTGGCAAAGAGCACATCATTATTCAGTGGACGAAACCTGAATCTGATGGTGGCA

ATGAAATCAGCAACTACCTCGTCGACAAACGGGAGAAGAAAAGCTTGCGCTGGACCCGTGTCAACAAAGACTACGTGGTGTACGACACCAGGCTGAAGGT

GACCAGCCTCATGGAAGGCTGTGATTATCAGTTCCGAGTGACTGCCGTGAACGCTGCTGGCAACAGTGAGCCCAGTGAAGCTTCAAACTTCATCTCATGC

AGAGAGCCATCAT ACACCCCTGGGCCACCTTCTGCTCCAAGAGTTGTGGATACCACCAAGCGCAGCATTAGTTTGGCATGGACCAAGCCCATGTACGAC

GGTGGTACTGACATCATAGGATACGTCCTTGAAATGCAAGAGAAGGACACAGATCAATGGTGCCGAGTACATACAAACGCCACGATAAGAAACAACGAAT

TCACTGTGCCTGACCTTAAGATGGGCCAGAAGTACTCCTTCAGGGTTGCTGCTGTGAACGCCAAGGGTATGAGTGACTACAGTGAGACGACTGCTGAAAT

TGAGCCCGTGGAAAGACTAG AAATACCAGATCTTGAGCTTGCAGATGATCTGAAGAAGACCGTGATTGTCAGGGCTGGAGCCTCCTTGCGCCTGATGGT

GTCTGTCTCTGGAAGACCTTCTCCTGTCATCACGTGGAGCAAAAAAGGCATTGACCTTGCAAATCGGGCAATTATTGACAACACAGAGAGCTACTCTTTA

CTCATTGTAGACAAAGTTAATCGGTATGATGCTGGAAAATACACAATTGAAGCTGAAAATCAGTCTGGCAAGAAATCAGCAACGGTCCTAGTTAAAGTCT

ATG ATACTCCTGGTCCCTGCCCTTCAGTGAGCGTTAAAGAAGTTTCGAGAGATTCTGTGACCATCACTTGGGAAATCCCCACAATTGATGGTGGTGCTC

CGGTCAACAATTACATTATTGAGAAGCGAGAAGCCGCCATGAGGGCATTCAAGACAGTAACCACCAAATGCAGCAAGACTCTTTACCGCATATCTGGACT

CGTCGAGGGAACCATGTACTACTTTAGAGTGCTTCCAGAAAACATCTATGGCATCGGAGAGCCTTGCGAAACATCAGACGCAGTTCTAGTCTCAGAAGTA

CCTTTGGTGCCCACAAAACTAGAAGTGGTTGATGTCACCAAATCCACTGTGACCCTTGCTTGGGAGAAACCACTCTATGACGGTGGAAGCCGACTCACCG

GATATGTTCTTGAGGCCTGCAAAGCCGGCACCGAGAGATGGATGAAAGTTGTCACTTTGAAACCCACAGTCTTAGAGCACACTGTTATTTCCCTGAATGA

AGGCGAGCAGTACTTGTTTAGAGTGAGGGCTCAAAATGAGAAAGGTGTGTCAGAACCGAGAGAGATCGTCACACCAGTGACAGTACAAGACCTCAGAG T

GTTGCCAACGATTGACCTTTCCACAATGCCCCAAAAGACCATCCATGTCCCAGCTGGCAGACCAATTGAGCTGGTGATACCGATCACTGGTCGGCCGCCA

CCTACTGCTTCCTGGTTCTTTGCTGGTTCTAAACTGAGAGAATCAGAGCGTGTCACAGTTGAAACCCACACTAAAGTCACCAAGCTAACCATCCGTGAAA

CTACTATAAGAGATACGGGAGAATATACGCTTGAACTAAAGAATGTTACTGGAACCACCTCAGAGACAATAAAAGTTATTATTCTTG ACAAGCCTGGTC

CACCAACTGGGCCCATCAAGATTGATGAAATTGATGCCACGTCAGTTACGATATCCTGGGAACCTCCCGAATTGGATGGTGGTGCTCCACTGAGTGGCTA

TGTGGTAGAGCAGCGTGATGCTCATCGTCCAGGATGGCTGCCAGTTTCTGAGTCTGTAACAAGACCAACGTTTAAGTTTACCAGACTCACCGAAGGAAAT

GAATACGTGTTCCGCGTGGCTGCAACAAACCGCTTCGGGATTGGCTCGTACTTGCAGTCTGAGGTCATAGAATGCCGAAGCAGCATCA GTATTCCTGGA

CCTCCAGAAACATTACAGATATTTGATGTCTCCCGTGATGGCATGACACTTACATGGTATCCACCTGAAGATGATGGTGGCTCCCAAGTGACTGGATATA

TCGTGGAACGTAAAGAAGTAAGAGCTGATCGGTGGGTCCGTGTAAATAAAGTACCAGTGACTATGACCCGGTACCGCTCCACCGGCCTTATTGAAGGCTT

AGAATATGAACATCGGGTCACAGCCATTAATGCAAGAGGAACTGGAAAACCAAGTCGTCCTTCCAAACCCACCGTTGCCATGGATCCAATTG CTCCACC

AGGAAAACCACAAAATCCAAGAGTTACAGATACAACAAGGACTTCAGTCTCCCTGGCCTGGAGTGTTCCGGAAGATGAAGGTGGATCTAAAGTCACAGGG

TACTTGATCGAAATGCAAAAAGTAGATCAACGTGAATGGACCAAATGTAACACCACCCCAACCAAGATTCGGGAGTATACCCTAACACACCTACCTCAGG

GCGCTGAATACAGATTCCGTGTCCTAGCCTGTAATGCTGGTGGACCTGGAGAACCTGCTGAGGTACCAGGAACCGTCAAAGTCACAGAGATGCTGG AAT

ACCCTGACTATGAACTTGATGAGAGATACCAGGAAGGTGTCTTTGTTCGACAAGGTGGGGTCATCAGGCTTACCATCCCAATCAAAGGAAAACCATTCCC

AGTATGTAAATGGACCAAGGAAGGCCAAGACATTAGTAAGCGTGCCATGATTGCAACATCGGAAACACATACTGAGCTTGTGATCAAAGAAGCAGACAGA

AACGATTCTGGAACTTACGACTTGGTTCTGGAAAACAAATGTGGCAAGAAGACCGTTTACATTAAGGTCAAGGTGATAGGAAGTCCCAACACTCCAGAAG

GGCCACTGGAATACGATGACATACAAGCCCGCTCTGTAAGGGTCAGCTGGAGACCTCCTGCTGACGATGGTGGTGCTGACATCCTGGGCTACATCCTTGA

GAGAAGAGAGGTACCTAAGGCTGCCTGGTATACCATTGACTCCAGAGTCCGAGGCACATCTCTGGTGGTGAAAGGCCTCAAAGAAAACGTGGAATACCAT

TTCCGTGTCTCAGCAGAAAACCAGTTTGGCATAAGCAAACCCTTGAAATCTGAGGAGCCAGTCATACCAAAGACACCACTGA ATCCACCAGAACCACCA

AGCAATCCTCCTGAAGTACTTGATGTGACCAAAAGTTCCGTTAGCTTGTCATGGTCTCGACCTAAAGATGACGGCGGCTCTCGAGTGACGGGCTACTACA

TTGAGCGCAAGGAGACATCCACTGACAAGTGGGTCAGACACAACAAAACCCAGATAACCACCACGATGTACACTGTCACCGGCCTCGTTCCCGATGCTGA

GTACCAGTTCCGCATCATCGCACAGAATGACGTTGGCCTTAGTGAGACCAGCCCTGCTTCTGAACCTGTTGTTTGCAAAGATCCCTTTG ATAAGCCAAG

CCAACCAGGAGAACTTGAGATTCTCTCGATATCCAAAGACAGTGTCACCCTCCAGTGGGAGAAACCCGAATGTGATGGTGGCAAAGAAATCCTTGGATAC

TGGGTTGAATACAGACAGTCTGGAGACAGTGCTTGGAAGAAGAGCAATAAGGAACGGATCAAGGACAGACAGTTCACCATCGGCGGTTTGCTAGAAGCTA

CTGAATATGAGTTCCGAGTATTTGCTGAGAACGAGACTGGGCTCAGCCGACCACGTAGAACAGCTATGTCTGTCAAGACTAAACTAACAT CTGGAGAAG

CCCCAGGAGTGCGCAAAGAAATGGCTGATGTGACCACCAAATTAGGTGAAGCTGCACAACTCTCATGCCAGATAGTTGGAAGGCCCCTTCCTGACATTAA

ATGGTACCGGTTTGGTAAAGAGCTCATACAAAGCCGGAAGTACAAAATGTCCTCAGATGGGCGCACGCATACTCTGACAGTAATGACAGATGAACAAGAA

GATGAAGGTGTTTATACATGTGTAGCCACAAATGAAGTAGGAGAAGTAGAAAGCAGCAGCAAGCTTCTTCTGCAAGCGGCACCACAGTTCCATCCTGGTT

ACCCACTGAAAGAGAAGTATTACGGGGCCGTGGGGTCTACGCTTCGGCTCCACGTTATGTATATTGGCCGCCCAGTACCTGCCATGACTTGGTTCCATGG

CCAGAAACTTTTGCAAAACTCAGAAAAAATCACCATTGAAAACACTGAGCACTATACTCACCTTGTCATGAAGAATGTCCAACGAAAGACTCATGCTGGG

AAATACAAGGTTCAGCTCAGCAATGCCTTTGGGACAGTGGATGCCACCCTAGATGTGGAAATACAAG ATAAACCAGACAAGCCTACTGGACCCATTGTG

ATTGAAGCACTACTCAAGAACTCGGTGGTGATCAGCTGGAAACCACCTGCTGATGATGGCGGCTCCTGGATCACCAATTACGTGGTAGAGAAATGTGAGG

CCAAAGAAGGTGCTGAATGGCAATTGGTGTCTTCAGCCATCTCGGTGACAACCTGCAGAATTGTGAACCTCACAGAGAATGCCGGCTACTATTTCCGGGT

CTCAGCTCAGAACACCTTTGGCATCAGTGAGCCACTAGAGGTCGCCTCCATTGTGATCATCAAGAGTCCATTCG AAAAGCCAGGTGTTCCTGGTAAACC

AACCATCACTGCTGTCACAAAGGATTCTTGTGTTGTGGCTTGGAAGCCACCTGCAAGCGATGGCGGTGCAAAGATCAGAAATTACTACCTTGAGAGGCGC

GAGAAGAAGCAAAACAAGTGGATTGCTGTGACGACAGAGGAAATTCGAGAAACCGTCTTCTCAGTGCAAAACCTTATTGAAGGTCTTGAATATGAGTTCC

GTGTGAAATGTGAAAACCTGGGTGGAGAGAGTGAATGGAGTGAAATATCAGAACCCGTCACTCCAAAATCCGACGTCCCGATTCAGGCTCCACACTTCAA

GGAGGAGCTGAGAAACCTGAATGTAAGGTATCAGAGCAACGCCACTCTGGTCTGCAAGGTGACCGGTCACCCAAAGCCTATTGTGAAATGGTACAGACAA

GGCAAAGAAATTATCGCCGATGGACTCAAGTACAGGATTCAAGAATTTAAGGGCGGTTACCACCAGCTCATCATTGCAAGCGTCACAGATGATGATGCCA

CGGTGTACCAAGTCAGAGCCACCAACCAAGGGGGCTCCGTGTCTGGCACTGCTTCCTTGGAAGTGGAAG TTCCAGCTAAGATACACTTGCCCAAGACTC

TCGAAGGCATGGGAGCGGTCCATGCTCTCCGAGGGGAAGTGGTTAGCATCAAGATCCCCTTCAGTGGTAAGCCAGACCCCGTGATCACCTGGCAGAAAGG

ACAAGATCTCATCGACAATAATGGCCACTACCAAGTGATTGTCACAAGATCCTTCACGTCACTTGTCTTCTCCAATGGAGTGGAGAGAAAAGATGCTGGC

TTCTATGTCGTCTGTGCTAAAAACAGATTTGGAATTGATCAAAAGACAGTCGAACTGGATGTGGCTGATGTCCCCGACCCACCCAGGGGTGTCAAAGTTA

GTGACGTCTCACGCGATTCTGTCAACTTAACATGGACAGAGCCAGCTTCTGATGGTGGTAGCAAGGTCACCAACTACATCGTGGAAAAGTGTGCAACTAC

TGCAGAAAGATGGCTCCGAGTGGGACAGGCCCGAGAAACCCGTTACACTGTGATCAACTTGTTTGGAAAAACAAGTTACCAGTTCCGAGTAATAGCTGAA

AATAAATTTGGCCTGAGCAAGCCATCAGAGCCCTCAGAACCAACCGTTACCAAAGAAGATAAGACCAGAGCTATGAATTATGATGATGAGGTGGATGAAA

CCAGAGAGGTCACCACGACTAAAGCATCACACTCCAAAACTAAAGAACTCTACGAGAAATACATGATAGCTGAAGATCTGGGGCGTGGTGAGTTTGGAAT

TGTCCACCGTTGCGTTGAAACATCCTCAAAGAGGACATTCATGGCCAAATTTGTTAAAGTCAAAGGAACCGATCAGGTTTTAGTCAAGAAAGAGATTTCC

ATTCTAAACATTGCTAGGCACAGGAACATCTTATACCTCCATGAATCATTTGAAAGCATGGAAGAGTTAGTTATGATCTTTGAATTTATATCAGGACTCG

ACATATTTGAACGCATCAACACGAGCGCCTTTGAGCTTAATGAAAGAGAAATTGTAAGCTATGTCCGCCAAGTCTGCGAAGCACTGGAGTTCTTACATAG

CCAGAATATTGGCCACTTTGACATTCGACCAGAAAATATCATTTACCAGACAAGAAAGAACTCCACTATTAAAATAATAGAGTTTGGTCAAGCCCGTCAG

CTGAAGCCAGGAGACAACTTTAGGCTGCTGTTCACTGCCCCTGAATACTATGCCCCTGAAGTCCACCAGCATGATGTTGTCAGCACTGCCACAGACATGT

GGTCGCTTGGTACATTGGTGTATGTGCTACTGAGTGGAATCAACCCATTTTTGGCTGAAACTAACCAACAGATGATTGAGAACATCATGAACGCTGAATA

TACTTTTGATGAAGAAGCCTTCAAAGAAATTAGCCTTGAAGCGATGGATTTTGTCGACCGGCTATTGGTGAAAGAGCGAAAATCTCGCATGACAGCATCA

GAGGCCCTGCAGCACCCATGGCTGAAGCAAAGGATCGACAGAGTCAGTACTAAAGTCATCAGAACACTGAAACACCGGCGGTACTACCACACCCTGATAA

AGAAAGACCTCAATATGGTTGTATCAGCAGCCCGGATCTCCTGTGGTGGTGCAATACGATCTCAGAGGGGAGTGAGCGTGGCTAAAGTTAAAGTTGCATC

CATTGAAATTGGTCCGGTCTCTGGGCAAATAATGCACGCCATTGGCGAAGAAGGCGGGTATGTCAAATATGTTTGCAAGATCGAAAATTATGATCAGTCT

ACCCAGGTGACCTGGTACTTTGGCGTGAGACAGCTGGAAAACAGTGAGAAATATGAAATCACCTATGAAGATGGAGTGGCCACCATGTATGTCAAAGACA

TCACCAAATTTGATGATGGGACCTACAGATGCAAAGTCGTCAATGACTACGGTGAAGATAGCTCTTACGCAGAGCTGTTCGTTAAAGGAGTGAGGGAAGT

TTATGACTACTATTGCCGCCGAACCAAGAAAGTCAAGCGCAGAACAGATGCGATGCGGCTCCTTGAAAGGCCACCAGAATTTACCCTGCCTCTCTATAAC

AAGACGGCATACGTGGGTGAAAATGTCCGTTTTGGAGTAACTATTACCGTCCACCCAGAACCTCGTGTGACGTGGTATAAATCAGGTCAGAAAATCAAGC

CAGGTGATGATGAAAAGAAATACACATTCGAGTCTGACAAGGGTCTTTATCAATTAACAATCAACAGCGTGACCACAGACGATGATGCTGAATACACCGT

TGTGGCAAGGAACAAACATGGTGAAGACAGCTGTAAAGCAAAGCTGACGGTGACTTTACATCCACCCCCGACGGAAACCACGCTCAGACCCATGTTCAAG

CGGCTGCTGGCAAATGCCGAATGCCATGAAGGCCAAAGTGTCTGCTTTGAGATCAGAGTTTCTGGCATCCCTGCACCAACATTAAAATGGGAGAAGGATG

GCCAGCCGCTGTCCCTCGGGCCCCACATTGAAATTGTCCATGAAGGCTTAGATTATTATGCACTGCATATCAGGGACACTTTGCCGGAAGACACAGGTTA

TTACAGAGTCACGGCCACAAACACGGCCGGATCCACCAGCTGCCAGGCTCACTTACAGGTAGAGCGGTTGCGCTACGTAAAGCAGGAATTCCAGAGTAAA

GAGGAACGTGAGCGCCATGTCCAAAAACAGATTGACAAGACACTGAGGATGGCTGAAATCCTTTCTGGAACTGAAACTGTGCCATTGACTCCCGTAGCCC

AAGAGGCTCTGCGAGAAGCTGCCATTCTTTACAAACCAGCAGTGAGCACCAAGACTGTCAAAGGAGAATACCGACTTCAGACGGAGGAAAAGAAAGAGGA

GAGAAAACTCCGCATGCCTTACGAAGTCCCAGAGCCCCGCAGGTTCAAACAAGCCACAGTAGAAGAAGACCAGCGCATCAAGCAGTTCGTGCCTATGTCT

GACATGAAGTGGTATAAGAAGATCCGGGATCAATATGAAATGCCTGGGAAACTTGACAGAGTTGTCCAGAAAAGGCCCAAGCGCATCCGCCTTTCAAGAT

GGGAACAGTTCTATGTGATGCCTCTTCCTCGCATTACTGACCAATACCGACCTAAATGGCGGATCCCCAAACTGACCCAAGACGATCTGGAAATGGTGAG

GCCGGCCCGACGGCGTACCCCTTCCCCAGATTATGATCTTTACTATTATAGAAGGAGGAGACGCTCTCTGGGTGACATGTCAGATGAGGAACTGCTCCTC

CCCATTGATGACTACCTGGCGATGAAGAGAACCGAGGAAGAGAGGCTGCGTCTGGAGGAGGAGCTTGAACTGGGCTTCTCGGCTTCACCTCCCAGCCGAA

GCCCCCCGAGGTTTGAGCTGTCTAGCCTGCGCTATTCTTCACCGCCAGCTCATGTCAAGGTGGAAGACAGAAGAAGAGACTTCAGGTACTCGACCTATCA

CGTCCCCACAAAGGAGGAAACCAGCACGAGTTATGCAGAGCTGCGGGAACGGCATGCCCAGGCCTCATACAGGCAGCCGAAGCTACGGCAGAGAATCATG

GCCGAGAAGGAGGAAGAGGAGCTACTGCGGCCAGTGACAACCACCCAGCGTCTCTCAGAATACAAGAGTGAGCTGGACTACATGTCAAAAGAAGAAAAGT

CTAAAAAGAAATCAAAACGACAGAGACAAGTGACAGAAATAACGGAAATCGAAGAGGAATACGAAATCTCAAGACGGGCTCAAAGGGAATCATCCTCCTC

CGTGTCCAGACTACTGAGACGCCGTCGCTCCTTGTCTCCAACTTATATTGAGTTAATGAGACCAGTGTCTGAGCTGATTCGGTCCCATCCACGACCTGCT

GAGGAATATGAAGATGATGCAGAAAGAAGGTCTCCTACTCCAGAGAGAACTCGCCCACGTTCTCCCAGCCCTGTGTCTAGCGAGCGATCCCTCTCAAGAT

TTGAGAGGTCTGCAAGATTTGACATCTTCTCCAGGTACGAGTCCATGAAAGCTGCCTTAAAAACTCAGAAGACATCGGAAAGGAAGTATGAGGTTTTGAG

TCAGCAGCCTTTCACACTGGACCATGCCCCTCGAATCACACTGCGGATGCGCTCCCACAGGGTTCCCTGTGGCCAAAACACACGCTTCATCCTAAACGTC

CAGTCGAAGCCGACTGCCGAAGTTAAATGGTACCACAATGGTGTAGAACTCCAAGAGAGCAGTAAGATTCATTACACCAACACAAGTGGGGTCCTGACCT

TGGAGATTCTGGACTGCCAGACTGAGGACGGTGGAACCTACCGTGCCGTGTGCACCAACTACAAAGGAGAGGCATCAGACTACGCAACCCTGGATGTAAC

TGGCGGAGCTTATACCACCTATGCATCCCAGCGCAGAGATGAGGAGGTCCCCAAGTCAGTCTTCCCTGAACTGACAAAAACAGAGGCATATGCAGTCTCG

TCGTTCAAGAGAACATCTGAGCTGGAAGCTGCTTCTTCAGTCAGGGAAGTGAAGTCACAAATGACAGAGACGAGGGAAAGTCTCTCAACCTATGAGCATT

ACGCCTCTGCGGAAATGAAAAGCGCCACATCAGAGGAAAAGTCACTGGAAGAAAAAGCCACGGTGAGAAAGATTAAGACAACACTGGCAGCAAGAATTTT

AACCAAGCCACGCTCCATAACTGTCCATGAAGGTGAGTCTGCGAGGTTTTCCTGCGACACTGATGGGGAGCCGGTACCAACAGTGACCTGGCTGCGTGAA

GGACAAGTGGTGAGTACTTCTGCTCGCCACCAAGTGACCACCACCAAGTACAAGTCGACCTTTGAGATTTCTTCAGTTCAGGCCTCTGATGAGGGCAACT

ACAGCGTGGTAGTTGAAAACAGCGATGGGAAGCAAGAAGCACAGTTCACCCTGACCGTGCAAAAGGCCAGGGTTATTGAAAAGGCTGTGACGTCACCACC

CAGAGTCAAGTCCCCAGAGCCTCGGGTGAAGTCCCCAGAAACAGTGAAGTCTCCCAAAAGAGTGAAATCTCCAGAACCAGTAACTTCTCATCCAAAAGCC

GTGTCACCCACAGAGACAAAGCCAACAGAGAAGGGTCAACATCTCCCAGTCTCTGCCCCACCAAAGATAACTCAGTCCCTGAAAGCAGAAGCTTCTAAAG

ACATTGCAAAGCTGACCTGTGCGGTTGAAAGTAGTGCACTGTGTGCAAAAGAGGTCGCCTGGTATAAAGATGGCAAGAAACTCAAGGAAAATGGGCATTT

TCAATTTCATTACTCAGCAGATGGGACCTACGAACTCAAAATTCACAACCTTAGCGAATCTGATTGCGGAGAGTATGTTTGTGAGGTCTCTGGTGAAGGA

GGAACTTCCAAAACCAGCTTCCAGTTTACTGGACAATCCTTCAAGAGTATCCATGAGCAGGTGTCAAGCATATCAGAAACTACAAAATCGGTTCAGAAAA

CTGCTGAGTCAGCAGAAGCCAAGAAATCC GAACCAATAGCTCCTGAATCAATTTCCTCAAAGCCAGTAATTGTTACTGGGCTGCGGGATACAACAGTTT

CTTCAGACAGTGTTGCTAAATTTACAATTAAAGTTACTGGAGAGCCCCAGCCAACTATCACCTGGACAAAGGATGGAAAG GCTATTGCACAAGGCAGTA

AATACAAACTCTCTAGCAACAAAGAAGAATTCATCTTAGAAATCCTCAAGACCGAGACATCTGATGGCGGACTTTACGCCTGTACAGTAACAAATTCTGC

TGGATCTGTGTCCTCGAGCTGCAAGCTGACAATAAAAG CTGTAAAAGACACCGAGGCACAGAAAGTATCTACCCAGAAGACCTCCGAAGTCACATCTCA

GAAGAAAGCGAGTGCCCAAGAGGAAATTTCTCAAAAAGCCCTAACTTCTGAAGAAATCAAAATGTCAGAAGTAAAATCTCATGAAACGCTGGCCATCAAG

GAGGAAGCGTCCAAAGTTCTGATTGCTGAGGAGGTCAAGAGGTCAGCAGCAGCCTCCCTGGAGAAATCCATCGTCCATGAAGAAGTCACCAAAACCTCAC

AGGCATCCGAAGAAGTCAAAACTCACGCGGAGATCAAAACACTGTCTACCCAGATGAACATAACCAAGGGCCAGCGAGCGACCCTGAAAGCCAACATTGC

TGGGGCCACAGATGTGAAATGGGTCCTGAACGGCACTGAGCTTCCGAACTCAGAGGAATACAGATACGGGGTATCTGGCAGTGACCAAACTCTCACCATC

AAACAAGCCAGTCACAGAGAGGAAGGGATCCTCAGCTGCATAGGCAAAACCAGCCAGGGAGTTGTCAAGTGTCAGTTTGACTTGACCCTGAGTGAAGAAC

TCTCGGATGCTCCAAGCTTCATCACACAGCCCAGATCTCAAAACATTAACGAGGGACAAAATGTTCTCTTTTCTTGTGAGGTCAGCGGGGAGCCGTCCCC

TGAAATTGAGTGGTTTAAAAATAACCTTCCA ATTTCCATTTCTTCAAATATCAGTGTGAGTCGCTCCAGAAACGTGTACACTCTTGAAATCCGAAATGC

GGCTGTAAGTGACAGCGGAAAGTACACAATTAAGGCTAAGAATTTCCACGGCCAGTGCTCTGCAACAGCGTCCCTCACAGTGCTCC CTCTGGTGGAAGA

ACCACCGAGAGAGGTGGTATTGAAAACGAGCAGTGACGTGAGCTTGCACGGAAGCGTCTCGTCTCAGTCAGTCCAAATGTCTGCCTCTAAGCAGGAGGCA

TCCTTCAGCAGCTTCAGCAGCAGCAGCGCTAGCAGCATGACTGAAATGAAGTTTGCGAGCATGTCTGCCCAAAGCATGTCTTCCATGCAAGAGTCCTTTG

TAGAAATGAGTTCCAGCAGTTTTATGGGAAAATCTAGCATGACACAACTGGAAAGCTCAACCAGTAGAATGCTCAAAGCAGGCGGAAGAG GAATTCCAC

CTAAAATTGAAGCTCTTCCCTCTGATATCAGCATCGACGAAGGCAAAGTCCTAACAGTAGCCTGTGCCTTTACTGGGGAGCCTACTCCAGAAATAACATG

GTCCTGTGGTGGAAGGAAAATCCAAAACCAAGAACAACAAGGAAGATTCCACATTGAAAACACAGATGACCTGACCACCCTGATCATCATGGACGTACAG

AAACAAGATGGCGGACTTTATACCCTAAGCTTAGGGAATGAATTTGGATCTGACTCTGCCACTGTGAATATTAATATCCGTTCTATGTAAGAGGGCCAGG

GCCAAGAGCGGGGGCCCTTTACACTCGATGCTCATTCATAATCTCTCTCAAATGATTCACATGAACTAATCTTTCTGACCTGTAAATATTTTTAAGTAGT

TTTATATCCATCTGAATGAGTCACAGTTCCAAAACTATGCATTTCAATCCTTTCATACTTGACCTGAGAATATTTGCTAATGACACACATGTACATACTG

TATATAGCCGGGTTCACGGTTATAAAGTTTTGTACCATTTTATTTTATGACATTTTACACTGTAACTTTTGAAACTAACTGTTGGTGGGAGAAAGTTTCT

TATAGATTATAGAACGAATACCCTGCCAATACTTAATCAATCTTTGTGCCTCAACATACTGTTGATGTCTAAGTATGCCTCAGTGGGTTGAGAAATTCCC

CACTGAAGATGTCCTATCCACCTAAAAAAAAAAGGATGCTTCTGTACATGTCCCTGACATGTGCACTGACACCTATTGAATCAGAAATGTAAGGCATTGG

TGATGTTTGCATCTACCCTCCTGTAAGCAACACTTTAACGTCTTACGTTTTCTCTGATGATGTCACACTGAAAATTATCATGACAAATATAACCAGAGCA

AAGTGTAACGGCCATACACTTTGTTCGCCCACTTCACACTGTCTCTGGCATACAGAGTGCATGGATAGCTTGGGAAATGTACCATCTCCTGGCCATCCCC

TCGTCTAACCAAGCTATGCAAGTATTCCTATGCCAGAGCGGTGTCGACTCCTGGAGGTCCCAGGTGCAGCTCCTGCCTTGTGTGGTAGTTCTAAATTCAA

ATTTCACCGGGAACTGGGCAACTAAGCAATGAGCCACAGCAAAATAATAATAATAATAATTTAAAAAAATGTAACAAGTGAAGCTGTCGTTAAAACAACA

ATACTACCAACTGCCCATAAAAAAAAAAATTACTAATTTGATGTAGTCCTTTTCATGCCAGTATATGTTCAATTGGTAGTTATAAATGTTGGACCTCCTT

GAGATTAAAAAAAAATAAAGCAAGCTATCTGCACCTC
Translation
 MTTQAPMFTQPLQSVVVLEGSTATFEAHVSG GSPVPEVSWFRDGQVISTSTLPGVQISFSDGRARLMIPAVTKANSGRYSLRATNGSGQATSTAELLV

TA AETAPPNFSQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELVVQG

 GEEVVPAKKTKTIVSTAQISETRQTRIEK KIEAHFDARSIATVEMVIDGATGQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPV

RHVRAPTPSPVR RSVSPAGRISTSPIRSVKSPLLIRKTQTTTMATGPEVPPPWKQEGYVASSTEAEMRETTMTSSTQIRREERWEGRYGVQEQVTISGA

AAAAASASVSSSFTAGAITTGTKE VKQETDKSAAVATVVAAVDMARVREPAISAVEQTAQRTTTTAVHIQPAQEQ ARKEAEKTAVTKVVVAADKAKEQ

ELKSRTREVMVTTQEQTHISHEQ IRKETEKAFVPKVVISATKAKEQETRITGEITTKQEQKRITQET MMKETRKTVVPKVIVATPKIKEQDLVSRSRE

AITTKRDQVQITQEK KRKEVETTALSTIAVATAKAKEQETVLRSREAMATRQEHIQVTHGQ VGVGKKAEAVATVVAAVDQARVREPREPTHVEESHSQ

QTTLEYGYKEHISTTKVPEQPRRPASEPHVVPQAVKPAVIQAPSETHIKTTDQMGMHISSQ VKKTTDISTERLVHVDKRPRTASPHFTVSKISVPKTEH

GYE ASIAGSAIATLQKELSATSSTQKITKSVKAPTVKPGETRVRAEPTPSPQFPFADMPPPDTYKSQAGIEVKKEVGVSISGSTVREEHFEVLRGREAK

 VTETARVPAPAEVPVTPPTLVS GLKNVTVIEGESVTLECHISGYPSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGT

VSTSCYLAVQV VSEEFDKETTLTEKFATEEKR RFVESRDVVMTDTSITEEQAGPGEPAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSGV

PLTTGYR RYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEA ADYEALVKTQQEMLYQTQMSTFIQEPKVGEIAPGFAYSEYEK

EYEKEQALIRKKMAKDTVMVRTFVEDQ EFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAIESGFDIRIKNYRILEGMGVTFHCKMS

GYPLPK IAWYKDGKRIRHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPFSAPTYMPTPEAVSRIR RSVSPRSLSR

SPIRMSPAMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPASFKCLEGQTARFDLKVVGRPMPETFWFHNG GQQIVNDYTHKVV

IKEDGTQSLIIVPASPSDSGEWTVVAQNRAGKSTISVTLTVEA AVEHQIKPAFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRI

R RIEGTRGEAALKIDSIISQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQK

PFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSATLIVKDEKSLVE

ESQLPDGKKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDC

KSYDTGEVKVTAENPEGVTEHKVKLEIQQREDFRSVLRRAPEPKPEFHVHEPGKLQFEVQKVDRPVDTSETKEVVKLKRAERITHEKVSEESEELRSKFK

RRTEEGYYEAITAVELKSRKKDESYEELLKKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPERIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVV

GKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQA AKQLITFTQELQDVVAKEKDTMATFECETSE

PFIKVKWYKDGIEVHAGDKYRMHSDRKVHFLSVLTIDTSDAEDYSCVLVEDENIKTTAKLIVEG GAVVEFVKELQDIEVPESYSGELECIISPENIEGK

WYHNDVELKSNGKYSITSRRGRQNLTVKDVTKEDQGEYSFVVDGKKTTCKLKMKP PRPIAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWMKDGQEVQ

HSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGNVSVYS SVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQSI

VKGTKQRLVINRTHASDEGPYKLMVGRVETSCNLSVEK KIKIIRGLRDLTCTETQNVVFEVELSHSGIDVVWNFKGKEIKPSSKYKIEAHGKIYKLTVL

NMMKDDEGEYAFYAGENTTSGKLTVAG GGAISTPLTDQTVAESQEAVFECEVANPESEGEWLKDGKHLALSNNFRGESDGHKRRLVIAAAKLDDAGEYT

YKVATSKTSAKLKVEA AVKIKKTLRNLTVTETQDAVFSVELTHPDVKGVQWIKNGVVLDSNDKYEISVKGTLYSLKIKNCAMADESVYGFKLGRLGASA

RLHVET TVKIIKKPKDVTALENATVTFEVSVSHDTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQSISPSDAGEYTAMVGQLECKAKLFVET TLHI

TKTMKSIEVPETKAASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTP PIMITSMLKDINAEE

KDTITFEVTVNYEGISYKWLKNGVEIKSTDRCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEA ARHIEFRKHIKDIKVLEKKRAMFECE

VSEPDITVQWMKDGQELQIADR RIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNMSTANLFVEGRDVRIRSIKKEVQ VIEKQRAVVEFEVNEDDVDA

HWYKDGIEINFQVQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSVTLYVNA APEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKE

EQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEV VPEVVSPDQEMPVYPPAIVTPLQDTVTSEGRPARFQCQVSGTD 

DLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYAFVANNAVGQVSSTATLRLEA APESILHERIGQQIEMEMKE EIASLLSAEEDFQT

YSSDLRLPNANETLELLSEPPARSTQFDSRQEGAAPVFIREISDVEISVEDVAKLSVTVTGCPKPKIQWFFNGMLLTPSADYKFVFDGDTHSLIILFTRF

QDEGEYTCLASNEYGKAVCSAHLRISPRGERSTEMESGEKKALEKPKGPCPPYFFKELKPVHCGPGIPAVFEYSVHGEPAPTVLWFKEDMPLYTSVCYTI

IHSPDGSGTFIVNDPQRGDSGLYLCKAQNLWGESTCAAELLVLPEDTDVPDASCKEESTLGVPGDFLETSARGPLVQGVDSRQEITAFAEGTISKAALIA

EETLQLSYERSVDDSEVGTGVTIGAQKLPPVVLSTPQGTGELPSIDGAVHTQPGRGPPPTLNLQAVQAQTTLPKEATLQFEEPEGVFPGASSAAQVSPVT

IKPLITLTAEPKGNYPQSSTAAPDHALLSSVAAETLQLGEKKIPEVDKAQRALLLSQSLAEGCVESLEVPDVAVSNMRSEPQVPFQHTCTEGKILMASAD

TLKSTGQDVALRTEEGKSLSFPLALEEKQVLLKEEQSEVVAVPTSQTSKSEKEPEAIKGVKEVREQELLSKETLFPSMPEEQRLHLKTQVRRALQAAVAR

EQANLFSEWLRNIDKVEVTAVNFTQEPKRILCTYLITSVSSLTEELTVTIEDIDPQMANLETGLKDALCSIVCEERNILMAEDPRIHEEDKIDVQGGRDH

LSDAQKVETVIEAEADSKYLVSKEEVSWSKVESQLKDGDTNEVPQAETLKLAEESGTQKTSTEMSQEEAEGTLADLCPAVLKHLVDTISEEGDTVHLTSS

ISNAKEVHWYFKGNLVPSDGKFKCLKEQNAYTLVIEAVKTEDEGEYVCEASNDSGKAKTSAKLTVGERA AAPVIKRRIEPLEVALGHLAKFTCEIQGAP

NVRFQWFKAGREIYESDKCSIRSSNYVSSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTV - UNI36362 - VPTAEKKVRKLLPEPKPQPKEE

VVLKSV - UNI36362 - VLRKKPEEEEPKVEPKKVEKAKKPEE EPQPPPKAVEVEAPPEPTPKERKVPEPAKV - UNI17655 - VPEIKPAIP

LPGPEPKPKPEPE - UNI17655 - EVKTMKAPPIEPAPTPIAAPVTAPVVGKKAE EAKPKDEAAKPKGPIKG GVAKKTPSPIEAERKKLRPGSGG

EKPPDEAPFTYQLKAVPLKFVKEIKDIVLTEAESVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNK

EKTSTAKLIVEE ELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECS

SCVKVVE EIIREWLVKPIRDQHVKPKGTAVFTCDIAKDTPNIKWFKGYDEIPLEPNDKTEILKEGNHLFLKVKNAMPEDIDEYAVEIEGKRYPAKLTLG

E EREVELLKPIEDVTIYEKESASFDAEISEEDIPGEWKLKGELLRPSP TCEIKAEGGKRFLTLHKVKLDQAGEVLYQACNAITTAILTVKE EIELDF

AVPLKDVTVPEKRQARFECVLTREANVIWSKGPDIIKASDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSAQLFVTG GIRLKFISPLEDQTVK

EGQTATFVCELSHEKMHVVWFKNDVKLHTTRTVLMSSEGKTYKLEIRETTLDDISQIKAQVKNLSSTANLKVLE EADPYFTVKLHDKTGVEKDEIILKC

EVSKDVPVKWFKDGEEIVPSPKHSVKTDGLRRILKIKKAELKDKGEYVCDCGTDTTKANVTVEA ARLIKVEKPLYGVEVFVGETARFEIELSEPDVHGQ

WKLKGEPLTASP DCEIIEDGKKHVLVLYNCQLDMTGEISFQAANAKSAANLKVKE ELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEI

TGDDRFELIKDGTRHSLVIKSAAFEDEAKYMFEAEDKRTSGKLIIEG - UNI35827 - GIRLKFLTPLKDVTAKERENAVFTVELSHDNIPVSWFKN

DQRLHTSKRVSMHDEGKTHSITFKDLSIDDTSQIRVEAMGISSEAKLTVLE - UNI35827 - - UNI35899 - EGDPYFTGKLQDYTGVEKDEVI

LQCEISKADAPVKWFKDGKEIKPSKNVVIKADGKKRMLILKKALKSDIGQYTCDCGTDQTSGKLDIED - UNI32138 - - UNI35827 - - UNI

35899 - DREIKLVRPLYSVEVMETETARFETEISEDDIHANWKLKGEALLQTP - UNI32138 - - UNI33036 - - UNI35899 - ECEIK

EEGKIHVLILHNCRLDQTGGVDFQAANVKSSAHLRVKP - UNI32138 - - UNI32541 - - UNI33036 - PRVIGLLRPLKDVTVTAGETAT

FDCELSYEDIPVEWYLKGKKLEPNDK - UNI14991 - - UNI16643 - - UNI32541 - - UNI33036 - VVTRSEGRVHTLTLRDVKLED

AGEVQLTAKDFKTQANLFVKE - UNI14991 - - UNI16643 - - UNI32541 - EPPVEFTKPLEDQTVEEEATAVLECEVSRENAKVKWFKN

GTEILKSKKYEIVADGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVP - UNI14991 - PPHVEFLRPLTDLQVKEKETARFECEISKENEK V

QWFKDGAEIKKGKKYDIISKGAVRILVINKCLLNDEAEYSCEVRTARTSGMLTVLE EEEAVFTKNLANLEVSEGDTIKLVCEVSKPGAEVIWYKGDEEI

IETGRFEILTDGRKRILIIQNAQLEDAGSYNCRLPSSRTDSKVKVHE ELAAEFISKPQNLEILEGEKAEFVCTISKESFEVQWKRDDQTLESGDKYDII

ADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIE EKLRIIVPLKDTKVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRI

RDARLDDQANFNVSLTNHRGENVKSAANLIVEE EEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVAFDNRISYRIDKYKHSLIIKDCG

FPDEGEYVVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKK KYKFEKDGSIHRLIIKDCRLEDECEYAC

GVEDRKSRARLFVEE EIPVEIIRPPQDILEAPGADVIFLAELNKDKVEVQWLRNNMIVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARA

KLELAA AAPKIKTADQDLVVDAGQPLTMVVPYDAYPKAEAEWFKENEPLSTKTVDTTAEQTSFRISEAKKDDKGRYKIVLQNKHGKAEGFINLQVID D

VPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLVTDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDSPVEARSKY

D DVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVA

DPIE ERPSPPVNLNASEQTQSSVQLTWEPPLKDGGSPILGYIIERREEGKDNWIRCNMKPVPELTYK VTGLQKGNKYLYRVSAENAAGVSDPSEILGP

LTADDAFV VEPTMDLSAFKDGLEVIVPNPIKILVPSTGYPRPKATWTFGDQVLEEGDRVKMKTISAYAELVISPSERTDKGIYTLTLENPVKSISGEIN

VNVIA APPSAPKELKFSDITKDSVHLTWEPPDDDGGSPLTGYVVEKRDMSRKTWTK VMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYTDEP

VNMSAPAT TVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVEKCPRGSDKWVACGEPVPDTK KMEVTGLEEGKWYAYRVKALNRQGASKPSK

PTEEIQAVDTQE EAPEIFLDVKLLAGITVKAGTKIELPATVTGKPEPKITWTKADTLLKPDQRITIENVPKKSTVTITDSKRSDTGTYIIEAVNVCGRA

TAVVEVNVLD DKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERKATDSDVWHKLSSTVKDTNFKATKLTPNKEYIFRVAAENMYGVGEPVQ

AAPIIAKYQFD DPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYR RVKGLTNKKKYRFRVLAENLAGPG

KPSRSTEPILIKDPID DPPWPPGKPTVKDIGKTSLVLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTTEHLLTGLMEGQEYSFRVRAVNKAG

ESEPSEPSDPVLCREKLY YPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENA

IGQSDYTEIGDSVLAKDTFT TTPGPPYALTVVDVTKRHVDLKWEPPKNDGGRPIQR RYIIEKKEKLGTRWVKAGKTSGPDCNFRVTDVIEGTEVQFQV

RAENEAGVGHPSEPTEILSIEDPTS SPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGIVPDKEY

VLRVRAVNAVGVSEPSEISENVVAKDPDC CKPTIDLETHDIVVIEGEKLNIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVHADA

GVYTITLENKLGSATASINVKVIG GLPGPCKDIKASDITKSSCKLTWEPPEFDGGSPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFR

VKAVNKIGGGEYIELKNPVIAQDPKQ QPPDPPVDVEVHNPTAKAMTITWKPPLYDGGSKIMGYIIEKITKGEDRWKRCNEHLVPVLTYTAKGLEEGKEY

QFRVRAENAAGIGEPSRATPPTKAVDPID DAPKVILRTSLEVKRGDEIALDATISGSPYPTITWIKDENVIVPEEIKKRAAPPVRRKKGEAEEEEPFSL

PLTERLSINNSKQGESQLRIRDSLRPDHGQYMIKVENDHGVAKAPCSVSVLD DTPGPPINFVFEDIRKDSVLCKWEPPLDDGGSEIINYTLEKKDKTKP

DSDWIVITSTLRNCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLLAKDPFE EPPDAPDKPIVEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVN

STHWSRVNKTLLSSLKTKVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTARDPIS SPPGPPVPRVADTSSTTIELEWEPPAFNGGGEIMGYFVDKQL

VGTNEWSRCTEKMIKVRQFTVKEIREGADYKLRVSAVNAAGEGPPGETEPVTVAEPQA AEPPTVELDVSVKGGIQIMAGKTLRIPAEVTGRPVPTKVWT

IEEGELDKERVIIENVGTKSELIIKNALRKDHGRYVITATNSCGSKFAAVRVEVFD DVPGPVLDLKPVVTNRKMCLLNWSDPADDGGSDITGFIIERKD

AKMHTWRQPIETERSKCDITGLIEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLG GPPTSPERLTYTERTKSTITLDWKEPRSDGGSPIQGYIIEKRR

HDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNDVGESEPSLPLNVVIQDDEV VPPTIKLRLAVRGDTIKVKAGEPVNIPADVTGLPMPKIEWS

KNEKVIDKPTDTLNITKEEVSRSEAKTELSIPKAAREDKGTYTITASNRLGSVFRNVHVEVYD DRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITH

YIIDKRDASRKKSEWEEVTNTAVERRYG IWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLERTKGSMLVSWTPPLDNGGSPI

TGYWLEKREEGGTYWSRVSRAPITKVGLKGVEFNVPRLIEGVKYQFRAMAINAAGIGPPSEPSDPAVAGDPIY YPPGPPSCPEVKDKTKSSISLAWKPP

AKDGGSPIKGYIVEMQEEGTTDWKPVNEPDKLLTACECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQE EVPEVFIDIGAQDCLVCKAGS

QVKIPAVIKGRPTPKSSWEFDGKAKKAMK DGVHDIPEDAQ LETAENSSVIIIPECTRAHSGKYSITAKNKAGQKTANCRVKVMD DAPGPPKDLKVSD

ITRGSCRLSWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNCGSTTFVVPDLISEQQYFFRVRAENRFGIGPPAETIQRTTARDPIY YPPDPPIKLKI

GLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGKKKEAWRQCNRRDVEELEFTVEDLIEGGEYEFRVKAVNEAGVSKPSATVGPVIVKDQTC CPP

AIELKEFMEVEEGTDVNIVAKIKGVPFPTLTWFKAPPKKPDSKEPVVYDTHVNKQVVDDTCTLVIPQSRRSDTGLYSITAVNNLGTASKEMRLNVLG GR

PGPPVGPIKFESISADQMTLSWLPPKDDGGSKITNYVIEKREANRKTWVRVSSEPKECMYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFS 

SVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPVT

ARDPVA APPGPPFPKVTDWTKSSVDLEWSPPLKDGGSKITGYIVEYKEEGKEEWEK GKDKEVRGTKLVVTGLKEGAFYKFRVRAVNVAGVGEPGEVTD

VIEMKDRIV VSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWSMNERALPQEAAIETTAISSSMVIKNCQRSHQGVYSLLAKNEGGERKKTII

VDVLD DVPGPVGIPFLSDNLTNDSCKLTWFSPEDDGGSPITNYVIQKREADRRAWTPVTYTVTRQNATVQGLIQGKSYFFRIAAENSIGMGPFVETPNA

LVIRDPIT TVPERPEDLEVKEVTKNTVSLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFC

TKPITCKDELA APPTLDLDFRDKLTVRVGESFALTGRYSGKPKPKIDWFKDEADVLEDDRTHIKTTPTTLALEKTKAKRSDSGKYCVVVENSTGSRKGF

CQVNVVD DRPGPPVGPVIFDEVTKEYMVISWKPPLDDGGSEITNYIIEKKELGKDIWMPVTSASAKTTCKVPKLLEGKDYIFRIHAENLYGISDPLVSD

SMKAKDRFR RVPDAPEQPVVTEVTKDSALVTWNKPNDGGKPITNYILEKRETMSKRWVRVTKEPIHPYTKYRVPDLLEGCQYEFRVSAENEIGIGDPSP

PSKPVFARDPIA AKPSPPINPEAIDTTCNSVELTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQSYKFRVLAVNEAGE

SDPAHVPEPVLVKDRLE EPPELILDANMAREQHIRVGDTLRLSAIIKGVPFPKVTWKKEDREAPTKAQIDVTPVGSKLEIRNAAHEDGGIYSLTVENPA

GTKTVSVKVLVLD DKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVVTNYVVERKDVATAQWSPLSTTSKKKSHMAKHLTEGNQYLFRVAAENQYGRGP

FVETPKPIKALDPLH HPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGDKDWIKFKTVKNLDCVVTGLQQGKTYRFRVKAENIIGLG

LPDTTIPIECQEKLV VPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGTEIKTDDHYTVETDSFSSVLTIKNCLRKDTGEYQLTVSNAA

GTKTVAVHLTVLDVPGPPTGPINILDVTPEYMTISWQPPKDDGGSPVINYIVEKQDTRKGTWGVVSAGSSKLKLKVPHLQKGCEYVFRVKAENKMGVGPP

LDSIPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYVERREITGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSNPS

PSSDPIKACRPIKPPGPPINPKLKDKSKESADLVWTKPLSDGGSPILGYVVEYQKPGTAQWDRINKDELIRQCAFRVPGLIEGNEYRFRIRAANIVGEGE

PRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWSKEGKVLVKDKRVDLIHDLPRVELQIKEAVRADHGKYIISAKNSSGH

AQGSAIVNVLDRPGPCQNLKVSNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLVKANLLANNEYYFRVCAENKVGVGPTIETK

TPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSADWERVHKGSIKETHYMVDKCVENQIYEFRVQTKNEGGESDWVRT

EEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTSAESSKFSLTKAKRSDGGKYVITATNPAGSFVAYA

TVNVLDKPGPVRNLKITDVSSDRCTIRWDPPEDDGGCEIQNYILEKCESKRMVWSTYSANVLTPSATVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIA

KTKYDRPGRPDPPEVTKVSKEEMTVVWNAPEYDGGKSITGYYLEKKEKHAVRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPSLPSRPVV

AKDPIE EPPGPPTNFKVVDTTKSSITLAWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLIRMEFTVTSLDENQEYEFRVCAQNQVGIGR

PAELKEAIKPKEILE EPPEIDLDASMRKLVVVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAG

EKAVFVNVKVLD DTPGPVADLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREAERKTWSTVTPEVKKTSFNVTNLVPGNEYFFRVTAVNEYGPGVP

TDIPKPVLASDPLS SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYIISYREEDQPADRWTEYSVVKDLSLIVTGLKEGKKYKFRVAARNAVGV

SMPREAEGVYEAKEQLL LPPKILMPEQITIKAGKKLRVEAHVYGKPNPICKWKKGDDEVVTSSHLAIHKADGSSVLIIKDVTRKDSGYYSLTAENSSGS

DTQKIKVTVMD DAPGPPQPPFDISEIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEP

LTSPKMLAKFPFD DVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKERNSLLWVKANDTIVRSTEYPCAGLVEGLEYSFRIYALNKAGSS

PPSKPTEYVTARMPVD DPPGKPEVVDVTKNSASLIWARPKHDGGSRIIGYFVEACKLPGDKWVRCNTTPHQIPQEEYTATGLEENAQYQFRAIAKTAVN

ISQPSEPSDPVTILAENV VPPRIELSVEMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDTTPIKQAEGIKMAMKRNLCTLELFSVNRKDSGDYTITAE

NSSGSKSATIKLKVLD DKPGPPASVKINKMYADRAMLSWEPPLEDGGSEITNYIIDKRETSRPNWAQVSATVPITSCTVEKLIEGHEYQFRICAENKYG

VGDPILTEPAIAKNPYD DPPGRCDPPVISNITKDHMTVSWKAPADDGGSPITGYLVEKRETQAVNWTKVNRKPVIERTLKATGLQEGTEYEFRVTAINK

AGPGKPSDASKAVYAQDPLY YPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDHWVRCNLPEKLQKTRFEVTGLMENTEYQFRVY

AVNKIGYSDPSDVPDKHCPKDILI IPPEGELDAELRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCENVNKYDAGK

YILTLENSCGKKEYTIVVKVLD DTPGPPVNVTVKEVSKDSAYVTWDPPIIDGGSPIINYVVEKRDAERKSWSTVTTECSKTSFRVSNLEEGKSYFFRVF

AENEYGIGDPGETRDAVKASE ETPGPVVDLKALAITKSSCTIGWKKPRSDGGSRITGYVVDFLTEENKWQRVMKSLSLQYSTKDLKEGKEYTFRVSAEN

ENGEGTPSEIVVVAKDDVV VAPDLDLKDLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESTAVNTTLVVYDCQKSDAGKYTITL

KNVAGTKEGTLSIKVVGKPGIPTGPIKFDEVTAEAMTLKWGPPKDDGGSEITNYVLEKRDSVNNKWVTCASAVQKTTFRVTRLHEGIEYTFRVSAENKYG

VGEGLKSEPIVAKHPFD DVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITG GYHIEFKERNSLLWKRANKTPIRMKDFKVTGLTEGLEYEFRVMAI

NLAGVGKPSLPSEPVVALDPID DPPGKPEVISVTRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPDCAFTVTDLVEGGKYEFRIRAK

NTAGAISAPSESTGTIICKDEYE EAPTIVLDPTIKDGLTVKAGDSIVLSAISILGKPLPKSSWSRAGKDIRPSDIAQITSTPTSSMLTVKYATRKDAGE

YTITATNPFGTKEEHVKVSVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKAYVLEKRETSRLLWTVVSEDIQACRHVVTKLIQGNEYLFRVSAV

NHYGKGEPVQSEPVKMVDRFG GPPGPPGKPEISNVTKNTATVSWKRPTDDGGSEITGYHVERREKKGLRWVRATKTPVSDLRCKVTGLQEGNTYEFRVS

AENRAGIGPPSDASNPVLMKDVAY YPPGPPSNAHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDDAWIKDTTGTALRITQFVVPDLQTKEKYN

FRISAINDAGVGEPAVIPNVEIVEKEVAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKHRANIENTESFTLLIIPECNRYDTGKF

VMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTVTTKCHKCTYKVTGLTEGCEYFFRVMAEN

EYGVGEPTETTEPVRASEAPLPPDSLNIMDITKNTVSLAWPKPRHDGGSKITGYVIEAQRKGSDQWTHISTVKGLECVVRNLTEGEEYTFQVMAVNSAGR

SAPRESRPVIVKEQTMLPELDLRGIYQKLVIARAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNVENTATSTILNINECVRSDSGPYPLTAKNTVG

EVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWEPPENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGVEYQFRVRAQNRYGVGPGI

TSASVVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQTVSKALVPGNIFKSTGLTDGIAYEFRVIAENMAGKSKPS

KPSEPMFALDPIDPPGKPVPLNITRHTVALKWAKPEYTGGFKITSYVVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSE

PSDAITCRDDLEAPRIMVDVRFKDTITLKAGEAFKLEADVSGRPPPTMEWTKDGKELEGTGKLEIKIADFSTHLINKDSSRTDSGAYILTATNPGGFAKH

IFNVKVLDRPGPPEGPLAVSDVTSEKCVLSWLPPLDDGGAKIDHYIVQKRETSRLAWTNVATEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLESEP

VLAVDPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNKKALTDLRFKVSGLTEGHEYEFRIMAENAAGISAPSATSP

FYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQVVTPPAGLKATSYTITSLIENQEYKIRIYAMNSEGLGEPALV

PGTPKAEERMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWAREHGESLDKASIESTSSYTLLVVGNVNRFDSGKYILTVENSSGSKSAFVN

VRVLDTPGPPQNLKIKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKA

SERPLPPGKITLTDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDRWATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLV

IPPAFKLLFNTFTVLAGEDLKIDVPFIGRPPPAVTWHKDDIPLKQTTRVNAESTENNSLLTIKEACREDVGHYTVKLTNSAGEATETLNVIVLDKPGPPT

GPVKMDEVTADSVTLSWEPPKYDGGSSINNYIVEKRDTSTTAWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPVVAQYPFKVPGPPG

TPFVTLASKDSMEVQWHEPVSDGGSKVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGIEYEFRVSAENIVGIGKPSKPSECYAAHDPCDPPGRP

EAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPDGRWMKASFTNIIDTQFEVTGLLEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVEPPRISM

DPKYRDTVVVQAGESFKIDADIYGKPIPTTQWVKGDQELSSTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGEKSVTINVKVLDRPGPPEGPVA

ISGVTAEKCTLAWKPPLQDGGSDITNYIVERRETSRLVWTLVDANVQTLSCKVLKLLEGNEYIFRIMAVNKYGVGEPLESESLIAKNPFVVPDAPKAPEV

TAVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPK

VMDVTRSSVFLSWTKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNLEVEKLLEKHEYNFRICAINKAGVGEHADVPGPVMVEEKLEAPDIDLD

LELRKVINIRAGGSLRLFVPIKGRPTPEVKWGKVDGDIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEI

TKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPARTADPIKVAEVPQPPGKITVDDVTRN

SVSLSWTKPEHDGGSKIIQYIVEMQAKNTDKWSECARVKSLDAVITNLTQGEEYLFRVIAVNEKGRSDPRSLAVPIIAKDLVIEPDVRPAFSSYSVQVGQ

DLKIEVPISGRPKPSISWTKDGMPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVSNVVGQKTAAIEIITLDKPDPPKGPVKFDEISAESITLSWN

PPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESEPVVAQYPYKEPGPPGTPFVTAISKESMVVQWHE

PINNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKALNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEAIIVKRNEITLQWTKPV

YDGGSMITGYIVEKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRL

EADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTAEKCTLAWSPPLQ

DGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNKYIFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSD

GGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHVVDTTKNSITLAWSKPIY

DGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEIAKLIEHQEYKIRVCALNKVGLGEAASVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIH

IPFKGRPTPEITWSKEEGEFTDKVQIEKGINFTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSVLLVWEPPIIDGGA

KVKNYVIDKRESTRKAYANVSSKCNKTSFRVENLTEGAIYYFRVMAENEFGVGVPTETSDAVKASEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRIL

GYVVEMQPKGTEKWSVVAESKVCNAVVSGLSSGQEYQFRVKAYNEKGKSDPRVLGIPVIAKDLTIQPSFKLPFNTYSVQAGEDLKIEIPVIGRPRPKISW

VKDGEPLKQTTRVNVEETATSTILHIKESSKDDFGKYSVTATNSAGTATENLSVIVLEKPGPPVGPVKFDEVSADFVVISWEPPAYTGGCQISNYIVEKR

DTTTTNWQMVSATVARTTIKISKLKTGTEYQFRIFAENRYGKSTPLDSKPVVVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGSKVTGYHLEQKE

KNSILWVKLNKIPIQDTKFKTTGLDEGLEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIVITRNSVTLKWKKPVYDGGSKITGYIVEKKDLP

DGRWMKASFTNVVETEFTVTGLVEDQRYEFRVIARNAADNFSEPSESSGAITARDEIDAPNASLDPKYRDVIIVHAGETFVLEADIRGKPIPDIIWSKDG

NELEETAARMEIKSTLQKTTLIVKDCIRTDGGQYTLKLSNVGGTKTIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGASISHYIIEKRETS

RLSWTQVSNEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEALESEPVIACNPYKRPGPPSTPEASAITKDSMVLTWTRPVDDGGAEIEGYILEKRDKEG

IRWTKCNKKTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVRGYVIELKKAA

ADEWTTCTPPSGLQGKQFTVTKLKENTEYNFRICAFNTEGVGEPATIPGSVVAQERMEAPEIELDADLRKVVTLRASATLRLFVTIKGRPEPEVKWEKAE

GILTERAQIEVTSSYTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAY

ATITNNCTKNTFKIENLQEGCSYYFRVLASNEYGIGLPAETAEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSAC

TQVKTLETTISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIAKDIEIKPSVELPFNTFNVKANDQLKIDIPFKGRPQATVAWKKDGQVLRETTRVNVAS

SKTVTTLSIKEASREDVGTYELCVSNTAGSITVPITVIVLDRPGPPGPIRIDEVSCDNVSISWNPPEYDGGCQISNYIVEKRETTSTTWQVVSQAVARTS

IKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMVVSWQVPVNDGGSQVIGYHLEYKERSSILWSKANKVLIADTQ

MKVSGLDEGLMYEYRVYAENIAGIGKCSKACEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPRYDGGAKITGYIVERRELPDGRWLKCNFTNVQETYFE

VTELTEDQRYEFRVFARNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIIVKAGEVLKINADIAGRPLPVISWAKDGVEIEERAKTEIVSTDYTT

TLTVKDCVRRDTGQYVLTLKNVAGTRTMAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSRLAWTICEAELRTTSCKVT

KLLKGNEYIFRVTGVNKYGVGEPLESMAVKALDPFTTPSPPTSLEITSVTKDSMTLCWSRPETDGGSDISGYIIERREKNSLRWMRVNKKPVYDLRVKST

GLREGCEYEYRVFAENAAGLSLPSETSPLVRAEDPVFLPSPPSKPKIVDSGKTTITIGWVKPLFDGGAPITGYTVEYKKSEETDWKVAIQSFRGTEYTMS

GLTTGDEYVFRVRSLNKMGASDPSDSSDPQVAKEREEEPVFDVDSEMRKTLIVKAGSSFTMTVPFRGRPIPNVSWSKPDTDLRTRAYIDSTDSRTLLTIE

NANRNDSGKYTLTIQNVLSAASMTFVVKVLDSPGPPANITVREVTKETAMLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGA

IYYFRVSGENEFGVGVPAETKEGVKITE EKPSPPEKLGVTSVSKDSVSLSWLKPEHDGGSRIIHYVVEALEKGQKTWVKCAVVKTTHHVVSGLRESHEY

FFRVFAENQAGLSDPRELLLPVLIKDQLE EPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVT

TDAGRYEITAANSSGTTKTFINIIVLDRPGPPTGPVAISDITEESVTLKWEPPKYDGGSHVTNYIVLKRETSTAVWSEVSATVARTMIKVMKLTTGEEYQ

FRIKAENRFGISDHIDSVCVVVKLPYT TTPGPPSTPWVSNVTRESITVGWHEPVSNGGSAVTGYHLEMKDRNSILWQKANKMIIRTTHFKVTTISAGLI

YEFRVYAENAAGIGKPSHPSEPVLAIDACE EPPRNVRITDISKNSVNLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVIETQFTVSGLTQNSQ

YEFRVFARNAVGSVSNPSEVVGPITCIDSYG GGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWYKDDKELQTNALVCVENSTDLASILIKDA

NRLNSGSYELKLRNAMGSASATIRVQILD DKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVAENLEECIVTTTKIIKG

NEYVFRVRAVNKYGIGEPLESEPVVAKNAFV VTPGPPSIPEVTKITKNSMTVVWDRPTVDGGSEINGYFLERRDKKSLAWLKVLKETIRDTRQKVTGLT

ENSDYQYRVCAVNAAGVGPFSEPSDFYKAADPID DPPGPPAKIRIADSTKSSITLGWSKPVYDGGSDVTGYVVEMKQGDEEEWTIVSTRGEVRTTEYVV

SNLKPGVNYYFQVSAVNCAGQGEPITMTEPAQAKDVLE EEPEIDLDVALRTSVIAKAGEDVQLLIPFKGRPPPTVTWRKDEKNLGSDTRYSIQNTDSSS

LLVIPQVTRNDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQKLQVKHVSLGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSGTSFKVT

DLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVVLSWTKPDFDGGSIITDYLVERKGKGEQAWSHAGISKTCEIEIGQLKE

QSVLEFRVSARNEKGQSDPVTIGPLTVKELVITPEVDLSEIPGAQISVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEYVRFSKTENKITLSIKNSK

KEHGGKYTVILDNAVCRNSFPITIITLGPPSKPKGPIRFDEIKADSAIMSWDIPEDDGGGEITCYSIEKREASQTNWKMVCSSVARTTFKVSNLVKDSEY

QFRVRAENRYGVSEPLASNIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQRVNTSPISGREYRATGLIEGLDY

QFRVYAENSAGLSSPSDPSKFTLAVSPVD DPPGTPDYIDVTRETITLKWNPPLRDGGSKIVAYSIEKRQGSDRWVRCNFTDVSECQYTVTGLSPGDRYE

FRIIARNAVGTISPPSQSSGLIMTRDENV VPPTVEFGPEYFDGLVIKSGDSLRIKALVQGRPVPRVTWFKDGVEIERRMNMEITDVLGSTSLFVRDATR

DHRGVYTVEAKNVSGSTKAEVTVKVQD DTPGKVVGPIRFTNITGEKMTLWWEAPLNDGCAPVTHYIIEKRETSRLAWALIEDNCEALSYTAIKLITGNE

YQFRISAVNKFGVGRPLESDPVVAQIQYT TIPDAPGVPEPSNVTGNSITLTWTRPESDGGSEIQHYILERREKKSTRWVKVISKRPISETRFKVTGLVE

GNEYEFHVMAENAAGIGPASGISRLIKCREPVNPPSAPSVVKVTDTSKTTVSLEWARPVFDGGMEIIGYIIEMCKADLGDWHKVNTEPCVKTRYTVTDLQ

AGEEYKFRVSAVNGAGKGDSCEVTGTIKAVDRLSAPELDIDANFKQTHIVRAGVSIRLFIAYQGRPTPTAVWSKPDSNLSIRADIHTTDSFSTLTVENCN

RNDAGKYTLTVENNSGKKSITFTVKVLDSPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVIEKREASRRSWQVVSEKCTRQILKVSELTEGVPYY

FRVSAENEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITSYLLEMRQKGSDFWVEAGHTKQLTFTVERLVENTEYEFRVK

AKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPISGRPAPKVTWKLEEMRLKETDRMSIATTKDRTTLTVKDSMRGDSGRYF

LTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSVSAESCVLSWTEPKDDGGTEITNYIVEKRESGTTAWQLINSSVKRTQIKVTHLTKYKEYCFRVSSEN

RFGVSKPLESVPIVAEHPFV VPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKIVGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYA

LNAAGVSKASEASRPIMAQNPVD DPPGRPEVTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFR

VLAKNAAGVISKGSESTGPVTCRDEYA APPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKISLQYTGKRATAVIKYCDRS

DSGKYTLTVKNASGTKSVSVMVKVLD DSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECLTASYVVTRLIKNNEYT

FRVRAVNKYGLGVPVESEPIVARNSFT TIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGC

DYQFRVTAVNAAGNSEPSEASNFISCREPSY YTPGPPSAPRVVDTTKRSISLAWTKPMYDGGTDIIGYVLEMQEKDTDQWCRVHTNATIRNNEFTVPDL

KMGQKYSFRVAAVNAKGMSDYSETTAEIEPVERLE EIPDLELADDLKKTVIVRAGASLRLMVSVSGRPSPVITWSKKGIDLANRAIIDNTESYSLLIVD

KVNRYDAGKYTIEAENQSGKKSATVLVKVYD DTPGPCPSVSVKEVSRDSVTITWEIPTIDGGAPVNNYIIEKREAAMRAFKTVTTKCSKTLYRISGLVE

GTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVISLNEGE

QYLFRVRAQNEKGVSEPREIVTPVTVQDLRV VLPTIDLSTMPQKTIHVPAGRPIELVIPITGRPPPTASWFFAGSKLRESERVTVETHTKVTKLTIRET

TIRDTGEYTLELKNVTGTTSETIKVIILD DKPGPPTGPIKIDEIDATSVTISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRPTFKFTRLTEG

NEYVFRVAATNRFGIGSYLQSEVIECRSSIS SIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLI

EGLEYEHRVTAINARGTGKPSRPSKPTVAMDPIA APPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQREWTKCNTTPTKIREYTLT

HLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLE EYPDYELDERYQEGVFVRQGGVIRLTIPIKGKPFPVCKWTKEGQDISKRAMIATSETHTELV

IKEADRNDSGTYDLVLENKCGKKTVYIKVKVIGSPNTPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLK

ENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLN NPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTV

TGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFD DKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDRQ

FTIGGLLEATEYEFRVFAENETGLSRPRRTAMSVKTKLTS SGEAPGVRKEMADVTTK         
Transcript ENSMUST00000070199
Sequence
AAAGTGCCTGAGATTCCCAAGAAGCCAGAGGAAAAAGTTCCTGTGCCTATTCCTAAAAAGGAGAAGGCTCCACCTGCCAAAG TCCCGGAAGTGCCCAAG

AAGCCTGTACCAGAGGAGAAGCCACCAGTACCTGTTCCCAAAAAGGTGGAACCACCACCAGCCAAAG TGCCAGAAGTGCCGAAGAAACCTGTGCCTGAG

AAGAAGGTACCAGCGCCTACTCCTAAGAAAGTAGAGGCTCCTCCTGCAAAAG TGCCAGAGGTGCCCAAGAAACCCATTCCAGAAGAAAAGAAACCAACA

GCTCTTCTGAAAAAAATGGAAGCCCCACCCCCGAAAG CGCCAAAGAAACGGGAGGTAGTCCCAGTTCCTGTGGCTCTACCTCGGGAAGAAGAAGAAGAA

GAAGTGCCATTTGAGGAAGTTCCTGAAGAGGAAATTCTACCTGAGGAAGAAGTTCCATCTGAGGAGGAAGCTCCACCTGAAGAAGTTCCACCAGAGGAAG

AGGAAGTTCTTCCTGAAGAAGAGGAAGTTCTTCCTGAAGAAGAGGAAGTTCTTCCTGAGGAAGAGGAAGTTCAACCTGAGGAAGAAGCTCTTCCAGAGAT

TAAACCTAAGGTGCCAAAACCTGCACCAG TGCCAAAGAAAACTGTCCCTGAGAAGAAAGTCCCCGTTCCTGTTCCTAAAAAAGTGGAGCCTCCACCACC

TCCCAAAG TGCCTGAGATCAAGAAGAAAGTGCCAGAGAAGAAAGTAGTTGTTCCCAAGAAAGAGGAGGCTCCTCCCACCAAAG TTCCTGAGGTGTCTA

AGAAGGTGGAAGAAAGACGGATCATCCCCCCTAAAGAAGAGGAAGTTCCACCAGCTGAAG TATATGAGGAGGCTGAAGAACCCACTCCAGAAGAGATTC

CAGAAGAGCCGCCTAGCATAGAAGAAGAAGAGATAGTGGAGGAAGAGGAGGAGGAGGAGGAGGTGCTGCCACCTAGAG CACCTGAAGTGGTGAAGAAAG

CAGTACCCGAAGCTCCCACTCCTGTCCCTAAGAAAGCGGAGGCACCCCCCGCAAAAG TGCCAAAGAAAATCCCTGAGGAAAAGGTTCCCGTGCCGGTCC

AGAAAAAAGAGGCCCCACCAGCCAAAG TCCCAGAAAAGAAGAAAATCCCTGAAAAGAAAGTCCCTGTGCCCAAAAAGGAAGCTGTTCCACCGGCTAAAG

 GGAAAGCTGTTTTTGAAGAAAAAATATCAGTTGCCTACCAGCAAGAAGAACTAGTCCAAGAAAGAATAGAGCTAGAACTCGTGGAAGCCAAAGTGGAAG

AGGCTTTCGAAGAAGAGGAGTTCCACGAGGTGCAGGAATACTTTGAGGAAGAGGAGTTCCACGAGGTGGAGGAGTTCATCAGGGTGGAAGAGCGCAGGTT

CCAAGAAGAGCACAAAGTGGAAGAAGTCCACAGGGTCATTGAGTTCCTAGAGGCTGAAGAAGTGGAAGTATACGAAAAGCCCAAAATTCCACCTAAAAAA

G GACCTGAGGTATCTGAGAAAGTCATCCCTCCAAAAAAGCCACCCACTAAAGTCATTCCTCGAAAAGAGCCACCAGCTAAAG TACCTGAGGTGACCAA

GAAAACGGTGGTTGAAGAAAAAATCCGTGCTCCTGAAGAACCGAAGGTGCCGGCACCTAAAG CACCCGAAGTACCAAAGAAAATCACTCCAGAAGAAAA

AGTCCGTGAAGCTGTTCCTAAAAAGCCTGAAGTTCCACCACCTAAAG TTCCTGAGGTGCCTAAGAAAATTATTCAAGAAGAAAAATTACCCGTTGTTCT

TCCTGAAGACACAGAGATATACA TGTATGAAGCATCTGAAGAGACAGTCATAGAAGAAGAGCATGTCACTCTTCCGCAGAAGGCAAGACTCAAAGTGGC

AAAAG TGCCTGCACCACCCCAAACAGTTGTTACAGAAGAGAAAACTTATGTGACCATTCGTAAAACGAGGGAAACCCTGGCACTCAAAG AGTCTGAAA

CAACCCGGGAAGCGTTTCCAGAGCTGAAGTCATATAAGGCTGTCCCTGAAATTCCTGAGCCTCCTTCACCTGAAG ACCTTGAAATCATTGAAGATGTGC

TTCCGGAGAAGCGACCTCCTGCATCCAAAAGAAGAAAAACTCAACTCCCGACAG CACCAGAAGCTCCGAGAGAGATGCCTCCTGAAATGAACACCTTTG

AAGAAATTTCTGTAGAGCCAGAAATGCTGCCCACCCAAG TGCTGGACACTTACCAAGAAGCCACGGTGGAGAAGAAAACACTTCGGATTTCTCGCAAAA

AGCCTGAGCTTCCTTCAGATGAAGAAG TGCCCGAGGCTCCCAGAGAAGTTGTGGCCAAAAAGAAAGTGCTCCCTCCCCAAGTGCCGGAAGTTGTACCTG

TGAAAG TGCCTGGGGCTCCTAAAGAGGTTGTCTCTGAAAGGAAATCGCTTGAGGAACCACCTAAAAAGCCAGCAGTCCGGCCAGTCACAG TGCCCGAG

GAGCCCAAAGAGGTCATCCCTGAAAAGAAAGTGTCCCTGGTGCCTCCTAAAAAGCCAGCAGCCCCACCTGTCACAG TGCCTGAGGCACCTGAAGAGGTC

TTCTCTGAAGACGAAGAGACCCTGGCACCCCCTCAAGAGCCAGAGGCCCCACCTGCCAAAG TGCCAGAGGCTCCCAAAGAAGTTGTTCCTGAAAAGAAA

GTCTCCGTGGTGCCTCCCAAAAAGCCAGAAGCCCCACCTGCCAAAG TGCCAGAGGCACCCAAGGAAGCTGCCCCTGAGAAGAAAGTGCCAGTGGCACCT

AAGAAAAAGCCAGAAGCCCCACCCGTGAAAG TGCCAGAGGCACCCAAGAAAGTTGTCCCTGAGAAGAAACTGCCAGTAGCAGCTCCTAAAAAGCCTGAA

GCCCCAGCTGCTGAAG TACCCGAGGTGCCAAAGACAGCTGTTCCCCAAAAGAAGATCCCTGAGGCCATTCCCCCCAAACCGGAAAGTCCTCCCCTTGAA

G TGCCTGAAGTACCACCCAAGGAAGTCACTCCTGAAAAGAAAGTTCCAGCAGCACCTCCCACGAAGCCAGAAATTCCACCTCCCAAAG TACCTGAAGC

TCCTCAGGCAGCTGTTGTTGAAGAGAAAACCCCTGAGGCACTGCCCAAAAAGGCGGAAGCCGCCCCTGTCCCAG TGCCTCAAGTCCAAGAGACTGTCCC

TGAAAAGACAAGACCAGTGGGACCTCCTAAAAAGCCAGAAGCCACAACTGTCCCAG TGCCCAAAGTCCAGAAAACTATCCCTGAAAAGACAAGACCAGA

GGCCCCTCCTAAAAGGCCAGAAGCCAGGACTGTCCCAG AGACTGTCCCAGAAAAGACAAGACCGATGGCTCCTCCTAAAAAGCCAGAAGCCACAACTCT

CCCAG TGCCTGAAGTCCAAGAGACTGTCCCTGAAAAGACAAGACCAGTGGGACCTCCTAAGAAGCCAGAAGCCACAACTGTCCCAG TGCCTGAAGTCC

AAGAAACTATCCCAGAAAAGACAAGACCTCCTAAAAAGCCAGAAGCCACACCTGTCCCAG TGCCTGAAGTCCAAGAGACTGTCCCTGAAAAGACAAGAC

CAGTAGGACCTCCTAAGAAGCCAGAAGCCACAACTGTCTCAG TACCTGAAGTCCAAGAAACTATCCCTGAAAAGACAAGACCAGCGGCCCCTCCTAAAA

AGCCAGAAGCCACAGCTGTCCCAG AAACTATCCCTGAAAAGACAAGACCAGAGGCCCCTCCTAAAAGGCCAGAAGCCACAACTGTCCCAG TGCCTGAA

GCTGATCAAGCAGTTGTCCCAGAAAAGAAAGTCCCCAGGGTCCCGCCCAAAAAAGTTGAAGCCCCACCTATTACAG TGCCTGAGGAACCTAAAGAGGTC

ATCCCTGAAAAGAAAGTGTCCCTGGTGCCTCCTAAAAAGCCAGCAGCCCCACCTGTCACAG TGCCTGAGGCACCTGAAGAGGTCTTCTCTGAAGACGAA

GAGACCCTGGCACCCCCTCAAGAGCCAGAGGCCCCACCTGCCAAAG TGCCAGAGGCTCCCAAAGAAGTTGTTCCTGAAAAGAAAGTCTCCGTGGTGCCT

CCCAAAAAGCCAGAAGCCCCACCTGCCAAAG TGCCAGAGGCACCCAAGGAAGCTGCCCCTGAGAAGAAAGTGCCAGTGGCACCTAAGAAAAAGCCAGAA

GCCCCACCCGTGAAAG TGCCAGAGGCACCCAAGAAAGTTGTCCCTGAGAAGAAACTGCCAGTAGCAGCTCCTAAAAAGCCTGAAGCCCCAGCTGCTGAA

G TACCCGAGGTGCCAAAGGCAGCTGTTCCCCAAAAGAAGATCCCTGAGGCCATTCCTCCCAAACCAGAGAGTCCTCCCCCTGAAG TGTATGAGGAACC

TGAAGAGGAGATTGTCCCAGAAGAGCCTCCAGAGGAGGCTGTGGAAGAACCAGTGCCAGCTCCCCCTCCAAAAG TGACAGAGCCACCTAAGAAGCCTGT

CCCTGAGAAGAAAGCGCCTCCTGCTGTTGTCAAGAAACCTGAACCCCCACCAGCGAAAG TGCCTGAAGTGCCTAAGGAAGCTCCCCCTGAAAAGAAAGT

GCCTCCCAAAAAGCCAGAAGCCCCACCTGCTAAAG TGCCAGAAGTTCCGAAAGAAGTTGTCACAGAAAAGAAAGTGGCTGTTCCCAAAAAGCCAGAAGT

CCCGCCAGCCAAAG TGCCAGAGGTGCCAAAGAAACCTGTCATTGAAGAGAAGCCAGCCATTCCTGTTGTTGAGAAAGTGGCGTCCCCTCCTGCTGAAG 

TATATGAAGAACCGGAAGAAGTCACTGCTGAGGAAGAGGAGCCAGCCCCTGCTGTAGAAGAGGAGGAATACGAAGCTCCCCCTCCCCCTGCACCAG TGC

CTGAAGAGCCTAAGAAGGTTGTCCCAGAGAAGAAATTTCCTGTCATCAAAAAACCAGAGGCTCCCCCTCCTAAAG TACCTGAGGTGCCAAAGAAAGCTG

TGCCCGTGAAGAAAGTTCCGGTTGTTAAGAAGCCAGAACCACCAGAAGCTGAAG TCCCCGAGGTGCCGAAGAAACTTGTTCCAGTCAAGAAGGAACCTG

TGCCTGTTACCAAAAAAACAGAAGTCCTGCCAGAAAAAG TACCGGAAGCACCCAAGAAAATTACCCCAGAAAAGAAAGAGTCTGTTCCCGTGCCTGAAG

AGCCAGAGGCCCCTCCTGCCTCAG TGGAAGAGACTCCTGAGGAGACAATCTATGAAGAGAAAGCAACCATTACCATTGGTAGAAAAGAGACGCCCCCTG

TTGAAG AACGCGAAATTGAAAAGTTTATTCAACCTGAAGAACCCGAACTGGAACCAGAGCCAGAAGAAATCCCAGTACAAG AACCTGAGCCAGAGAAG

AAGGTTATCGAGAAACCAAAACTCAAACCAAGACCCCCTGCACGTCCTCCTTCTCCACCTAAGGAAGATGTGAAGGAGAAAATGTTCCAACTTAAAG - 

UNI36362 - CTGTTTCAAAGAAGAAAGTTCCTGAAAAACCCGAGGTTGTGGAAAAAGTGGAGCCTGCACCACTAAAAG - UNI36362 - TGCCTA

CAGCTGAAAAGAAAGTTCGTAAATTACTTCCTGAACCTAAGCCGCAGCCAAAGGAAGAGGTGGTGCTGAAAAGCG - UNI36362 - TTCTAAGAAAG

AAACCCGAGGAAGAAGAACCTAAAGTAGAACCTAAAAAAGTAGAAAAAGCTAAAAAACCGGAAG AGCCACAGCCACCTCCAAAAGCCGTTGAAGTTGAA

GCTCCTCCAGAGCCTACACCAAAGGAAAGGAAAGTTCCAGAACCGGCCAAAG - UNI17655 - TTCCTGAAATTAAGCCAGCGATACCTCTCCCTGG

ACCTGAACCAAAGCCAAAGCCTGAGCCAG - UNI17655 - AGGTGAAAACCATGAAAGCTCCACCCATCGAGCCGGCACCCACTCCCATCGCTGCCC

CCGTGACAGCGCCTGTGGTTGGGAAGAAAGCAG AAGCCAAACCTAAGGATGAGGCTGCCAAGCCAAAAGGTCCCATCAAAG GTGTAGCCAAAAAGACT

CCTTCACCAATAGAAGCTGAAAGGAAAAAGCTCAGACCAGGAAGCGGTGGAGAGAAACCTCCAGACGAAGCTCCGTTCACTTACCAACTCAAGGCCGTGC

CACTGAAATTCGTGAAAGAAATCAAAGACATCGTTTTGACAGAGGCAGAGTCTGTGGGCTCTTCTGCCATCTTCGAATGTTTGGTCTCCCCATCCACTGC

CATTACAACCTGGATGAAGGACGGCAGCAACATCCGTGAGAGCCCAAAGCACAGATTCATTGCAGACGGCAAAGACAGGAAGCTGCACATTATCGACGTT

CAGCTGTCTGATGCTGGTGAATACACCTGTGTGCTACGCTTGGGAAATAAAGAGAAGACGTCCACTGCTAAGCTCATCGTAGAAG AACTTCCTGTGCGC

TTTGTGAAAACACTGGAGGAGGAAGTCACGGTGGTCAAGGGGCAGCCGTTGTACTTGAGCTGTGAGTTGAACAAAGAACGCGATGTGGTCTGGAGGAAGG

ATGGTAAGATTGTGGTGGAGAAACCTGGCAGGATCGTGCCTGGTGTCATTGGCCTGATGCGGGCCCTGACCATCAATGATGCTGATGACACTGATGCCGG

AACATACACTGTGACTGTGGAAAATGCCAACAACCTGGAATGTTCTTCTTGTGTAAAAGTAGTAG AAATCATTAGAGAATGGCTTGTGAAACCTATCCG

AGATCAGCATGTGAAGCCCAAGGGAACAGCTGTTTTCACCTGTGACATAGCCAAGGACACGCCAAACATTAAGTGGTTCAAAGGCTATGACGAGATCCCC

TTGGAACCAAACGACAAGACTGAGATACTGAAAGAGGGAAACCACCTCTTTCTCAAGGTTAAGAATGCTATGCCAGAAGATATTGATGAGTATGCAGTGG

AAATTGAAGGGAAAAGATACCCAGCAAAGCTGACACTTGGAG AGCGCGAAGTTGAGCTACTTAAGCCGATAGAAGATGTCACCATTTATGAGAAGGAAA

GTGCCAGCTTTGATGCAGAAATCTCAGAGGAAGACATTCCTGGGGAGTGGAAGCTGAAGGGCGAGCTTCTGCGGCCCTCGCCT ACTTGTGAAATCAAAG

CTGAAGGTGGGAAGCGCTTCTTAACTTTGCACAAAGTGAAACTGGACCAAGCTGGCGAAGTCCTCTACCAGGCTTGCAATGCGATCACAACTGCCATTCT

GACAGTCAAAG AAATCGAGCTTGACTTTGCTGTACCCCTGAAGGATGTGACTGTCCCAGAGAAGAGACAGGCTCGGTTTGAATGTGTCCTCACCAGAGA

GGCAAATGTCATATGGTCTAAAGGGCCTGATATAATCAAGGCATCTGACAAATTTGATATTATTGCTGATGGAAAGAAACACATTCTTGTTATCAACGAC

TCTCAGTTTGACGATGAAGGAGTCTATACTGCAGAGGTGGAGGGCAAGAAGACGTCAGCACAATTATTTGTGACAG GCATAAGACTTAAGTTCATATCA

CCACTGGAAGATCAAACAGTAAAAGAAGGCCAAACAGCAACTTTTGTCTGTGAGCTCTCTCATGAAAAAATGCACGTGGTCTGGTTCAAAAACGATGTCA

AGCTACACACAACCAGGACAGTGCTCATGTCTTCTGAGGGAAAGACTTATAAGCTGGAGATAAGGGAGACCACACTGGATGATATCTCACAGATCAAAGC

TCAAGTGAAGAACCTCAGCTCTACAGCCAACCTGAAGGTCTTGG AGGCCGATCCCTACTTCACCGTGAAATTACACGACAAGACTGGCGTGGAGAAGGA

CGAGATCATTCTTAAGTGTGAAGTGAGCAAAGATGTTCCGGTCAAATGGTTCAAAGACGGGGAAGAGATTGTGCCTTCGCCCAAACATTCTGTCAAGACC

GACGGCCTGCGCCGCATCTTAAAGATCAAGAAGGCAGAGCTCAAAGACAAAGGGGAATATGTGTGCGACTGCGGTACAGACACCACCAAGGCCAACGTCA

CTGTTGAGG CTCGACTCATAAAAGTGGAGAAACCCCTGTACGGCGTGGAAGTGTTTGTGGGTGAAACCGCCCGCTTTGAAATTGAACTGTCTGAACCTG

ACGTGCATGGCCAGTGGAAGTTAAAGGGAGAGCCTTTGACTGCTTCTCCT GACTGCGAAATCATCGAAGATGGGAAGAAACATGTCTTGGTTCTGTATA

ACTGTCAGCTGGATATGACCGGGGAGATATCCTTCCAGGCCGCCAACGCTAAATCAGCAGCCAACCTGAAAGTGAAAG AACTGCCGCTCATTTTCATCA

CCCCTCTGAGTGACGTCAAAGTCTTTGAGAAAGATGAGGCGAAGTTTGAGTGTGAAGTATCCAGGGAGCCCAAAACATTCCGCTGGCTGAAAGGAACCCA

GGAAATCACTGGTGATGACAGATTTGAGCTCATCAAGGATGGCACCAGGCATTCATTGGTGATCAAGTCAGCAGCTTTTGAAGATGAGGCCAAATACATG

TTTGAAGCTGAAGATAAACGCACAAGCGGCAAACTGATCATTGAAG - UNI35827 - GAATCCGTCTCAAATTCCTGACCCCACTCAAGGATGTGAC

AGCCAAAGAAAGGGAAAATGCCGTGTTTACTGTGGAGCTGTCCCATGACAACATCCCAGTGAGCTGGTTCAAGAACGACCAGCGCCTGCACACCAGCAAG

CGGGTCTCCATGCATGATGAAGGGAAAACACACTCCATCACGTTCAAAGACCTGTCTATTGACGACACCTCCCAAATTAGAGTGGAGGCCATGGGGATAA

GTTCAGAGGCTAAGCTCACTGTGCTGG - UNI35827 - - UNI35899 - AGGGAGACCCATACTTCACAGGAAAGCTTCAAGATTACACAGGCGT

GGAGAAGGATGAAGTGATTCTTCAGTGTGAAATCAGCAAAGCAGACGCACCCGTGAAATGGTTTAAGGACGGGAAGGAAATTAAGCCGTCTAAAAACGTT

GTTATCAAGGCTGACGGCAAGAAACGCATGCTGATCCTGAAGAAGGCCTTGAAATCAGATATCGGCCAATATACCTGTGACTGTGGGACAGACCAGACCT

CTGGGAAGCTGGACATTGAAG - UNI32138 - - UNI35827 - - UNI35899 - ATCGGGAAATTAAACTGGTGCGACCCCTGTACAGCGTGG

AGGTGATGGAGACCGAGACGGCCCGCTTTGAAACTGAGATCTCTGAAGATGATATACATGCCAACTGGAAACTGAAGGGAGAGGCACTGCTCCAAACACC

T - UNI32138 - - UNI33036 - - UNI35899 - GAATGTGAAATTAAAGAAGAAGGCAAGATCCACGTCCTTATCTTACACAACTGCCGCCT

AGACCAGACTGGAGGTGTAGATTTCCAAGCTGCCAATGTCAAATCTAGTGCCCACCTCCGAGTTAAAC - UNI32138 - - UNI32541 - - UNI

33036 - CACGGGTAATTGGTCTGCTGAGGCCTCTAAAGGATGTTACAGTGACCGCAGGGGAAACGGCCACCTTTGACTGCGAGCTCTCCTATGAGGAT

ATCCCAGTGGAATGGTACCTCAAAGGGAAGAAGCTGGAGCCTAACGATAAG - UNI14991 - - UNI16643 - - UNI32541 - - UNI3303

6 - GTGGTGACACGTTCAGAAGGAAGAGTTCACACGCTCACCCTGAGGGATGTGAAGCTAGAAGATGCTGGCGAAGTCCAACTAACTGCAAAGGATTTC

AAAACTCAGGCCAATCTCTTTGTGAAAG - UNI14991 - - UNI16643 - - UNI32541 - AACCCCCGGTTGAGTTCACTAAGCCTCTTGAG

GACCAGACGGTCGAAGAGGAGGCCACTGCAGTACTGGAGTGTGAAGTATCCAGAGAAAATGCCAAAGTGAAATGGTTCAAAAATGGGACAGAAATCCTCA

AAAGCAAGAAGTATGAAATCGTTGCTGATGGCAGGGTCAGGAAGCTCATTATTCATGGTTGTACCCCAGAGGATATCAAAACGTACACTTGTGATGCTAA

AGATTTTAAGACCTCCTGTAACCTGAATGTTGTTC - UNI14991 - CTCCTCATGTGGAATTCTTAAGACCACTCACAGACCTCCAAGTCAAAGAAA

AAGAAACTGCTCGGTTCGAGTGCGAAATTTCCAAAGAAAATGAGAAG GTTCAGTGGTTTAAAGATGGTGCTGAAATTAAAAAGGGCAAAAAGTATGACA

TCATTTCTAAGGGAGCAGTACGAATTCTTGTCATCAACAAATGTCTACTGAATGATGAAGCAGAATATTCCTGTGAAGTGAGGACAGCAAGAACTTCCGG

CATGCTGACAGTCCTAG AAGAAGAAGCTGTCTTCACAAAAAATCTTGCCAACCTTGAAGTTAGTGAAGGAGACACTATCAAACTGGTGTGTGAAGTCTC

CAAGCCTGGGGCAGAAGTGATTTGGTACAAAGGGGATGAGGAGATCATCGAAACAGGGAGATTTGAAATACTTACTGATGGAAGGAAGAGAATCTTGATC

ATTCAGAATGCGCAGCTTGAGGATGCAGGCAGCTACAACTGTCGACTCCCAAGTTCTCGAACGGACAGCAAAGTCAAAGTACACG AACTTGCTGCTGAG

TTCATCTCGAAGCCTCAAAACCTTGAAATTCTTGAAGGAGAAAAGGCTGAGTTTGTCTGCACTATCTCAAAGGAAAGCTTCGAAGTTCAGTGGAAGAGGG

ATGATCAGACACTTGAATCTGGAGATAAATATGACATCATTGCTGATGGCAAAAAGAGAGTCCTAGTTGTAAAGGATGCCACATTACAAGACATGGGCAC

TTACGTAGTCATGGTTGGGGCTGCCAGAGCCGCAGCTCACCTGACAGTCATTG AAAAACTCAGGATCATAGTTCCTCTTAAGGACACCAAGGTGAAGGA

ACAACAAGAGGTTGTCTTCAACTGCGAAGTCAATACTGAAGGTGCCAAAGCCAAATGGTTCAGAAATGAAGAAGCCATATTTGATAGTTCAAAATACATC

ATTCTCCAAAAAGACCTGGTCTACACCCTCAGAATCAGAGATGCACGGTTAGATGACCAAGCCAACTTTAATGTGTCTTTGACCAATCACAGAGGTGAAA

ATGTTAAAAGTGCAGCCAATCTAATAGTGGAAG AGGAAGATCTTAGGATTGTTGAACCTCTTAAAGATATTGAAACAATGGAGAAGAAGTCAGTCACAT

TCTGGTGCAAGGTGAATCGTCTCAATGTGACACTGAAGTGGACCAAAAATGGAGAAGAAGTGGCTTTTGACAACCGTATATCATACCGAATTGATAAGTA

CAAACACTCTCTAATCATCAAGGACTGTGGCTTCCCAGATGAAGGTGAATACGTCGTCACTGCTGGGCAAGATAAATCCGTGGCAGAGCTGCTCATCATA

GAAGCCCCAACAGAATTCGTGGAGCACCTGGAAGACCAGACGGTCACAGAGTTTGATGACGCTGTCTTCTCCTGCCAGCTCTCCAGAGAGAAAGCGAATG

TAAAATGGTACAGAAATGGAAGAGAAATCAAGGAAGGCAAAAA ATACAAGTTTGAGAAGGATGGGAGCATCCACAGGCTCATCATAAAAGACTGCAGGC

TGGAGGATGAGTGTGAATACGCTTGTGGTGTAGAGGACCGCAAGTCCCGAGCTAGACTTTTTGTAGAAG AAATTCCAGTTGAGATTATCAGGCCTCCTC

AAGACATTCTTGAAGCCCCTGGTGCAGACGTTATCTTCTTGGCTGAGCTCAACAAAGATAAAGTGGAGGTCCAATGGCTTAGAAATAACATGATCGTCGT

CCAGGGTGACAAGCACCAGATGATGAGTGAAGGAAAGATACACAGGCTACAGATTTGTGATATTAAGCCACGTGACCAGGGCGAATACAGATTCATTGCC

AAAGATAAAGAAGCCAGGGCTAAACTTGAATTAGCAG CTGCACCTAAAATCAAGACAGCTGATCAAGATCTCGTCGTTGATGCTGGCCAGCCTCTGACA

ATGGTGGTACCCTATGATGCCTACCCCAAAGCAGAAGCTGAATGGTTTAAAGAGAACGAACCTCTATCTACAAAAACCGTTGACACTACGGCTGAGCAGA

CTTCTTTCAGAATCTCAGAAGCCAAGAAGGACGACAAGGGGAGGTATAAAATCGTGCTTCAGAACAAGCATGGGAAAGCAGAGGGCTTCATCAATTTACA

AGTTATTG ATGTTCCCGGGCCAGTTCGTAACTTAGAAGTGACAGAAACATTTGATGGTGAAGTAAGCCTCGCCTGGGAGGAACCACTAACGGATGGTGG

GAGCAAAATCATAGGCTATGTTGTTGAAAGGCGTGATATCAAGAGAAAGACCTGGGTTCTGGTCACTGACCGAGCGGACAGCTGTGAGTTCACTGTCACT

GGACTACAGAAAGGAGGAGTGGAGTACCTGTTCCGTGTGAGTGCAAGGAACAGAGTTGGCACTGGAGAACCCGTAGAAACTGACAGTCCTGTAGAAGCAA

GGAGTAAATATG ATGTTCCAGGCCCTCCTTTGAATGTAACCATCACCGATGTGAATAGATTTGGTGTCTCACTAACATGGGAGCCACCAGAGTACGATG

GAGGTGCTGAAATCACAAACTATGTGATTGAGCTGAGAGACAAGACTTCTATCAGATGGGACACTGCCATGACCGTAAGAGCTGAAGACCTGTCAGCAAC

TGTCACTGATGTGGTTGAAGGACAGGAGTATAGTTTCCGTGTCAGAGCCCAGAACCGAATCGGAGTTGGGAAACCAAGTGCAGCCACACCCTTTGTCAAA

GTTGCTGATCCAATAG AGAGACCAAGTCCTCCTGTGAACCTAAACGCCTCAGAACAGACACAGTCATCAGTTCAGCTCACCTGGGAGCCTCCTCTGAAA

GATGGAGGCAGCCCCATACTGGGCTACATAATTGAAAGACGTGAAGAGGGAAAAGACAATTGGATTCGCTGCAATATGAAACCTGTCCCTGAACTGACTT

ACAAG GTCACTGGATTGCAAAAAGGGAACAAATATTTATATAGAGTGTCTGCAGAAAATGCAGCTGGTGTTTCAGATCCATCTGAGATCCTCGGTCCTC

TCACTGCTGATGATGCGTTTG TTGAACCAACGATGGATTTAAGTGCATTCAAAGATGGTTTGGAAGTCATAGTTCCCAATCCCATCAAGATCCTGGTCC

CAAGCACAGGCTATCCAAGACCAAAAGCAACCTGGACTTTTGGAGATCAAGTACTTGAAGAGGGGGATCGTGTGAAAATGAAGACCATATCAGCCTATGC

CGAGCTTGTCATTTCTCCAAGCGAACGAACAGACAAAGGCATTTACACACTCACGTTAGAAAATCCTGTGAAGTCAATTTCTGGAGAAATCAATGTCAAT

GTAATTG CTCCTCCAAGTGCGCCCAAAGAACTGAAATTTAGTGATATAACAAAGGATTCTGTACATTTGACTTGGGAACCACCAGATGATGATGGAGGG

AGTCCACTAACTGGATATGTTGTTGAAAAGAGAGACATGAGCCGGAAAACATGGACTAAA GTTATGGACTTTGTTACTGATCTAGAATTCACAGTTCCT

GATCTTGTTCAAGGAAAGGAGTATCTATTCAAAGTCTGTGCCCGAAATAAGTGTGGCCCTGGAGAACCTGCATATACTGATGAACCTGTAAATATGTCTG

CCCCTGCAA CGGTACCTGACCCACCAGAGAATGTTAAATGGAGAGACAGGACAGCCAACAGCATCTTCCTAACATGGGATCCTCCTAAAAATGATGGTG

GCTCTCGTATCAAAGGATATATAGTTGAAAAATGTCCACGTGGTTCTGATAAATGGGTTGCCTGTGGAGAACCTGTTCCAGATACAAA AATGGAAGTGA

CAGGTCTTGAGGAAGGCAAATGGTATGCCTACCGTGTGAAGGCCTTGAACAGGCAAGGTGCTAGCAAGCCAAGCAAACCCACTGAAGAGATCCAGGCGGT

GGACACACAGG AGGCCCCTGAGATCTTCCTGGATGTGAAGCTCCTGGCTGGGATCACTGTGAAAGCTGGAACGAAGATCGAACTTCCCGCCACGGTGAC

TGGAAAACCGGAACCGAAAATAACTTGGACCAAGGCTGACACCCTTCTGAAGCCAGACCAGAGAATCACCATTGAAAACGTTCCTAAAAAATCCACAGTG

ACAATCACAGACAGTAAGAGAAGTGACACAGGCACATATATCATAGAAGCCGTGAACGTCTGTGGCCGGGCCACTGCTGTGGTAGAAGTGAATGTCTTAG

 ATAAACCTGGACCACCAGCTGCCTTTGACATCACAGATGTAACCAATGAGTCGTGTCTTCTGACCTGGAACCCACCAAGAGACGATGGCGGGTCTAAGA

TCACAAACTATGTGGTGGAGAGAAAAGCAACAGACAGTGATGTGTGGCATAAGCTCTCATCAACCGTTAAGGACACAAACTTCAAGGCAACCAAATTAAC

ACCCAACAAAGAGTACATCTTCAGAGTTGCTGCAGAAAATATGTATGGTGTTGGTGAGCCGGTTCAAGCTGCTCCAATAATAGCCAAATACCAGTTTG A

TCCACCCGGACCTCCAACTCGCCTAGAACCTTCCGACATCACTAAAGATGCGGTGACGCTCACATGGTGTGAGCCAGATGATGATGGTGGCAGTCCCATC

ACTGGATACTGGGTTGAAAGATTAGATCCTGACACTGATAAATGGGTTCGATGCAATAAGATGCCAGTGAAGGACACAACATACAG GGTAAAAGGTCTC

ACCAATAAGAAAAAGTACAGATTCCGCGTGCTTGCTGAAAATTTGGCAGGGCCAGGAAAACCAAGTAGATCAACTGAACCAATCTTAATAAAGGATCCCA

TAG ATCCTCCATGGCCCCCTGGAAAACCAACTGTAAAGGATATAGGCAAAACCTCCTTAGTATTGAACTGGACCAAGCCAGAACACGATGGAGGGGCAA

AGATTGAGTCTTACGTCATTGAGATGCTAAAGACCGGAACAGACGAGTGGGTCAGGGTGGCTGAGGGAGTTCCGACCACTGAGCATTTGCTCACAGGGCT

AATGGAAGGCCAGGAATACTCATTCCGAGTGAGAGCCGTGAACAAGGCTGGAGAGAGTGAGCCCAGTGAACCCAGCGACCCTGTGCTTTGCCGGGAGAAA

CTAT ATCCTCCATCACCACCTCGCTGGCTCGAAGTGATTAATATCACAAAAAATACAGCTGACCTAAAATGGACAGTTCCAGAGAAAGATGGAGGGTCA

CCCATCACCAACTACATTGTGGAAAAGAGAGATGTGAGACGGAAAGGCTGGCAAACAGTGGACACCACTGTCAAGGACACCAAGTGCACGGTCACCCCAC

TGACAGAGGGGTCTCTGTATGTGTTCCGAGTTGCTGCAGAAAATGCCATAGGACAAAGTGACTACACAGAAATCGGAGATTCTGTCCTGGCCAAAGACAC

CTTCA CCACCCCTGGACCACCCTATGCCCTGACAGTGGTTGATGTGACAAAACGACATGTTGACCTAAAGTGGGAGCCACCTAAAAATGATGGCGGAAG

ACCAATACAGAG ATACATCATTGAGAAGAAAGAAAAATTAGGTACCCGTTGGGTGAAAGCCGGGAAGACCTCAGGCCCTGACTGTAACTTCAGAGTAAC

TGATGTCATTGAAGGAACAGAAGTCCAGTTTCAAGTTCGGGCAGAAAATGAAGCAGGAGTTGGTCACCCAAGTGAGCCCACAGAAATTCTGTCAATCGAA

GACCCAACAA GTCCTCCTTCACCTCCGCTTGATCTACATGTGACTGATGCTGGGAGAAAACACATTGCCATTGCTTGGAAACCACCAGAGAAAAATGGC

GGAAGTCCTATCATAGGCTACCATGTTGAAATGTGTCCAGTAGGCACAGAGAAATGGATGCGAGTTAATTCTCGCCCAATAAAAGATCTGAAGTTCAAGG

TTGAAGAGGGTATTGTTCCGGACAAAGAATATGTTCTGAGAGTGAGAGCTGTCAATGCTGTCGGTGTCAGTGAGCCATCTGAAATCTCCGAAAACGTGGT

CGCCAAAGACCCAGACT GCAAACCAACTATTGATCTAGAGACTCACGACATTGTTGTTATCGAAGGAGAAAAGTTAAACATCCCTGTGCCCTTCAGGGC

TGTCCCAGTGCCAACCGTGAGCTGGCATAAAGATGGCAAAGAAGTTAAAGCAAGTGACAGATTGACAATGAAGAACGACCACATCTCTGCACACCTCGAG

GTTCCCAAGAGTGTCCATGCAGATGCTGGAGTGTACACCATCACCCTGGAGAATAAGCTCGGCTCAGCAACGGCTTCAATCAATGTCAAAGTCATAG GT

CTACCTGGTCCATGCAAAGATATTAAAGCAAGTGACATAACCAAAAGTTCTTGTAAGTTAACATGGGAACCTCCAGAGTTTGATGGTGGAAGCCCGATTC

TTCATTATGTCCTGGAACGGAGAGAAGCAGGGAGGAGGACATATATCCCAGTCATGTCTGGTGAGAACAAACTGTCTTGGACCGTAAAAGATCTCATACC

AAATGGTGAATACTTCTTCCGAGTAAAAGCAGTCAACAAGATTGGCGGAGGAGAATACATTGAACTCAAGAATCCTGTCATTGCTCAAGATCCAAAGC A

ACCACCTGATCCACCTGTAGATGTTGAGGTTCATAATCCTACAGCTAAGGCAATGACTATCACGTGGAAGCCACCCTTGTATGATGGAGGAAGCAAGATA

ATGGGTTACATCATAGAAAAGATCACTAAGGGTGAGGATAGATGGAAGAGATGCAATGAACATCTGGTCCCTGTCCTGACCTACACAGCGAAAGGACTCG

AGGAGGGGAAAGAGTACCAATTCCGTGTGCGAGCGGAGAACGCTGCTGGTATTGGTGAACCTTCCCGGGCCACTCCCCCAACCAAAGCTGTCGACCCTAT

TG ATGCCCCAAAAGTCATCCTCAGAACAAGCCTGGAAGTAAAGCGGGGTGATGAAATAGCACTTGATGCAACCATCTCTGGCTCACCATACCCAACAAT

CACATGGATAAAAGATGAAAATGTCATTGTTCCAGAGGAAATTAAGAAGCGAGCGGCACCCCCAGTTAGGAGGAAGAAGGGCGAGGCTGAAGAGGAGGAG

CCCTTTTCCCTCCCTCTGACAGAACGTCTGAGCATCAACAATAGCAAACAGGGAGAATCTCAGCTGCGCATCCGTGACTCTCTGCGGCCTGACCATGGCC

AGTACATGATCAAAGTTGAGAATGATCACGGTGTTGCAAAAGCTCCTTGCTCCGTCAGTGTGTTAG ATACACCAGGACCACCAATCAACTTTGTATTTG

AGGATATTAGAAAGGACTCTGTCCTGTGTAAGTGGGAACCACCGCTTGACGATGGTGGCAGTGAAATCATTAACTATACCTTGGAAAAGAAAGACAAGAC

CAAGCCCGACTCAGACTGGATTGTTATCACATCAACACTCAGAAACTGCAAATATTCAGTAACAAAACTGATTGAAGGAAAAGAGTACCTCTTCCGTGTA

AGAGCTGAAAATAGGTTTGGACCTGGGCCACCATGTGTTTCAAAGCCACTTTTAGCCAAAGATCCATTTG AACCACCTGATGCACCAGATAAACCCATT

GTGGAAGATGTCACCAGCAACAGTATGCTAGTAAAATGGAATGAACCGAAAGATAATGGAAGCCCCATCTTGGGTTACTGGCTTGAAAAACGTGAGGTCA

ATAGTACACACTGGTCTCGTGTCAACAAAACCCTTCTCAGTTCTTTGAAAACCAAGGTAGATGGCTTGCTGGAAGGACTCACCTATGTCTTCCGAGTTTG

TGCTGAAAACGCTGCTGGACCTGGAAAGTTCAGCCCACCTTCGGATCCTAAAACAGCTCGCGATCCAATCT CTCCACCTGGGCCGCCTGTCCCGAGAGT

TGCTGATACAAGCTCTACAACCATTGAGCTGGAGTGGGAACCCCCAGCTTTCAATGGTGGTGGGGAAATTATGGGCTACTTTGTTGATAAGCAGCTGGTT

GGCACAAATGAGTGGTCACGCTGCACAGAGAAGATGATCAAAGTCCGTCAGTTCACTGTCAAAGAAATCCGAGAGGGTGCCGACTACAAACTTCGAGTGA

GTGCTGTCAATGCAGCAGGCGAAGGACCACCTGGAGAAACAGAACCTGTTACTGTGGCTGAGCCACAAG AGCCTCCAACTGTGGAACTAGATGTTTCTG

TCAAGGGTGGAATACAAATCATGGCTGGGAAGACTCTCAGAATCCCAGCGGAGGTGACTGGCCGTCCTGTGCCCACAAAAGTATGGACCATCGAAGAAGG

GGAGCTAGATAAAGAGCGTGTTATAATAGAGAATGTCGGAACCAAATCTGAACTAATTATCAAGAACGCATTGAGAAAAGACCATGGCAGATACGTGATC

ACGGCAACAAACAGCTGTGGTTCCAAATTTGCCGCAGTCCGGGTTGAAGTGTTCG ATGTCCCTGGCCCAGTTCTTGACCTCAAACCGGTTGTAACAAAC

AGAAAGATGTGTCTGCTTAATTGGTCCGATCCAGCAGATGATGGCGGAAGTGACATCACAGGGTTTATAATTGAAAGGAAGGATGCTAAGATGCACACTT

GGAGACAGCCCATCGAGACTGAGAGATCCAAGTGTGACATCACAGGCCTTATAGAGGGACAAGAATACAAGTTCCGTGTCATTGCCAAGAACAAGTTTGG

CTGTGGGCCTCCTGTTGAAATAGGACCAATTCTTGCAGTTGATCCACTAG GCCCTCCAACATCTCCTGAAAGGCTCACATACACAGAAAGAACAAAATC

CACCATCACACTTGACTGGAAAGAGCCACGCAGCGATGGTGGCAGTCCCATTCAAGGATATATCATTGAAAAACGCCGCCATGACAAACCCGACTTTGAA

AGAGTTAACAAGAGACTCTGCCCAACCACATCATTTCTGGTTGAAAATCTTGATGAACACCAAATGTATGAGTTCCGTGTCAAAGCCGTCAATGACGTTG

GTGAAAGTGAACCATCTCTGCCTCTTAACGTAGTCATACAGGATGATGAAG TCCCTCCCACTATTAAGTTGCGCCTGGCTGTTCGAGGAGACACTATCA

AAGTTAAGGCAGGGGAGCCAGTTAACATCCCTGCAGACGTGACCGGCCTCCCCATGCCTAAGATTGAGTGGTCCAAGAATGAAAAGGTGATTGATAAACC

TACGGATACACTGAATATAACCAAAGAAGAAGTCTCCCGAAGTGAGGCAAAGACTGAGCTTAGCATCCCTAAAGCAGCCCGAGAGGACAAGGGCACGTAC

ACAATCACAGCTTCCAATCGTCTTGGCTCCGTATTCCGCAACGTTCATGTGGAGGTTTATG ATCGTCCATCTCCACCCAGAAACCTCGCTGTTACTGAC

ATCAAAGCTGAGTCTTGCTATTTGACGTGGGATGCCCCTCTAGACAATGGAGGCAGTGAAATTACTCATTACATCATTGACAAGCGTGATGCCAGCAGGA

AGAAGTCCGAATGGGAAGAAGTCACTAACACTGCTGTTGAGAGAAGATACGGG ATCTGGAAGCTTATCCCCAATGGTCAGTACGAGTTCCGAGTGAGGG

CAGTGAATAAATATGGAATCAGTGATGAATGCAAATCAGACAAGGTCGTCATTCAAGATCCCTACCGCCTCCCCGGGCCTCCTGGAAAACCGAAAGTCTT

AGAACGTACCAAAGGATCTATGCTTGTGAGCTGGACCCCTCCTCTGGACAACGGAGGGTCTCCAATTACTGGCTACTGGCTAGAGAAGAGAGAGGAAGGT

GGTACCTACTGGTCACGTGTTAGCAGAGCACCAATAACCAAAGTAGGACTGAAGGGTGTGGAATTCAATGTTCCGCGGTTGATTGAAGGCGTCAAATATC

AATTTAGAGCCATGGCAATAAATGCTGCAGGAATTGGCCCTCCCAGTGAACCATCAGACCCAGCTGTTGCAGGAGATCCTATAT ACCCTCCTGGGCCAC

CTTCTTGCCCAGAGGTCAAAGATAAAACAAAATCAAGCATCTCACTAGCATGGAAACCTCCAGCCAAAGACGGTGGCAGCCCAATCAAAGGCTACATTGT

AGAGATGCAAGAGGAGGGAACCACGGACTGGAAGCCAGTCAATGAACCCGATAAACTTCTCACTGCCTGTGAATGTGTGGTGCCTAATCTGAAAGAGCTC

AGGAAGTACAGGTTCAGAGTGAAAGCTGTCAATGAAGCTGGAGAGTCTGAACCAAGTGACACGACCGGAGAGATCCCTGCCACTGATATCCAAG AAGTT

CCAGAGGTTTTCATTGACATTGGCGCACAAGACTGCCTGGTTTGCAAAGCTGGCTCACAGGTCAAAATTCCTGCTGTGATCAAGGGACGCCCCACACCAA

AATCATCTTGGGAATTTGATGGAAAAGCAAAGAAGGCAATGAAG GATGGAGTTCATGATATACCTGAAGATGCACAG CTGGAGACGGCCGAAAACTCA

TCGGTCATCATTATCCCAGAGTGTACTCGAGCTCACTCGGGCAAATACAGCATCACAGCCAAGAACAAAGCAGGACAGAAAACTGCCAACTGCAGAGTTA

AAGTCATGG ACGCACCAGGCCCTCCCAAAGATTTGAAGGTCAGTGACATCACAAGGGGTAGTTGCCGCCTCTCATGGAAGATGCCAGATGATGATGGAG

GTGATAGGATCAAAGGCTACGTCATTGAGAAGAAGACCATCGACGGGAAAGCCTGGACGAAAGTCAATCCAAATTGTGGAAGCACCACATTTGTGGTACC

AGATCTTATCTCTGAGCAGCAATACTTCTTCCGTGTTCGAGCAGAAAACCGTTTTGGAATTGGCCCACCTGCAGAAACCATCCAGAGGACCACTGCCAGA

GACCCAATAT ATCCTCCTGATCCCCCTATCAAACTCAAGATTGGTCTCATAACAAAGAACACAGTGCACCTGTCGTGGAAACCTCCAAAGAATGATGGT

GGCTCTCCTGTCACCCATTATATTGTTGAGTGTTTGGCTTGGGACCCTACCGGGAAAAAGAAAGAAGCCTGGAGGCAGTGCAATAGGCGTGATGTGGAAG

AACTGGAGTTCACCGTGGAAGACCTCATAGAGGGAGGGGAATATGAATTCAGAGTCAAAGCCGTCAACGAGGCCGGGGTCAGCAAGCCTTCAGCCACTGT

TGGTCCTGTGATTGTCAAAGACCAGACAT GCCCACCAGCCATTGAGCTAAAAGAATTCATGGAAGTTGAAGAAGGAACTGATGTTAACATTGTGGCCAA

AATCAAAGGTGTGCCGTTCCCAACTCTCACCTGGTTCAAGGCTCCGCCAAAGAAACCCGACAGCAAAGAGCCTGTTGTTTATGACACCCATGTCAACAAA

CAGGTGGTGGATGACACTTGCACTTTAGTCATTCCTCAGTCTCGCCGGAGTGACACTGGCTTATATTCTATCACAGCCGTAAACAACCTGGGGACAGCAT

CAAAGGAGATGAGACTCAATGTCCTTG GTCGTCCTGGCCCCCCTGTGGGACCCATAAAGTTTGAATCTATTTCAGCGGATCAGATGACATTATCTTGGC

TTCCACCTAAAGATGACGGTGGGTCTAAGATTACAAACTATGTCATTGAGAAAAGAGAAGCCAACAGAAAGACATGGGTACGTGTCTCCAGTGAACCTAA

AGAATGCATGTACACAATTCCCAAATTGCTAGAAGGCCATGAATACGTCTTCCGAATCATGGCCCAGAATAAGTACGGCATTGGAGAGCCACTTGACAGT

GAACCTGAGACAGCACGGAACCTCTTCT CTGTCCCTGGAGCTCCAGATAAACCAACAGTGAGCAGCGTCACTCGCAACTCCATGACTGTCAACTGGGAA

GAGCCGGAATATGATGGAGGCTCTCCTGTGACAGGGTACTGGTTAGAAATGAAAGACACCACTTCAAAGAGATGGAAGAGAGTTAACCGAGATCCCATCA

AAGCCATGACTCTAGGTGTTTCTTACAAAGTGACTGGCCTTATTGAAGGATCAGACTATCAGTTCCGGGTATATGCAATCAATGCCGCTGGTGTGGGTCC

AGCAAGTCTTCCCTCAGATCCAGTGACTGCTAGAGATCCAGTTG CTCCCCCTGGTCCTCCATTCCCCAAAGTGACAGACTGGACAAAATCATCTGTGGA

CTTAGAATGGTCTCCTCCACTAAAAGATGGCGGATCCAAAATCACTGGCTACATTGTTGAGTATAAGGAAGAAGGAAAAGAAGAATGGGAAAAG GGTAA

AGATAAAGAAGTGAGGGGGACAAAACTGGTTGTTACTGGATTAAAAGAAGGAGCCTTCTACAAATTCCGTGTGAGAGCAGTCAATGTTGCTGGTGTTGGG

GAACCTGGAGAAGTCACGGACGTTATTGAAATGAAGGACAGAATTG TGTCGCCTGACCTTCAGCTTGATGCCAGTGTCAGAGACAGAATAGTGGTCCAC

GCCGGAGGGGTGATCCGTATCATTGCCTATGTATCTGGGAAGCCACCTCCCACTGTCACCTGGAGTATGAATGAAAGAGCCTTGCCTCAAGAGGCCGCCA

TTGAGACCACAGCAATTAGCTCATCCATGGTCATCAAGAACTGCCAGAGGAGCCACCAAGGCGTCTACTCTCTTCTTGCCAAAAATGAAGGCGGAGAAAG

AAAGAAGACAATTATTGTTGATGTACTAG ATGTCCCAGGACCTGTTGGAATACCATTCCTCTCTGACAACCTAACCAATGACTCCTGCAAACTGACATG

GTTCTCTCCAGAAGATGATGGTGGCTCTCCAATCACCAATTATGTCATTCAGAAGCGGGAAGCTGACCGCAGGGCATGGACCCCTGTGACATACACAGTC

ACTCGACAAAATGCTACTGTTCAGGGCCTTATTCAAGGAAAATCCTACTTTTTCCGAATTGCAGCTGAGAATAGCATTGGCATGGGCCCATTTGTTGAGA

CACCAAATGCACTTGTCATTAGAGACCCAATAA CTGTGCCAGAGAGACCTGAGGACCTGGAAGTCAAAGAAGTCACTAAAAATACTGTGTCTTTGACTT

GGAACCCTCCCAAGTATGATGGCGGGTCAGAAATTATAAACTATGTCCTAGAAAGCCGCCTCATTGGTACTGAGAAGTTCCACAAAGTTACAAATGACAA

CCTGCTTAGCAGGAAATACACTGTGAAAGGCTTAAAAGAAGGCGATACATATGAGTACCGCGTCAGTGCCGTCAATATCGTTGGACAAGGCAAGCCATCA

TTTTGCACCAAGCCAATCACTTGCAAGGATGAACTGG CTCCACCTACACTTGACCTCGACTTCAGAGATAAGCTTACCGTCCGAGTTGGTGAATCTTTC

GCCCTCACTGGCCGATACTCAGGCAAACCAAAGCCTAAGATTGATTGGTTCAAAGATGAAGCTGATGTACTGGAAGATGATCGTACTCACATAAAGACCA

CTCCCACGACACTTGCTCTTGAGAAGACAAAGGCCAAACGCTCAGATTCTGGGAAATACTGTGTAGTTGTGGAGAACAGTACAGGCTCCAGGAAAGGTTT

CTGTCAAGTCAATGTTGTTG ATCGTCCTGGACCACCAGTAGGACCTGTCATTTTTGATGAGGTGACCAAAGAATACATGGTTATTTCTTGGAAGCCACC

TCTAGATGATGGAGGAAGTGAAATTACCAATTATATTATTGAGAAGAAGGAGCTCGGTAAAGACATCTGGATGCCTGTGACATCTGCCAGTGCCAAAACT

ACATGCAAGGTCCCTAAACTGCTTGAAGGAAAAGATTACATCTTCCGGATTCATGCGGAAAATCTATATGGAATAAGTGACCCTCTGGTGTCTGATTCAA

TGAAAGCCAAAGATCGATTCA GAGTCCCTGATGCACCTGAGCAGCCAGTTGTCACAGAGGTCACCAAAGACTCGGCATTAGTAACCTGGAACAAGCCAA

ATGACGGAGGAAAGCCCATCACAAACTACATCCTGGAAAAGAGGGAAACTATGTCTAAAAGATGGGTTCGAGTTACCAAAGAGCCTATTCATCCATACAC

TAAGTATAGGGTTCCTGATCTTCTAGAAGGATGCCAGTATGAATTCCGTGTTTCTGCAGAGAATGAAATTGGTATTGGAGATCCAAGTCCACCATCCAAA

CCAGTCTTTGCTAGAGACCCAATTG CTAAACCAAGTCCACCTATTAATCCTGAGGCAATAGATACAACATGTAATTCAGTTGAGCTAACTTGGCAGCCA

CCACGTCACGACGGTGGTAGCAAGATCCTGGGTTATATCGTGGAGTACCAGAAAGTTGGGGATGAAGAGTGGAGACGAGCCAATCACACTCCTGAATCAT

GCCCTGAAACTAAATATAAAGTCACTGGCCTCAGGGATGGTCAGAGCTACAAGTTCCGAGTACTGGCAGTCAACGAGGCTGGTGAATCGGACCCAGCCCA

CGTTCCTGAACCAGTTCTAGTAAAGGACCGACTTG AACCTCCTGAGCTTATACTTGATGCTAACATGGCAAGAGAACAACACATTAGAGTTGGTGACAC

CCTAAGACTTAGTGCCATCATCAAAGGTGTGCCATTCCCCAAAGTAACCTGGAAAAAAGAAGACAGAGAGGCTCCAACAAAAGCCCAAATTGATGTTACT

CCAGTTGGGAGCAAGCTTGAAATCCGTAATGCTGCCCACGAAGATGGTGGTATTTATTCCCTAACTGTGGAGAATCCGGCGGGTACAAAGACAGTCTCAG

TCAAAGTATTGGTCTTAG ATAAACCTGGGCCACCTAGAGATCTGGAAGTCAGTGAAATTAGGAAAGATTCTTGTTACCTGACTTGGAAGGAACCACTGG

ACGACGGTGGTTCTGTTGTAACCAATTATGTGGTTGAGAGGAAAGATGTTGCCACTGCCCAGTGGTCCCCTCTTTCCACCACGTCAAAGAAGAAGAGCCA

TATGGCTAAACATCTGACTGAGGGCAATCAGTACCTCTTCCGAGTAGCTGCTGAGAACCAATACGGACGTGGTCCTTTTGTTGAAACACCTAAGCCCATC

AAGGCTCTGGATCCTCTCC ATCCCCCAGGGCCACCCAAGGATCTGCACCACGTAGATGTCGACAAGACTGAAGTCTCTCTCGTTTGGAATAAGCCAGAT

CGTGATGGTGGTTCTCCAATCACAGGATACTTAGTGGAATATCAAGAAGAGGGTGACAAGGACTGGATCAAGTTCAAGACTGTGAAAAATTTAGACTGTG

TTGTTACAGGCTTACAACAAGGAAAGACCTATAGATTCCGTGTAAAAGCTGAAAATATCATAGGTCTTGGTCTTCCTGATACAACTATCCCAATAGAATG

TCAAGAGAAACTAG TGCCTCCATCTGTGGAATTAGATGTGAAGTTAATTGAAGGGCTTGTGGTGAAGGCTGGTACCACAGTTAGATTCCCTGCCATCAT

AAGAGGTGTACCTGTTCCTACTGCAAAATGGACAACTGATGGGACTGAGATTAAAACAGATGACCACTACACAGTTGAGACTGACAGCTTCTCATCCGTG

CTGACCATTAAGAATTGTTTAAGGAAGGATACTGGGGAATACCAACTCACAGTTTCCAATGCAGCGGGTACCAAAACAGTAGCTGTCCATCTTACTGTTC

TTGATGTACCTGGTCCACCAACAGGTCCTATTAATATCCTGGATGTCACACCTGAATACATGACTATCTCATGGCAACCGCCTAAGGATGATGGAGGAAG

CCCAGTGATAAATTACATTGTTGAGAAACAAGATACAAGGAAAGGTACATGGGGTGTCGTCTCTGCAGGAAGCAGTAAGCTGAAGCTGAAGGTCCCACAT

CTCCAAAAAGGCTGTGAATACGTTTTCAGAGTCAAAGCAGAGAACAAGATGGGTGTCGGTCCTCCCCTTGACTCCATACCTACTGTTGCTAAGCACAAGT

TCAGTCCTCCATCTCCTCCTGGTAAACCAGTGGTAACTGACATTACTGAGAATGCTGCAACGGTGTCTTGGACACTGCCAAAATCTGATGGTGGCAGTCC

AATAACTGGCTATTATGTAGAGCGCAGAGAAATAACCGGCAAATGGGTGAGGGTCAACAAAACGCCTATTGCTGACCTGAAGTTCAGGGTGACTGGACTC

TATGAGGGAAATACATACGAGTTTAGAGTTTTTGCTGAAAATCTTGCAGGTTTAAGCAATCCATCACCCAGTTCTGACCCAATCAAAGCTTGCCGGCCCA

TCAAACCACCAGGGCCACCTATAAATCCTAAGCTGAAAGACAAGAGCAAAGAATCTGCTGACTTGGTGTGGACAAAGCCCCTCAGTGATGGTGGCAGCCC

CATTTTGGGGTATGTAGTAGAGTATCAGAAACCTGGCACAGCGCAGTGGGATAGGATTAATAAAGACGAACTCATCAGGCAATGTGCCTTCCGGGTCCCC

GGACTGATTGAAGGAAATGAGTACAGATTTCGCATTAGAGCAGCTAACATTGTGGGTGAGGGAGAGCCAAGGGAGCTTGCAGAATCTGTGATTGCAAAAG

ACATCCTTCATCCCCCGGAAGTGGAACTTGACGTTACATGCCGTGATGTCATTACCGTCCGGGTGGGTCAAACTATCCGCATTCTTGCCCGAGTCAAAGG

CAGACCTGAGCCAGACATAACTTGGTCCAAGGAAGGAAAAGTACTGGTCAAAGACAAGCGGGTTGACCTAATTCATGATCTGCCTCGTGTTGAGCTACAA

ATTAAAGAAGCTGTCAGAGCTGACCATGGCAAGTATATCATCTCTGCTAAGAACAGCAGTGGGCATGCCCAAGGGTCAGCCATTGTTAATGTCCTTGACA

GACCTGGGCCTTGCCAGAATCTGAAGGTTAGCAACGTAACCAAGGAAAACTGCACCATTTCTTGGGAAAACCCACTAGATAATGGTGGCTCAGAAATTAC

AAATTTCATAGTGGAATATCGTAAACCAAATCAGAAAGGCTGGTCAATCGTTGCCTCAGATGTCACCAAGAGACTGGTCAAGGCCAACCTGTTAGCCAAT

AATGAATACTATTTCCGTGTTTGTGCAGAGAATAAAGTAGGTGTTGGGCCAACCATTGAAACAAAGACTCCAATTTTGGCCATCAATCCTATTGACAGGC

CAGGGGAGCCTGAAAACCTTCATATTGCAGATAAAGGAAAGACCTTTGTCTATCTAAAGTGGCGACGGCCTGATTATGATGGTGGTAGCCCGAATCTATC

ATATCATGTTGAGAGGAGACTGAAGGGCTCTGCAGACTGGGAAAGAGTGCACAAAGGAAGCATTAAGGAAACCCACTACATGGTTGACAAGTGTGTTGAA

AACCAGATTTATGAGTTCAGAGTACAAACTAAGAATGAAGGTGGAGAAAGTGATTGGGTGAGGACAGAGGAAGTTGTTGTGAAGGAAGATTTACAGAAGC

CAGTACTTGATCTAAAATTAAGTGGGGTGCTAACTGTCAAAGCAGGGGACACCATTAGACTCGAGGCAGGTGTGAGAGGCAAACCATTCCCAGAGGTTGC

CTGGACCAAAGACAAAGATGCTACAGATTTAACAAGATCACCAAGGGTCAAGATTGATACCAGTGCCGAATCATCGAAATTCTCTCTTACCAAAGCCAAG

CGAAGCGATGGCGGTAAATACGTAATCACCGCAACTAACCCAGCTGGCAGTTTTGTGGCCTATGCGACTGTCAATGTTTTAGATAAACCTGGTCCTGTAA

GAAACCTGAAAATCACTGATGTGTCCAGTGACAGGTGTACTATCCGCTGGGATCCACCAGAAGATGATGGCGGCTGTGAAATCCAAAATTATATCCTAGA

AAAATGTGAGAGCAAGAGAATGGTATGGTCTACCTATTCTGCTAATGTCTTGACACCCAGTGCTACAGTGACTCGTCTCATAGAAGGAAATGAGTATATT

TTCAGAGTTCGTGCAGAAAACAAAATAGGCACAGGGCCTCCAACAGAAAGTAAACCAGTCATTGCAAAAACCAAGTATGACAGACCTGGCCGCCCTGATC

CTCCAGAAGTCACTAAAGTAAGCAAAGAAGAGATGACCGTGGTTTGGAACGCCCCTGAATATGATGGTGGGAAGTCTATCACAGGATACTATTTAGAGAA

AAAAGAAAAGCATGCAGTCCGCTGGGTCCCTGTTAACAAGAGTGCCATCCCTGAGCGACGCTTGAAAGTACAGAATCTCCTCCCAGGGCACGAGTACCAG

TTCCGTGTCAAAGCAGAAAATGAAGTTGGCATTGGAGAACCAAGCTTACCATCAAGACCAGTGGTGGCAAAAGATCCCATAG AACCACCTGGGCCACCA

ACCAATTTCAAAGTGGTTGATACAACCAAAAGTTCCATAACTCTCGCATGGGGAAAACCAGTCTATGATGGTGGTGCACCGATAATTGGATATGTCGTAG

AGATGAGACCCAAAATAGCAGACGCATCACCTGACGAAGGCTGGAAAAGGTGCAACGCTGCAGCTCAACTTATTCGCATGGAATTCACAGTCACCAGCTT

GGATGAGAACCAGGAGTACGAGTTCAGGGTGTGTGCCCAGAATCAAGTTGGCATTGGGCGCCCTGCAGAGCTAAAGGAAGCCATCAAACCTAAAGAAATC

CTAG AGCCTCCAGAGATTGACTTGGATGCCAGCATGAGAAAACTGGTCGTAGTGAGAGCTGGCTGCCCTATTCGACTATTCGCAATAGTGAGAGGACGA

CCTGCCCCCAAAGTCACATGGCGCAAAGTGGGCATTGATAATGTGGTCAGAAAAGGACAAGTCGATCTAGTTGACACTATGGCCTTCCTTGTCATCCCCA

ACTCTACCCGTGATGACTCTGGAAAATACTCCCTGACCCTTGTGAACCCAGCAGGAGAAAAGGCTGTTTTTGTGAATGTCAAAGTACTAG ATACTCCTG

GACCTGTGGCTGATTTAAAAGTTTCAGATGTCACTAAAACATCATGTCACGTGTCCTGGGCACCTCCTGAAAATGATGGTGGAAGCCAAGTGACACATTA

TATTGTGGAGAAACGTGAGGCAGAAAGAAAAACATGGTCAACAGTTACCCCTGAAGTGAAGAAAACAAGCTTCAATGTAACCAACCTTGTCCCTGGGAAC

GAGTATTTCTTCCGAGTAACTGCTGTCAATGAATATGGCCCTGGTGTCCCGACAGACATCCCCAAACCTGTGCTTGCATCAGATCCTCTCA GTGAGCCA

GATCCTCCAAGAAAACTGGAGGTGACCGAAATGACAAAGAACAGTGCTACACTGGCCTGGTTACCTCCGTTGCGTGATGGAGGCGCTAAAATCGATGGCT

ATATCATTAGTTACAGAGAAGAAGACCAACCTGCAGATCGCTGGACAGAGTACTCAGTGGTCAAAGACCTCAGCCTTATTGTTACTGGCCTAAAGGAAGG

AAAGAAATATAAATTTAGAGTTGCAGCTAGAAATGCTGTTGGAGTCAGCATGCCAAGAGAGGCCGAAGGCGTCTACGAAGCAAAAGAACAGCTAT TGCC

ACCAAAGATCCTCATGCCTGAGCAAATCACTATCAAAGCCGGGAAGAAACTTCGAGTTGAGGCGCATGTGTATGGAAAGCCTAACCCCATCTGCAAATGG

AAGAAAGGAGACGACGAAGTTGTTACATCCAGCCACCTGGCCATCCACAAGGCAGACGGCTCCTCAGTTCTGATCATAAAAGACGTTACTAGAAAAGACA

GTGGTTACTATAGCCTCACGGCAGAGAATAGCTCCGGGTCAGACACTCAGAAAATCAAAGTTACAGTCATGG ATGCTCCTGGGCCCCCTCAGCCTCCAT

TTGACATTTCTGAAATAGATGCTGATGCTTGCTCCCTGTCTTGGCACATCCCTCTGGAGGATGGAGGCAGCAACATTACCAATTACATAGTAGAGAAATG

TGATGTAAGCCGTGGCGATTGGGTCACAGCTCTAGCATCAGTCACCAAGACTTCCTGCAGGGTTGGAAAGCTGATCCCAGGCCAGGAGTATATCTTCCGG

GTCCGAGCTGAAAACAGATTTGGCATTTCAGAGCCTCTCACATCTCCAAAGATGCTTGCTAAGTTCCCATTTG ATGTTCCTAGTGAGCCAAAGAATGCA

CGTGTCACTAAAGTCAACAAAGACTGCATATTTGTCGCGTGGGACAGACCAGACAGTGATGGAGGAAGCCCCATCACTGGTTACCTGATTGAACGCAAAG

AAAGAAACAGTTTGCTCTGGGTGAAAGCTAATGACACTATTGTCCGGTCAACTGAGTATCCTTGTGCTGGCCTCGTAGAAGGTCTAGAATATTCATTCAG

AATCTATGCTCTAAACAAAGCTGGGTCCAGCCCACCTAGCAAACCAACTGAGTATGTGACTGCAAGGATGCCGGTTG ATCCACCAGGGAAACCTGAAGT

TGTTGACGTCACCAAGAACAGCGCATCGCTTATCTGGGCCCGGCCAAAGCATGATGGAGGCAGCAGAATTATCGGCTATTTTGTAGAGGCTTGCAAACTT

CCTGGTGATAAATGGGTTCGGTGCAATACCACACCTCACCAGATTCCCCAGGAAGAGTACACAGCTACTGGGTTAGAAGAGAATGCTCAGTATCAGTTCA

GAGCGATTGCCAAGACTGCTGTGAACATCAGCCAGCCTTCCGAGCCTTCTGATCCAGTGACCATTCTTGCAGAAAATG TTCCTCCACGGATAGAACTCA

GTGTTGAGATGAAGTCTTTGCTTACCGTGAAGGCTGGGACTAATGTCTGCTTGGATGCTACTGTCTTCGGGAAACCGATGCCAACGGTTTCTTGGAAGAA

AGACACCACACCAATAAAACAAGCCGAAGGCATAAAGATGGCAATGAAGCGGAACTTGTGTACCTTGGAGCTGTTCAGTGTGAACCGGAAAGACTCAGGA

GACTATACCATTACTGCCGAAAATTCCAGTGGTTCCAAATCAGCCACCATTAAGCTGAAAGTACTAG ATAAGCCAGGTCCTCCAGCATCTGTGAAAATC

AACAAGATGTATGCAGACCGTGCAATGCTGTCCTGGGAACCTCCTCTCGAGGATGGAGGCTCAGAAATCACCAACTACATCATTGACAAGCGTGAAACAA

GCAGGCCCAACTGGGCCCAGGTCTCTGCTACTGTGCCCATCACCAGCTGCACTGTGGAGAAACTTATAGAGGGCCATGAATACCAGTTCCGTATCTGTGC

CGAAAACAAATACGGAGTCGGCGATCCCATCCTCACTGAGCCAGCGATTGCCAAAAACCCATATG ACCCGCCTGGACGCTGTGACCCTCCTGTCATTAG

CAACATCACTAAAGATCACATGACCGTCAGCTGGAAAGCCCCAGCGGATGATGGTGGCTCACCTATCACCGGATACTTGGTTGAAAAGCGGGAAACTCAG

GCAGTCAACTGGACTAAAGTCAACAGAAAACCTGTTATAGAAAGGACATTAAAAGCAACGGGTCTCCAGGAAGGCACGGAGTATGAATTCCGAGTTACGG

CTATCAATAAAGCTGGACCCGGCAAACCCAGTGATGCATCCAAAGCCGTGTATGCTCAAGACCCACTGT ATCCTCCTGGCCCGCCAGCTTTCCCTAAAG

TCTATGATACCACCCGTAGTTCTGTGAGTCTATCATGGGGCAAGCCGGCCTATGATGGCGGCAGCCCTATCATTGGTTATCTTGTGGAAGTAAAGCGAGC

TGATTCTGATCACTGGGTGAGGTGCAATTTGCCAGAGAAGCTCCAGAAGACCCGCTTCGAGGTGACTGGCCTGATGGAAAACACCGAGTATCAGTTCCGA

GTGTATGCCGTTAACAAGATTGGGTACAGCGACCCCAGCGATGTGCCAGATAAACACTGCCCCAAGGACATCCTAA TTCCACCTGAGGGAGAACTTGAT

GCTGAACTAAGGAAAACACTTATCTTACGTGCTGGAGTTACAATGAGACTCTACGTGCCAGTAAAAGGACGGCCACCTCCAAAGATTACTTGGTCTAAAC

CGAACGTCAATCTAAGAGAAAGGATTGGCCTGGATATAAAGTCGACAGACTTTGACACCTTCTTGCGCTGCGAAAATGTGAACAAATATGATGCAGGAAA

ATATATCTTAACCTTGGAGAACAGCTGCGGCAAGAAGGAGTACACTATTGTGGTGAAAGTGCTGG ACACTCCTGGTCCACCTGTCAATGTGACTGTTAA

GGAGGTATCCAAGGACTCTGCATATGTTACCTGGGATCCTCCCATTATTGATGGTGGGAGCCCCATCATAAACTATGTGGTTGAGAAACGGGATGCAGAG

AGGAAGTCCTGGTCGACAGTGACAACCGAGTGCTCGAAGACAAGCTTCAGAGTCTCTAACTTGGAGGAGGGGAAATCCTACTTCTTCAGAGTGTTTGCCG

AAAATGAATACGGCATCGGGGATCCGGGGGAGACACGTGATGCTGTCAAAGCTTCTG AAACCCCGGGACCTGTGGTCGACCTGAAAGCACTGGCTATAA

CTAAGTCATCTTGTACCATCGGCTGGAAGAAGCCTCGAAGTGATGGCGGAAGCAGAATTACTGGCTATGTGGTGGATTTCCTGACAGAAGAAAATAAGTG

GCAACGGGTCATGAAATCACTGAGCCTTCAGTACTCCACAAAGGATCTGAAGGAGGGGAAGGAGTACACCTTCAGAGTGAGTGCAGAGAATGAAAACGGA

GAAGGAACCCCAAGTGAAATTGTGGTTGTGGCCAAGGACGATGTTG TGGCTCCCGATCTTGACTTGAAGGATCTACCTGATCTGTGCTACTTGGCTAAA

GAAAACAGCAACTTCCGTCTCAAGATCCCCATAAAAGGCAAACCAGCACCATCGGTGTCTTGGAAGAAGGGGGAAGATCCCCTAGCAACAGACACAAGAG

TCAGTGTCGAATCAACTGCAGTTAACACAACCCTTGTAGTATATGACTGCCAAAAATCCGATGCTGGAAAATACACAATCACACTCAAGAATGTTGCTGG

CACCAAGGAAGGAACTCTTTCTATAAAGGTTGTTGGCAAGCCTGGCATCCCCACCGGACCAATCAAATTTGATGAAGTCACAGCAGAAGCCATGACCTTG

AAGTGGGGTCCTCCAAAGGATGATGGAGGTTCTGAAATCACCAACTATGTACTAGAGAAGAGAGACTCTGTGAATAACAAGTGGGTGACATGTGCTTCCG

CTGTCCAGAAAACCACCTTTAGAGTAACCAGACTTCACGAGGGCATAGAATACACCTTCAGGGTCAGTGCTGAAAATAAATATGGTGTAGGAGAAGGCCT

AAAGTCAGAGCCAATTGTTGCCAAACATCCATTTG ATGTGCCTGATGCTCCCCCACCTCCCAATATTGTGGATGTCAGACATGATTCAGTATCTCTAAC

ATGGACTGATCCCAAAAAGACTGGTGGCTCACCAATTACAG GGTATCATATTGAATTCAAGGAAAGAAACAGCCTTCTGTGGAAGAGAGCTAACAAGAC

TCCTATAAGGATGAAAGATTTTAAAGTGACAGGATTAACTGAAGGTCTTGAATATGAATTCAGAGTTATGGCTATCAATCTAGCTGGAGTGGGCAAGCCA

AGCCTGCCATCAGAGCCAGTTGTGGCACTTGATCCAATTG ATCCTCCTGGAAAACCTGAGGTTATCAGCGTAACAAGGAATTCAGTGACTCTCATCTGG

ACAGAACCTAAATACGATGGTGGCCATAAATTAACAGGATATATCGTGGAGAAGCGGGATCTACCCTCTAAGTCTTGGATGAAAGCCAACCATGTTAATG

TCCCAGACTGTGCCTTTACTGTAACTGATCTTGTTGAAGGTGGAAAATATGAATTCCGAATCAGAGCAAAGAATACAGCGGGTGCTATTAGTGCTCCATC

AGAGAGCACAGGAACCATTATTTGCAAGGATGAATACG AGGCACCAACCATTGTCCTTGATCCAACAATTAAAGATGGGCTAACAGTCAAGGCAGGGGA

TAGCATTGTTTTAAGTGCCATTAGCATTCTCGGCAAACCCCTTCCAAAGTCAAGCTGGTCCAGGGCAGGAAAAGATATCAGACCATCAGACATAGCTCAA

ATAACTTCAACCCCAACATCTTCTATGCTGACAGTTAAGTATGCCACAAGAAAGGATGCTGGCGAGTATACCATCACCGCTACCAATCCTTTTGGCACAA

AGGAGGAACATGTGAAGGTATCAGTCCTTGATGTACCTGGTCCCCCAGGTCCCATTGAAATCAGTAATGTTTCAGCTGAAAAAGCAACACTTACTTGGAC

ACCTCCCTTAGAAGATGGGGGCTCACCGATTAAAGCTTATGTTCTTGAGAAGAGAGAAACCAGCCGGCTTTTGTGGACAGTGGTTTCTGAAGATATTCAG

GCATGCAGACATGTGGTAACCAAACTCATCCAAGGAAATGAATACCTCTTCCGTGTGTCAGCAGTAAACCATTACGGCAAAGGAGAACCCGTTCAGTCTG

AGCCTGTCAAAATGGTGGACAGATTTG GTCCTCCTGGCCCTCCTGGAAAACCCGAGATCTCAAATGTCACCAAGAACACTGCCACTGTCAGCTGGAAGA

GGCCAACTGATGATGGTGGCAGCGAGATCACAGGATATCATGTAGAAAGGAGAGAAAAGAAAGGCCTGCGGTGGGTGAGAGCAACCAAAACACCAGTTTC

CGATCTCAGGTGCAAAGTAACTGGACTGCAAGAAGGAAATACCTATGAGTTCCGTGTCAGTGCAGAAAACAGAGCCGGGATTGGTCCTCCCAGTGACGCC

TCGAATCCTGTTCTGATGAAAGATGTTGCAT ATCCCCCAGGACCACCTTCAAATGCACATGTCACTGATACCACCAAGAAATCGGCTTCTTTAGCATGG

GGCAAGCCTCATTATGATGGTGGGCTTGAAATCACTGGCTATGTGGTAGAGCATCAAAAAGTAGGAGATGATGCCTGGATCAAAGACACAACAGGAACAG

CCCTCAGAATCACTCAGTTTGTGGTTCCTGATCTTCAGACTAAGGAAAAATACAATTTTAGAATTAGTGCCATCAACGATGCAGGTGTGGGGGAACCAGC

TGTGATTCCAAATGTTGAAATTGTAGAGAAGGAAGTGGCTCCTGATTTTGAGCTAGATGCTGAGCTGCGAAGAACACTTGTGGTTAGGGCAGGGCTCAGT

ATTAGGATTTTTGTGCCAATTAAAGGTCGTCCTGCACCTGAAGTGACATGGACCAAAGATAATATCAACCTGAAGCACCGAGCCAACATCGAAAACACAG

AGTCATTTACTCTTCTCATTATTCCAGAATGTAACAGATATGACACTGGTAAATTTGTGATGACCATCGAAAACCCAGCTGGGAAGAAAAGCGGCTTCGT

TAACGTCAGAGTCCTAGACACACCAGGCCCTGTCCTTAACCTAAGGCCTACAGACATCACAAAGGACAGTGTCACCCTACACTGGGACCTACCTCTGATA

GATGGGGGCTCACGTATAACAAATTATATTGTGGAGAAACGTGAAGCAACCAGGAAATCCTACTCCACAGTCACTACTAAGTGCCATAAATGTACATATA

AAGTGACTGGCTTGACAGAAGGCTGTGAATATTTCTTCAGAGTGATGGCAGAAAATGAATATGGGGTTGGTGAGCCAACGGAAACCACAGAACCTGTGAG

AGCCTCTGAGGCACCGTTACCCCCAGATAGCCTTAACATTATGGACATTACCAAGAACACAGTCAGCCTGGCGTGGCCTAAGCCAAGGCATGATGGTGGG

AGCAAGATCACTGGCTATGTGATTGAAGCCCAGAGAAAAGGGTCTGACCAGTGGACCCACATCTCAACAGTGAAAGGGTTAGAATGTGTGGTGAGGAACC

TAACCGAAGGAGAGGAATATACCTTCCAAGTGATGGCGGTAAACAGTGCAGGCAGGAGTGCCCCTAGAGAGAGCAGACCTGTCATTGTCAAAGAGCAGAC

GATGCTCCCAGAGCTGGATCTCCGTGGCATCTATCAGAAGCTAGTCATTGCCAGAGCTGGTGACAACATCAAAGTTGAAATCCCAGTACTTGGTCGACCC

AAGCCCACAGTCACATGGAAAAAGGGAGACCAAATCCTTAAACAGACACAGAGAGTTAATGTTGAAAACACAGCAACGTCAACCATCTTAAATATCAATG

AGTGTGTCAGAAGTGACAGTGGACCCTATCCATTAACAGCAAAGAACACTGTAGGAGAGGTTGGTGACGTTATAACCATTCAAGTCCATGATATTCCAGG

ACCACCTACTGGACCCATTAAATTTGATGAAGTTTCATCTGACTTTGTAACCTTCTCTTGGGAGCCACCAGAGAATGATGGAGGTGTACCAATAAGCAAC

TATGTAGTAGAGATGAGACAGACAGACAGTACTACATGGGTGGAGTTAGCAACAACTGTTATACGTACTACCTATAAAGCAACTCGTCTGACCACAGGAG

TGGAGTATCAATTCCGTGTAAGGGCTCAAAACAGATATGGAGTTGGACCGGGCATCACATCTGCATCTGTAGTTGCAAACTATCCATTCAAGGTGCCCGG

GCCTCCCGGTACCCCTCAGGTTACTGCAGTCACCAAAGACTCCATGACAATCAGCTGGCATGAACCACTTTCTGATGGTGGAAGCCCCATTTTAGGATAT

CACATTGAAAGGAAAGAACGGAATGGCATCCTCTGGCAGACTGTGAGCAAAGCATTAGTACCAGGCAACATTTTCAAATCAACTGGACTTACCGATGGCA

TTGCTTATGAATTCCGAGTAATTGCAGAAAACATGGCAGGCAAGAGCAAGCCAAGCAAGCCATCTGAACCAATGTTTGCTTTGGATCCCATTGACCCACC

CGGGAAACCAGTTCCTCTAAACATTACAAGACACACAGTGGCACTGAAGTGGGCTAAGCCTGAATATACCGGAGGCTTTAAAATTACTAGCTATGTGGTT

GAAAAGAGGGACCTTCCTAATGGACGATGGCTGAAGGCCAACTTCAGCAACATTTTAGAGAATGAATTTACGGTCAGCGGCCTAACTGAAGATGCTGCAT

ACGAGTTCCGTGTGATTGCCAAAAATGCTGCCGGTGCCATCAGTCCACCGTCTGAGCCATCAGATGCCATCACATGCAGGGACGACCTGGAGGCACCAAG

AATAATGGTGGATGTTAGATTTAAGGATACCATCACATTAAAAGCTGGCGAAGCATTCAAGTTGGAAGCTGATGTTTCAGGTCGCCCACCTCCAACAATG

GAATGGACTAAAGATGGAAAGGAGCTTGAAGGCACAGGGAAATTAGAAATAAAAATTGCAGACTTCTCCACTCATCTGATAAACAAGGATTCCTCAAGAA

CGGATAGTGGGGCTTACATCCTGACAGCAACCAATCCTGGTGGCTTTGCCAAACACATTTTCAATGTCAAAGTTCTTGATAGACCGGGACCACCTGAGGG

ACCTTTGGCTGTGTCTGATGTGACATCAGAGAAGTGTGTGTTGTCATGGTTGCCTCCACTGGACGATGGAGGTGCCAAAATTGATCATTACATCGTACAG

AAACGTGAAACCAGCAGGTTGGCATGGACAAATGTTGCCACAGAAGTCCAAGTAACAAAGCTGAAGGTTACTAAGCTCCTGAAAGGGAATGAATACATAT

TCCGTGTCATGGCAGTAAATAAATACGGGGTTGGAGAGCCACTTGAATCAGAACCTGTGCTTGCAGTGGATCCATATGGACCACCTGACCCACCCAAGAA

CCCGGAAGTTACAACTATCACCAAGGACTCCATGGTCGTCTGCTGGGGGCATCCTGACTCTGATGGTGGAAGTGAAATTATCAACTACATTGTGGAGCGG

CGTGATAAAGCTGGCCAGCGCTGGGTAAAATGCAACAAAAAAGCTCTGACTGACTTAAGATTTAAAGTATCTGGGCTGACAGAAGGACATGAATACGAGT

TCAGAATTATGGCAGAAAACGCAGCTGGAATCAGTGCTCCGAGTGCTACCAGCCCGTTTTATAAAGCTTGCGACACTGTGTTTAAACCTGGCCCACCGGG

TAACCCACGTGTCCTTGATACAAGCAGGTCGTCCATTTCAATTGCGTGGAATAAACCCATTTATGATGGAGGTTCAGAAATCACTGGGTATATGGTTGAG

ATTGCCCTGCCTGAAGAAGATGAATGGCAGGTTGTCACTCCACCAGCTGGGCTCAAGGCAACTTCCTATACCATCACCAGCCTCATAGAGAATCAGGAAT

ATAAAATCCGCATTTATGCCATGAATTCTGAGGGACTTGGGGAACCTGCCCTTGTTCCCGGAACTCCAAAGGCAGAAGAAAGAATGTTGCCTCCAGAGAT

AGAACTGGATGCTGACTTACGCAAAGTTGTCACTATACGAGCCTGCTGCACCTTGAGGCTCTTTGTTCCCATCAAAGGGAGACCAGCACCTGAGGTCAAG

TGGGCCCGAGAGCATGGAGAATCTCTGGACAAGGCTAGCATTGAATCCACAAGCTCTTACACCCTGCTTGTTGTTGGAAATGTTAACAGATTCGACAGTG

GCAAGTACATACTAACGGTAGAAAACAGCTCTGGCAGCAAGTCGGCGTTTGTCAATGTTAGAGTGCTAGATACGCCAGGCCCTCCACAGAATCTAAAGAT

AAAGGAGGTCACAAAGACATCTGTCACATTGACGTGGGAGCCTCCTCTCCTGGATGGAGGCTCAAAAATAAAGAACTATATTGTTGAGAAGCGAGAGTCC

ACAAGAAAGGCATATTCAACCGTGGCAACGAATTGCCATAAGACGTCCTGGAAGGTAGACCAGCTGCAAGAAGGCTGCAGTTACTATTTCCGTGTCCTCG

CTGAAAACGAATATGGCATTGGACTGCCCGCCGAAACAGCTGAGTCTGTGAAGGCATCGGAGCGACCTCTTCCTCCAGGGAAGATAACTTTGACGGATGT

CACACGAAACAGTGTGTCTCTCTCTTGGGAGAAGCCAGAACATGACGGGGGCAGCCGAATTCTAGGCTACATTGTAGAGATGCAGAGCAAAGGCAGTGAC

AGATGGGCCACGTGTGCCACAGTGAAAGTCACAGAAGCCACCATCACCGGCCTGATCCAGGGTGAGGAATACTCTTTCCGTGTTTCAGCGCAGAATGAAA

AGGGCATCAGTGACCCCAGACAACTGAGTGTGCCAGTAATTGCTAAAGACCTTGTTATCCCACCAGCCTTCAAACTCCTCTTCAATACATTCACGGTACT

GGCAGGTGAAGACCTGAAAATTGATGTACCATTCATTGGACGCCCTCCACCAGCTGTCACCTGGCATAAAGATGACATACCTCTGAAGCAAACAACTAGA

GTGAATGCAGAGAGCACGGAAAACAATTCTCTACTGACAATAAAGGAAGCCTGCCGAGAAGATGTTGGACATTACACGGTTAAACTGACTAACTCGGCAG

GTGAAGCCACTGAAACCCTTAATGTTATCGTTCTTGACAAGCCAGGGCCCCCAACAGGACCAGTGAAGATGGATGAAGTGACAGCAGACAGTGTCACTCT

TTCCTGGGAACCACCAAAGTATGATGGCGGAAGCTCTATCAATAATTACATTGTAGAGAAACGAGACACATCCACAACCGCCTGGCAAATCGTGTCAGCT

ACGGTTGCAAGAACAACCATAAAGGCCTGCAGACTAAAGACTGGCTGTGAGTATCAGTTCAGAATTGCAGCAGAAAACAGATATGGGAAGAGTACCTACC

TCAACTCAGAGCCTGTTGTTGCCCAGTACCCATTCAAAGTGCCAGGGCCACCGGGCACACCATTCGTCACGCTTGCCTCCAAAGACAGCATGGAGGTACA

ATGGCATGAGCCAGTCAGTGATGGTGGGAGCAAAGTCATTGGCTACCATCTAGAGCGCAAGGAAAGAAATAGCATCCTCTGGGTCAAGCTGAATAAGACA

CCTATTCCTCAAACCAAGTTCAAGACAACTGGCCTTGAAGAAGGCATTGAATATGAATTTAGAGTGTCTGCAGAGAACATCGTAGGCATCGGCAAGCCAA

GTAAGCCATCAGAATGTTATGCTGCTCATGACCCATGCGATCCACCAGGTCGGCCAGAGGCAATCATTGTCACAAGGAACTCTGTGACTCTTCAGTGGAA

GAAACCCACCTACGATGGTGGAAGCAAGATCACTGGTTACATTGTTGAGAAGAAAGAATTGCCTGATGGCCGCTGGATGAAAGCCAGTTTTACAAATATC

ATTGACACCCAGTTTGAGGTAACTGGCCTACTGGAAGATCATAGATATGAGTTTCGAGTTATAGCTCGAAATGCTGCAGGAGTTTTCAGTGAGCCCTCAG

AAAGTACAGGGGCAATCACAGCAAGAGATGAGGTTGAGCCACCCAGAATAAGCATGGACCCCAAATACAGGGACACGGTTGTGGTTCAAGCTGGTGAGTC

ATTCAAGATCGATGCAGATATATATGGCAAACCAATACCGACCACTCAGTGGGTAAAGGGTGACCAGGAGCTTTCAAGCACAGCTCGGTTAGAAATTAAG

AGCACCGACTTTGCCACCAGTCTCAGTGTCAAAGATGCGGTACGTGTGGATAGTGGCAATTATATCCTAAAGGCCAAAAACGTTGCAGGGGAGAAATCAG

TTACTATCAATGTCAAAGTTCTCGATAGACCAGGGCCACCTGAGGGACCTGTTGCTATATCAGGGGTTACAGCAGAAAAATGTACTCTAGCTTGGAAACC

CCCACTTCAGGATGGTGGGAGTGACATCACAAATTACATTGTGGAAAGGCGAGAAACCAGCCGCCTCGTCTGGACTCTGGTTGATGCCAATGTGCAAACG

CTCAGCTGTAAAGTCCTGAAGCTTCTTGAGGGCAATGAATATATTTTCCGTATAATGGCTGTGAACAAATACGGTGTTGGTGAACCTCTTGAATCTGAGT

CATTGATTGCCAAGAATCCATTTGTAGTCCCAGATGCACCCAAAGCTCCAGAAGTTACAGCTGTGACCAAAGACTCAATGATTGTTGTATGGGAAAGGCC

AGCGTCTGATGGTGGCAGTGAGATTCTAGGATATGTTCTAGAAAAACGGGACAAAGAAGGCATAAGATGGACAAGATGCCACAAGCGTCTAATTGGAGAG

CTGCGCCTGAGAGTGACTGGACTGTTAGAAAATCACAATTATGAATTCAGAGTCTCCGCTGAAAATGCTGCTGGACTTAGTGAACCAAGCCCCCCTTCTG

CTTACCAGAAGGCATGTGACCCCATTTATAAGCCAGGCCCTCCAAACAACCCCAAAGTCATGGATGTTACCAGATCTTCGGTTTTCCTTTCTTGGACCAA

ACCTATCTATGATGGTGGCTGTGAAATCCAAGGATACATCGTAGAAAAATGTGATGTGAGTGTTGGTGAATGGACAATGTGTACGCCACCAACTGGAATC

AATAAGACAAATCTAGAAGTCGAGAAGTTGTTGGAAAAGCATGAATACAACTTCCGGATCTGTGCCATTAATAAGGCCGGAGTAGGGGAGCATGCTGATG

TCCCTGGGCCTGTAATGGTTGAAGAAAAACTTGAAGCACCTGATATAGACCTTGACCTTGAACTAAGGAAAGTGATTAATATAAGGGCAGGTGGTTCCTT

AAGGCTGTTTGTTCCTATAAAAGGCCGTCCTACACCAGAAGTCAAGTGGGGGAAGGTTGATGGTGATATCCGGGACGCAGCTATAATTGATGTCACTAGC

AGCTTCACCTCTCTTGTTCTTGACAATGTCAATCGATATGATAGTGGAAAATACACTCTCACACTAGAAAACAGCAGTGGAACAAAATCTGCCTTTGTGA

CGGTAAGGGTCCTGGACACACCAAGCCCACCTGTCAACTTAAAAGTCACAGAAATCACCAAGGACTCGGTATCAATTACATGGGAACCTCCTTTGTTGGA

CGGAGGATCAAAAATTAAAAATTACATTGTTGAGAAACGAGAAGCCACAAGAAAATCCTATGCTGCAGTTGTAACAAACTGCCATAAGAATTCGTGGAAA

ATCGATCAGCTCCAAGAAGGTTGCAGTTACTACTTCAGGGTTACCGCTGAGAACGAATACGGTATTGGCTTGCCTGCCCGCACTGCAGATCCAATCAAGG

TTGCAGAAGTCCCACAACCTCCAGGGAAAATAACTGTGGATGATGTCACCAGAAACAGTGTCTCTCTCAGTTGGACAAAGCCCGAACATGACGGTGGCAG

TAAAATCATCCAGTATATCGTAGAAATGCAAGCTAAAAACACTGATAAGTGGTCAGAGTGTGCTAGGGTGAAGTCCCTTGACGCAGTTATTACCAACCTA

ACTCAGGGAGAAGAATACCTTTTCAGAGTCATTGCTGTAAATGAAAAAGGAAGAAGCGACCCCAGGTCCCTTGCGGTTCCAATCATCGCCAAAGATCTGG

TCATCGAGCCAGACGTGAGACCAGCATTCAGCAGTTACAGTGTACAGGTTGGCCAAGACTTGAAAATAGAAGTGCCAATTTCTGGACGTCCTAAACCAAG

CATTTCCTGGACTAAGGATGGGATGCCATTGAAGCAGACCACAAGAATCAATGTTACCGACTCCCTGGACCTCACCACACTCAGCATTAAAGAAACTCAT

AAGGATGATGGTGGACAGTATGGAATCACAGTTTCCAATGTGGTGGGTCAGAAAACAGCAGCTATTGAAATCATAACTCTAGATAAACCTGATCCTCCAA

AAGGGCCTGTTAAATTTGATGAGATCAGTGCTGAGAGCATCACATTATCCTGGAACCCTCCCTTATATACAGGGGGCTGTCAAATTACCAACTACATTGT

TCAGAAAAGAGACACAACCACCACAGTATGGGATGTCGTCTCTGCTACTGTTGCCAGAACGACCCTCAAAGTAACCAAGCTGAAAACGGGTACAGAATAC

CAATTCAGAATATTTGCTGAAAACCGATACGGACAAAGCTTTGCTCTGGAGTCTGAGCCAGTTGTAGCTCAATATCCCTACAAAGAACCAGGCCCTCCAG

GAACGCCATTTGTCACAGCCATCTCCAAAGAGTCTATGGTGGTACAGTGGCATGAACCGATCAATAATGGTGGAAGCCCAGTCATAGGTTACCACCTTGA

GAGAAAGGAAAGGAATAGTATTTTGTGGACAAAAGTCAACAAAACCATTATTCATGACACCCAGTTTAAAGCACTGAACCTTGAAGAAGGCATTGAGTAT

GAATTTAGAGTTTATGCTGAAAATATTGTTGGGGTAGGCAAGGCAAGCAAGAATTCTGAATGCTATGTAGCCAGAGACCCCTGTGACCCACCAGGTACCC

CAGAAGCAATAATAGTTAAGAGAAATGAAATCACTTTACAGTGGACCAAGCCTGTGTACGATGGTGGCAGTATGATCACAGGTTACATCGTAGAGAAACG

TGATTTACCCGAGGGTCGCTGGATGAAAGCCAGTTTCACAAATGTCATTGAAACTCAATTCACCGTGTCAGGTCTTACTGAAGATCAAAGATATGAATTC

AGAGTCATTGCAAAGAATGCAGCTGGGGCAATAAGTAAACCCTCTGACAGTACTGGACCAATAACTGCCAAGGATGAGGTTGAACTCCCACGAATTTCAA

TGGATCCAAAATTCAGAGACACAATAGTGGTAAATGCTGGAGAAACATTCAGGCTTGAGGCCGATGTCCATGGAAAACCCCTACCCACCATTGAGTGGTT

AAGAGGAGACAAGGAAATTGAAGAATCTGCCAGGTGTGAAATAAAGAACACAGATTTCAAAGCTTTACTTATTGTAAAAGATGCCATTCGAATTGATGGT

GGACAGTATATTTTAAGAGCCTCGAATGTTGCCGGGTCTAAGTCATTTCCAGTAAATGTGAAAGTGCTAGACAGACCAGGACCACCAGAAGGGCCAGTTC

AGGTTACTGGAGTCACAGCTGAAAAGTGCACTTTGGCATGGTCTCCACCACTTCAAGATGGTGGCAGTGACATTTCTCACTACGTGGTAGAAAAGCGAGA

AACCAGTCGACTTGCATGGACTGTGGTTGCTTCAGAAGTTGTGACTAATTCTCTGAAAGTTACCAAGCTCTTAGAAGGGAATAAATATATTTTCCGAATA

ATGGCTGTCAACAAGTACGGTGTCGGGGAACCTTTGGAATCTGCTCCAGTACTCATGAAAAATCCATTTGTGCTTCCTGGACCACCAAAGAGCTTAGAAG

TCACAAACATTGCCAAAGACTCCATGACAGTCTGCTGGAATCGGCCAGACAGTGATGGTGGCAGTGAGATCATTGGTTACATTGTGGAGAAGAGAGACAG

AAGTGGCATTCGGTGGATCAAGTGTAACAAACGCCGCATTACAGATTTGCGACTCAGGGTGACAGGATTAACAGAAGACCATGAGTATGAATTCAGAGTC

TCTGCAGAAAATGCTGCTGGAGTTGGAGAACCAAGTCCTGCTACCGTTTACTATAAGGCATGTGATCCTGTGTTCAAACCTGGCCCACCCACCAATGCAC

ACGTTGTAGACACCACTAAAAATTCAATTACACTTGCCTGGAGCAAACCTATCTATGATGGCGGCAGTGAGATCCTGGGCTACGTTGTAGAAATCTGTAA

AGCTGATGAAGAAGAATGGCAAATAGTTACTCCACAGACTGGCCTGAGAGTCACTCGATTTGAAATTGCCAAACTAATCGAACACCAAGAATATAAAATA

CGAGTTTGCGCCCTCAACAAAGTTGGTTTAGGTGAGGCTGCCTCAGTTCCTGGTACGGTGAAACCGGAAGATAAACTCGAGGCACCTGAACTTGACCTTG

ACTCTGAGTTAAGGAAAGGGATCGTTGTCAGAGCTGGTGGATCTGCCAGAATCCATATTCCATTCAAGGGTCGTCCAACGCCTGAGATCACTTGGTCAAA

AGAGGAAGGTGAATTCACAGATAAGGTCCAAATTGAGAAGGGAATTAACTTCACCCAACTCTCAATAGATAACTGTGACAGAAACGACGCCGGGAAATAC

ATCCTCAAGTTGGAGAACAGCAGCGGATCAAAGTCGGCTTTCGTAACCGTGAAAGTACTTGACACACCAGGACCGCCACAGAATCTGGCTGTCAAGGAAG

TGAGAAAAGACTCTGTCCTTCTGGTATGGGAGCCACCTATCATTGACGGTGGGGCAAAGGTCAAGAACTATGTCATCGACAAGCGCGAGTCCACTCGAAA

AGCATATGCTAACGTGAGTAGTAAATGCAATAAAACGAGCTTCAGAGTCGAGAACCTGACCGAAGGAGCCATCTACTACTTTAGAGTCATGGCAGAGAAT

GAATTTGGGGTTGGTGTTCCCACGGAGACATCTGATGCTGTGAAAGCTTCTGAGCCTCCTTCCCCACCAGGAAAGGTCACACTCACTGACGTGTCCCAGA

CCAGTGCATCCCTTATGTGGGAGAAACCCGAGCATGATGGAGGGAGCAGAATTCTGGGCTATGTTGTTGAAATGCAGCCCAAAGGAACAGAAAAGTGGAG

CGTTGTGGCTGAATCCAAAGTCTGTAATGCAGTGGTTAGTGGCCTGAGCTCCGGGCAAGAATATCAGTTCCGTGTCAAAGCTTACAATGAGAAAGGAAAA

AGTGACCCGAGAGTGCTTGGCATTCCTGTCATAGCCAAGGACTTGACCATCCAGCCTAGTTTTAAGCTGCCATTTAATACATATAGTGTCCAAGCGGGAG

AGGATCTGAAAATAGAAATTCCAGTCATAGGCAGACCAAGACCTAAAATTTCTTGGGTCAAAGATGGTGAGCCTCTTAAACAGACCACCAGAGTAAATGT

TGAAGAAACGGCTACTTCGACTATTTTACACATTAAAGAAAGCAGCAAAGATGACTTCGGGAAATACAGTGTCACAGCAACAAACAGTGCAGGCACAGCA

ACAGAAAACCTCAGTGTTATTGTTTTAGAAAAGCCTGGTCCTCCCGTTGGACCAGTGAAGTTTGATGAAGTTAGTGCAGACTTTGTGGTCATATCTTGGG

AACCTCCCGCCTATACTGGTGGGTGCCAAATCAGCAACTACATTGTAGAGAAGCGAGATACTACCACTACCAACTGGCAGATGGTGTCAGCAACAGTTGC

CAGGACAACCATTAAAATAAGCAAACTGAAAACAGGCACCGAATACCAGTTTAGGATTTTTGCTGAGAACAGGTATGGGAAAAGCACTCCCCTGGATTCT

AAGCCCGTTGTTGTACAATATCCATTTAAAGAGCCTGGACCACCTGGAACCCCTTTTGTAACATCTATCTCCAAAGATCAAATGCTTGTGCAGTGGCATG

AGCCAGTTAATGATGGAGGCAGCAAAGTGACTGGCTACCATCTTGAACAGAAGGAAAAGAATAGCATCCTGTGGGTCAAGTTGAATAAGATCCCCATCCA

AGACACCAAATTCAAAACAACGGGGCTTGATGAAGGGCTTGAATATGAGTTCAGGGTTTCTGCCGAGAACATTGTGGGCATTGGCAAGCCTAGCAAAGTG

TCAGAGTGCTATGTTGCGCGTGATCCGTGTGACCCACCTGGTCGACCTGAAGCCATCGTCATTACAAGAAACAGCGTCACGCTGAAATGGAAGAAACCTG

TTTATGATGGTGGCAGCAAGATAACGGGTTACATCGTAGAAAAGAAAGACCTTCCTGACGGCCGGTGGATGAAAGCCAGCTTCACCAATGTTGTGGAAAC

TGAGTTTACAGTGACTGGGCTTGTAGAAGACCAAAGATATGAATTTAGAGTCATTGCAAGAAATGCGGCTGACAACTTTAGTGAGCCATCTGAAAGCAGT

GGCGCCATCACTGCAAGGGATGAAATCGATGCACCAAATGCCTCGCTGGATCCTAAATACAGAGATGTCATCATTGTTCATGCAGGAGAGACCTTTGTTC

TCGAAGCTGATATCCGTGGCAAACCCATACCTGACATCATATGGTCAAAAGATGGGAACGAACTCGAAGAAACAGCAGCTAGGATGGAAATTAAATCTAC

TCTGCAGAAAACGACTCTCATTGTCAAGGACTGTATACGCACCGATGGGGGACAGTATACCTTGAAACTCAGCAATGTCGGGGGCACCAAGACTATACCT

ATTACCGTGAAGGTGCTGGATAGGCCAGGGCCTCCCGAAGGACCTCTGAAAGTTACTGGAGTTACAGCCGAAAAGTGTTACCTGGCATGGAACCCACCTT

TGCAAGATGGTGGTGCTAGTATTTCACATTACATCATTGAAAAGAGAGAGACAAGCAGACTCTCCTGGACCCAGGTTTCAAATGAAGTACAGGCCCTCAA

CTACAAAGTCACGAAGTTGCTTCCTGGGAACGAGTATATTTTCCGGGTTATGGCAGTGAATAAATATGGAATTGGAGAGGCCCTGGAGTCTGAACCGGTG

ATAGCCTGTAACCCATACAAGCGTCCAGGTCCTCCTTCAACACCCGAGGCCTCAGCCATCACCAAAGACTCTATGGTACTAACATGGACACGTCCAGTGG

ATGACGGAGGTGCTGAAATTGAGGGGTACATTCTTGAAAAGCGAGATAAGGAAGGCATCAGATGGACCAAGTGCAACAAGAAAACATTAACAGACCTTCG

GTTCAGGGTGACAGGCCTCACAGAAGGCCACTCCTATGAATTCAGAGTTGCTGCTGAGAACGCAGCTGGTGTCGGGGAACCCAGTGAGCCGTCCGTTTTC

TACCGTGCATGTGATGCCTTGTATCCACCAGGTCCACCAAGCAACCCCAAAGTGACAGACACCTCCAGGTCTTCTGTCTCCCTAGCATGGAATAAGCCAA

TTTATGATGGTGGTGCACCCGTTAGAGGATATGTGATTGAGCTCAAAAAAGCTGCGGCTGACGAATGGACTACCTGTACGCCACCATCGGGATTACAAGG

GAAGCAGTTCACAGTGACCAAGCTTAAGGAGAATACAGAGTACAACTTCCGCATCTGTGCTTTCAATACTGAAGGTGTAGGTGAGCCTGCAACGATACCA

GGCTCCGTTGTTGCTCAGGAGAGGATGGAAGCACCAGAAATAGAACTGGATGCTGATCTCAGAAAGGTGGTCACTCTGCGTGCAAGTGCCACTTTGCGCC

TATTTGTCACTATCAAAGGCCGCCCAGAACCTGAAGTTAAGTGGGAAAAGGCTGAAGGCATTCTCACGGAAAGAGCCCAGATCGAGGTGACGAGTTCTTA

TACAATGCTGGTGATTGACAACGTGACCAGATTTGACAGTGGTAGATACAACCTCACCCTAGAAAACAACAGTGGCTCCAAAACGGCTTTTGTCAATGTC

AGAGTTCTTGACTCACCAAGCGCACCCGTGAATCTGACCATAAGAGAAGTGAAGAAAGACTCGGTGACGCTGTCCTGGGAGCCACCACTTATTGACGGTG

GAGCAAAGATTACAAATTATATCGTTGAAAAACGAGAAACTACAAGAAAAGCTTACGCTACCATTACAAACAACTGCACTAAGAATACTTTCAAAATCGA

AAATCTACAAGAAGGGTGTTCTTATTACTTCCGAGTCCTGGCTTCTAATGAATATGGGATTGGTTTGCCAGCCGAAACAGCAGAGCCTGTCAAAGTGTCC

GAACCACCACTCCCACCTGGAAGGGTAACCCTTGTAGATGTGACCCGTAATACAGCTACGATTAAGTGGGAGAAGCCAGAGAGCGATGGCGGCAGCAAGA

TCACTGGTTATGTTGTGGAAATGCAGACAAAGGGCAGTGAAAAGTGGAGCGCATGCACACAAGTGAAGACTTTGGAGACAACTATATCTGGCCTAACTGC

AGGGGAAGAGTATGTCTTCAGGGTAGCTGCAGTTAATGAAAAAGGAAGAAGCGACCCAAGACAGCTTGGGGTGCCAGTCATTGCAAAAGACATTGAAATA

AAGCCCTCCGTTGAGCTTCCTTTTAATACTTTCAACGTTAAGGCTAATGACCAACTCAAAATTGACATACCATTTAAAGGAAGACCTCAAGCTACCGTGG

CCTGGAAAAAAGATGGTCAGGTCCTTAGAGAGACAACTAGAGTCAACGTAGCTTCCTCAAAGACCGTAACAACCCTATCTATTAAAGAAGCCTCAAGGGA

AGATGTTGGAACTTACGAACTATGTGTTTCAAATACTGCTGGATCCATAACAGTTCCTATTACTGTCATTGTCCTTGACAGGCCAGGACCTCCAGGACCC

ATACGAATTGATGAAGTTAGTTGTGACAATGTGTCTATTTCTTGGAATCCTCCAGAGTATGATGGTGGCTGCCAAATTAGCAACTACATTGTTGAAAAGA

GAGAAACCACTTCTACAACGTGGCAGGTAGTTTCACAAGCAGTGGCAAGAACATCCATTAAGATAGTCCGTCTGACAACAGGAAGTGAGTATCAGTTCCG

TGTCTGTGCAGAGAATCGGTATGGAAAGAGTTCCTACAGTGAGTCCTCAGCCGTTGTCGCTGAGTATCCATTCAGCCCTCCTGGGCCTCCTGGTACTCCT

AAAGTTGTGCATGCCACAAAATCTACCATGGTTGTAAGCTGGCAAGTACCAGTTAATGACGGAGGGAGCCAAGTGATTGGCTATCACCTTGAATACAAAG

AAAGAAGCAGCATTCTCTGGTCAAAAGCAAACAAAGTCCTCATTGCAGATACTCAGATGAAGGTCTCTGGTCTGGATGAGGGGCTGATGTACGAGTATCG

TGTATATGCTGAGAATATCGCTGGAATTGGTAAATGCAGTAAAGCCTGTGAACCGGTCCCTGCAAGAGACCCTTGTGACCCTCCTGGACAACCTGAAGTC

ACCAATATCACAAGAAAATCAGTGTCACTTAAGTGGTCTAAACCACGTTATGATGGTGGAGCGAAGATCACCGGATACATTGTTGAACGCAGAGAGCTAC

CGGACGGCAGGTGGCTGAAGTGCAATTTCACCAACGTTCAGGAAACATACTTTGAAGTAACTGAGCTAACTGAAGACCAGCGTTATGAATTCCGGGTTTT

TGCAAGAAATGCTGCTGATTCAGTCAGTGAGCCATCTGAATCCACTGGACCTATCACGGTGAAAGACGACGTTGAGGCGCCAAGAATTATGATGGATGTC

AAATTCCGAGATGTCATCATTGTCAAGGCCGGAGAAGTCCTTAAGATAAATGCAGACATTGCAGGGCGACCTCTGCCGGTAATTTCCTGGGCCAAAGATG

GGGTAGAAATTGAAGAAAGGGCAAAAACAGAAATTGTCTCAACAGACTATACTACCACATTAACAGTTAAAGACTGTGTAAGAAGAGACACTGGGCAGTA

TGTCCTTACACTGAAGAATGTGGCAGGAACTCGGACTATGGCAGTTAACTGTAAAGTACTTGATAAGCCTGGCCCGCCAGCAGGGCCACTTGAAATAAAT

GGCCTCACTGCTGAGAAGTGCTCCCTTTCCTGGGGACGTCCCCAGGAAGATGGCGGTGCAGATATTGATTATTATATCGTAGAAAAACGTGAAACAAGCC

GCCTTGCATGGACCATATGTGAAGCAGAGTTAAGGACAACATCTTGTAAAGTGACCAAGCTACTCAAAGGCAACGAATATATCTTCAGAGTAACTGGTGT

TAATAAATATGGTGTTGGTGAGCCCTTGGAGAGCATGGCCGTGAAGGCGCTAGATCCATTCACCACTCCTAGCCCACCCACATCTTTGGAAATTACATCT

GTGACCAAAGATTCCATGACACTTTGCTGGTCAAGACCTGAGACTGATGGAGGCAGTGACATCTCTGGATACATAATCGAAAGGCGTGAGAAAAACAGTC

TACGGTGGATGCGTGTGAACAAGAAGCCAGTGTATGATCTGAGAGTGAAGTCCACAGGACTCCGAGAAGGATGTGAATATGAGTATCGGGTTTTTGCTGA

AAATGCTGCCGGCCTGAGTCTTCCAAGTGAAACTTCTCCCTTGGTTCGAGCAGAAGACCCTGTGTTCTTGCCATCTCCTCCATCTAAACCCAAAATAGTG

GACTCGGGCAAGACAACAATCACCATTGGCTGGGTTAAACCTTTGTTTGACGGTGGGGCTCCAATAACGGGATATACCGTAGAATACAAAAAGTCTGAGG

AAACCGACTGGAAAGTTGCCATTCAGAGCTTCAGAGGCACAGAATACACAATGAGTGGGCTAACAACAGGAGACGAGTATGTTTTTAGAGTGAGGTCACT

CAATAAGATGGGTGCCAGTGACCCCAGTGATAGCTCCGATCCCCAGGTAGCCAAAGAGAGAGAAGAAGAACCTGTATTTGACGTTGACAGTGAGATGAGG

AAGACCTTGATTGTCAAGGCTGGGTCCTCGTTTACCATGACAGTTCCTTTCAGAGGAAGACCAATCCCCAACGTCTCCTGGAGTAAGCCCGACACCGACC

TCCGCACGAGAGCGTACATCGACTCCACAGATTCTCGTACATTACTTACTATTGAGAATGCCAACAGAAATGATTCTGGAAAATACACGCTGACAATTCA

GAATGTGCTGAGCGCTGCTTCCATGACCTTCGTCGTCAAAGTCTTAGATTCCCCGGGGCCTCCAGCCAATATTACTGTACGTGAAGTAACCAAGGAAACT

GCTATGCTGTCCTGGGATGTTCCTGAAAATGATGGCGGAGCACCGGTGAAGAATTACCACATAGAAAAACGTGAGGCCAGCAAGAAGGCGTGGGTGTCGG

TCACTAACAACTGCAACCGCCTCTCTTACAAAGTGACCAACTTACAGGAAGGAGCTATCTACTACTTCCGAGTCTCTGGGGAGAACGAGTTTGGTGTTGG

TGTGCCAGCTGAGACAAAGGAAGGAGTCAAAATAACAG AAAAACCAAGCCCACCAGAAAAGCTTGGTGTAACAAGTGTATCCAAAGACAGTGTCTCATT

GAGCTGGCTGAAGCCAGAACACGACGGTGGTAGCAGAATCATACACTATGTCGTCGAAGCACTTGAAAAAGGACAGAAAACGTGGGTTAAGTGCGCTGTG

GTGAAGACAACCCACCACGTTGTTTCCGGTCTGAGAGAGAGTCATGAGTACTTCTTCCGGGTCTTTGCAGAAAACCAAGCTGGTCTGAGTGACCCCAGGG

AGCTCCTGCTTCCTGTCCTCATCAAGGACCAGCTAG AACCACCCGAAATTGATATGAAGAATTTCCCAAGTCACACTGTGTATGTAAGAGCTGGTTCCA

ACCTTAAAGTTGACATTCCAATTTCTGGAAAACCATTACCCAAAGTGACCTTATCAAGAGATGGTGTACCACTGAAGGCCACCATGAGATTTAATACTGA

GATTACCGCTGAGAACCTGACCATCAATCTCAAAGAAAGTGTTACCACTGACGCTGGAAGATATGAGATCACTGCTGCCAACTCCAGTGGAACCACCAAA

ACTTTCATTAACATCATTGTGCTGGACAGGCCTGGACCCCCTACTGGCCCTGTAGCCATTAGTGATATAACTGAAGAAAGTGTGACTCTCAAATGGGAGC

CACCAAAGTATGATGGCGGAAGCCACGTCACCAATTACATTGTCCTGAAGAGAGAAACAAGTACTGCAGTGTGGTCTGAAGTGTCAGCAACAGTAGCAAG

AACCATGATTAAAGTCATGAAACTAACCACAGGAGAAGAATACCAATTCCGCATCAAGGCAGAAAATCGCTTCGGCATCAGTGATCATATAGATTCAGTG

TGTGTGGTTGTCAAACTACCATACA CTACACCTGGACCACCATCTACACCCTGGGTATCTAACGTTACTCGAGAAAGCATCACTGTGGGTTGGCACGAA

CCAGTGTCCAATGGAGGTAGTGCAGTCACGGGCTACCACCTGGAAATGAAAGACAGAAATAGTATTTTGTGGCAGAAAGCCAACAAAATGATCATCCGTA

CAACTCACTTCAAAGTTACAACAATCAGCGCTGGACTTATTTATGAATTCAGGGTGTATGCAGAGAATGCTGCTGGTATCGGAAAGCCCAGTCACCCATC

TGAACCAGTCTTGGCCATTGATGCCTGCG AACCCCCAAGAAATGTGCGGATCACTGATATCTCAAAGAACTCTGTCAACCTTTCATGGCAACAACCAGC

TTTTGATGGAGGAAGCAAGATTACAGGCTACATTGTTGAGAGGCGCGACCTTCCAGATGGGAGATGGACCAAGGCTAGCTTCACCAATGTTATTGAGACT

CAATTCACTGTCTCTGGATTGACTCAGAATTCCCAGTATGAATTCCGGGTCTTTGCTAGAAATGCTGTTGGTTCTGTCAGCAACCCATCTGAGGTTGTAG

GCCCCATCACATGCATTGACTCTTATG GTGGGCCTGTGATTGACTTGCCTCTAGAATATACAGAAGTTGTCAAATATAGAGCAGGTACCTCCGTGAAGC

TCAGAGCTGGTATTTCCGGCAAACCCGAGCCTACGATTGAGTGGTACAAAGATGATAAAGAATTACAAACCAATGCATTGGTGTGTGTGGAAAATAGCAC

TGACCTTGCATCTATACTCATCAAAGATGCCAACCGCCTTAACAGTGGAAGCTATGAGTTGAAACTGAGGAATGCCATGGGTTCCGCCTCAGCCACCATC

AGAGTACAGATCCTTG ACAAACCAGGACCTCCAGGCGGACCAATTGAATTTAAGACTGTCACTGCAGAAAAGATAACTCTGCTCTGGAGGCCCCCAGCT

GACGACGGTGGCGCAAAGATCACGCACTACATCGTGGAAAAACGGGAGACAAGCCGAGTCGTGTGGTCTATGGTGGCTGAAAATCTGGAAGAGTGCATCG

TTACAACTACCAAAATTATCAAAGGGAATGAGTACGTCTTCCGAGTCCGAGCTGTGAATAAGTATGGAATTGGCGAGCCGCTAGAATCTGAGCCAGTTGT

AGCCAAGAATGCCTTTG TTACACCTGGGCCTCCAAGCATCCCAGAGGTGACAAAGATTACCAAGAATTCAATGACTGTTGTCTGGGACAGGCCAACTGT

AGATGGTGGCAGTGAAATAAATGGCTATTTCCTTGAAAGACGAGACAAGAAGAGTCTAGCGTGGCTTAAAGTATTAAAGGAGACTATTCGTGACACCAGA

CAAAAGGTGACAGGACTCACGGAAAACAGTGACTATCAGTATCGAGTCTGTGCTGTAAATGCTGCTGGAGTGGGTCCATTCTCAGAACCATCCGACTTCT

ACAAGGCTGCTGATCCAATTG ATCCTCCAGGACCACCTGCCAAGATAAGAATTGCAGACTCGACCAAATCATCCATCACCCTTGGCTGGAGTAAGCCTG

TCTATGATGGTGGCAGTGATGTTACTGGATATGTGGTTGAGATGAAACAAGGAGATGAAGAAGAATGGACCATTGTCTCTACCAGGGGAGAGGTCAGAAC

TACAGAATATGTGGTCTCTAACCTGAAACCCGGAGTCAATTATTATTTCCAAGTATCAGCAGTAAACTGTGCCGGCCAAGGAGAACCTATAACAATGACT

GAACCTGCACAGGCTAAAGATGTCCTTG AGGAACCAGAAATCGACCTAGATGTGGCTCTCAGAACATCTGTTATAGCTAAAGCTGGTGAAGATGTCCAA

CTACTGATTCCCTTTAAAGGCAGACCGCCACCTACTGTCACCTGGAGGAAAGATGAGAAGAATCTTGGCAGCGATACCAGATACAGCATCCAAAACACTG

ATTCGTCTTCTTTGCTTGTTATTCCTCAAGTCACTCGCAATGATACAGGAAAATACATCCTGACAATAGAAAACGGAGTAGGCCAACCAAAGTCTTCCAC

CGTGAGTGTTAAGGTGCTCGACACACCAGCTGCCTGCCAGAAGTTACAGGTGAAACATGTTTCCCTAGGCACAGTCACATTGCTCTGGGATCCTCCTCTC

ATCGATGGAGGGTCTCCCATCATTAACTATGTCATCGAAAAGAGAGATGCCACGAAGAGAACATGGTCTGTTGTGTCACACAAGTGTTCCGGCACATCCT

TTAAAGTAACAGATTTATCAGAGAAGACTCCATTCTTCTTCAGGGTTCTTGCAGAAAATGAAATTGGCATTGGTGAGCCTTGCGAGACCACGGAGCCCGT

GAAGGCTGCTGAGGTGCCAGCACCTATCCGAGATCTCTCAATGAAAGATTCCACAAAGACATCTGTTGTCCTGAGCTGGACCAAGCCTGACTTTGATGGT

GGGAGCATCATCACAGACTATCTGGTGGAACGGAAAGGCAAAGGTGAACAAGCATGGTCCCATGCTGGCATCAGTAAGACATGTGAGATTGAGATTGGAC

AACTTAAAGAGCAATCAGTCTTGGAATTCCGAGTGTCTGCTAGAAATGAGAAAGGACAGAGCGACCCTGTCACTATTGGGCCACTTACAGTGAAGGAGCT

TGTAATTACACCTGAAGTTGACTTGTCAGAAATCCCTGGGGCACAAATATCTGTGAGAATTGGACATAACGTACACCTTGAATTACCTTATAAAGGAAAA

CCCAAGCCATCCATCAGTTGGCTGAAAGATGGCTTGCCACTGAAGGAAAGTGAATATGTTCGTTTCAGTAAGACAGAAAACAAAATCACCTTGAGTATTA

AGAATTCGAAGAAAGAGCATGGAGGGAAATATACTGTTATTCTTGATAATGCAGTGTGTAGAAACTCATTCCCCATTACAATCATCACCCTCGGCCCACC

GTCAAAGCCCAAAGGACCCATTAGATTTGATGAAATCAAGGCTGACAGCGCCATCATGTCATGGGACATACCTGAAGATGACGGAGGAGGAGAAATCACC

TGTTACAGCATTGAGAAGCGGGAAGCATCACAAACAAATTGGAAGATGGTGTGTTCAAGTGTTGCCAGAACAACTTTCAAAGTTTCCAATCTGGTCAAAG

ATTCTGAATACCAGTTTAGAGTTAGAGCAGAAAATAGATATGGAGTCAGTGAGCCACTTGCCTCAAATATCATCGTGGCAAAACACCAATTCAGGATTCC

TGGTCCTCCAGGAAAGCCAGTCATCTACAATGTAACTTCGGATGGCATGTCACTAACTTGGGATGCACCAGTTTATGATGGTGGTTCAGAAGTTACTGGA

TTCCATGTTGAAAAGAAAGAAAGAAACAGCATTCTTTGGCAAAGGGTTAACACATCACCAATATCTGGGAGAGAATACAGAGCTACTGGCTTAATAGAAG

GGCTGGACTATCAATTCCGTGTATATGCTGAGAATTCTGCTGGCCTGAGCTCACCTAGTGACCCAAGCAAGTTTACATTAGCTGTTTCCCCAGTAG ACC

CACCCGGCACTCCTGACTACATTGATGTCACCCGGGAAACCATCACACTTAAATGGAACCCACCATTACGTGATGGGGGCAGTAAGATCGTGGCCTACAG

CATTGAGAAGCGGCAAGGAAGTGACCGCTGGGTGAGATGCAACTTCACTGACGTCAGTGAGTGTCAGTACACAGTTACGGGACTCAGTCCTGGAGATCGA

TATGAGTTCAGAATAATTGCAAGAAATGCTGTTGGCACTATAAGCCCCCCCTCACAGTCTTCTGGCCTCATTATGACAAGAGATGAAAACG TTCCACCA

ACAGTAGAATTTGGCCCTGAGTACTTCGATGGTCTTGTTATTAAGTCTGGAGACAGTCTTAGGATCAAAGCTTTGGTTCAAGGACGACCGGTCCCACGAG

TAACTTGGTTCAAAGATGGAGTTGAAATTGAGAGGAGAATGAACATGGAAATAACTGATGTTCTTGGCTCTACCAGCCTCTTTGTCAGAGACGCAACTCG

AGATCACCGTGGTGTTTACACCGTGGAAGCCAAAAATGTATCTGGTTCCACAAAAGCAGAAGTTACAGTGAAAGTACAAG ATACACCAGGAAAAGTAGT

CGGGCCAATAAGATTTACTAATATTACTGGTGAAAAGATGACCCTGTGGTGGGAGGCACCTCTCAATGACGGCTGCGCTCCTGTCACGCACTACATCATT

GAAAAGCGTGAAACCAGCAGACTTGCTTGGGCATTGATTGAGGATAATTGCGAAGCCCTAAGTTACACTGCCATTAAACTAATCACTGGCAATGAGTATC

AGTTCCGGATTTCTGCAGTTAACAAGTTTGGTGTTGGCAGGCCACTTGAGTCCGACCCCGTGGTTGCTCAAATACAATACA CCATTCCAGATGCTCCCG

GAGTTCCAGAACCTAGCAATGTCACAGGCAACAGCATTACCCTGACTTGGACGAGGCCAGAATCAGATGGTGGCAGTGAGATTCAACACTACATCCTTGA

AAGGAGAGAAAAGAAAAGCACAAGATGGGTAAAAGTGATCAGCAAACGACCAATCTCTGAGACAAGGTTCAAAGTCACAGGTCTGGTGGAAGGCAACGAG

TATGAGTTCCATGTCATGGCTGAAAACGCTGCGGGCATAGGACCAGCAAGTGGGATCTCAAGACTCATTAAATGCAGAGAGCCTGTTAACCCACCAAGTG

CCCCCTCGGTAGTCAAAGTGACAGACACATCAAAGACAACTGTGAGCTTGGAATGGGCCAGGCCAGTCTTTGACGGCGGGATGGAGATAATTGGATACAT

AATAGAAATGTGCAAAGCTGACTTAGGGGACTGGCACAAAGTAAACACAGAGCCATGTGTGAAAACAAGATACACGGTCACTGATCTACAGGCTGGTGAA

GAATACAAATTCCGGGTCAGTGCGGTCAATGGTGCTGGGAAAGGAGACAGCTGTGAGGTGACCGGCACAATAAAAGCAGTCGATCGGTTATCAGCTCCCG

AGTTAGACATTGATGCAAACTTCAAGCAGACTCACATTGTTAGAGCGGGAGTTAGCATTCGTCTCTTCATTGCCTACCAGGGTAGACCCACTCCTACAGC

AGTATGGAGCAAGCCTGACTCTAACCTTAGCATCCGGGCTGATATCCACACAACAGACTCCTTCAGCACCCTCACCGTGGAAAACTGCAACAGAAATGAT

GCAGGGAAATACACACTCACGGTAGAAAACAACAGCGGTAAGAAGTCGATAACATTCACTGTAAAGGTGCTGGACTCTCCAGGACCACCTGGTCCCATTA

CCTTCAAAGATGTGACCCGGGGATCTGCTACACTGATGTGGGACGCCCCTCTCCTTGATGGTGGTGCCCGGATCCATCACTATGTGATAGAGAAGCGGGA

AGCGAGTCGCCGTAGCTGGCAGGTTGTCAGTGAAAAATGCACTCGCCAGATCCTCAAGGTGAGTGAGCTGACAGAAGGTGTTCCGTACTATTTCCGTGTT

TCTGCTGAAAATGAGTACGGTGTTGGTGAACCCTATGAAATGCCAGAACCAATTGTAGCCACAGAACAGCCCGCTCCACCTAGGAGGCTTGATGTCGTTG

ACACTAGCAAATCCTCTGCGGTCCTAGCCTGGCTTAAACCCGATCATGATGGAGGTAGTCGGATCACTAGCTACCTGCTTGAAATGCGACAAAAGGGATC

TGACTTCTGGGTTGAAGCTGGTCACACCAAACAGCTGACTTTCACAGTGGAGCGCCTCGTTGAGAATACTGAATATGAATTCCGGGTGAAAGCCAAGAAC

GACGCTGGCTACAGTGAACCCAGGGAAGCCTTCTCATCTGTCATTATCAAGGAGCCTCAAATTGAGCCCACTGCTGATCTCACTGGAATCACCAATCAGC

TCATCACTTGCAAAGCAGGAAGCACATTTACCATTGACGTGCCAATCAGTGGTCGTCCTGCCCCCAAAGTAACATGGAAGCTAGAAGAAATGAGACTCAA

GGAGACAGATCGAATGAGTATCGCAACAACAAAAGACAGGACCACCCTGACTGTAAAGGACAGTATGAGAGGTGACTCTGGCAGATACTTCCTGACCCTA

GAAAACACAGCCGGTGTTAAAACATTTACTATCACAGTTGTGGTCATTGGAAGACCAGGGCCAGTAACTGGTCCCATTGAGGTCTCATCTGTCTCGGCTG

AATCATGTGTCCTATCATGGACTGAACCAAAAGACGATGGAGGCACTGAAATTACAAATTATATAGTTGAAAAGCGCGAGTCGGGTACCACCGCCTGGCA

GCTTATCAATTCTAGTGTGAAGCGCACGCAGATTAAAGTCACACACCTCACAAAATACAAAGAATACTGTTTCCGGGTCAGCTCAGAGAATAGATTCGGG

GTCAGCAAGCCTCTGGAATCAGTGCCAATAGTTGCTGAACATCCATTTG TTCCACCAAGTGCTCCTACCAGGCCTGAGGTCTACTATGTGTCTGCCAAT

GCTATGTCAATTCGTTGGGAAGAACCCTACCATGATGGCGGTAGTAAAATCGTTGGCTACTGGGTTGAGAAGAAAGAACGTAACACCATTCTTTGGGTGA

AAGAAAACAAAGTGCCGTGCTTAGAGTGTAACTACAAAGTGACAGGCTTGGTAGAAGGACTGGAGTATCAGTTCCGAACATATGCACTCAATGCTGCGGG

CGTCAGCAAGGCCAGTGAAGCTTCAAGACCTATCATGGCTCAAAATCCAGTTG ATCCACCTGGTAGGCCAGAAGTGACAGATGTCACAAGATCAACAGT

GTCACTAATTTGGTCTGCCCCAGTGTATGACGGAGGCAGCAAAGTTGTGGGCTACATCATAGAACGGAAGCCAGTCAGTGAAGTTGGAGATGGTCGCTGG

CTGAAGTGCAACTATACCATTGTCTCTGATAATTTCTTCACTGTGACCGCTCTCAGCGAAGGGGACACTTATGAATTCCGTGTGTTGGCCAAGAACGCAG

CAGGCGTAATTAGCAAAGGCTCTGAATCTACAGGCCCTGTAACTTGCCGAGATGAATATG CTCCACCAAAAGCTGAATTGGATGCCAGGTTACAAGGCG

ATCTGGTGACCATCAGAGCAGGTTCAGATCTTGTTCTTGATGCTGCTGTTGGTGGCAAACCTGAACCCAAAATCATCTGGACCAAAGGAGACAAGGAACT

GGATCTCTGTGAAAAAATTTCTCTACAGTACACTGGCAAGCGAGCCACTGCTGTGATCAAATACTGTGACCGGAGTGACAGTGGGAAATACACACTGACA

GTGAAGAACGCTAGTGGGACCAAGTCCGTATCTGTCATGGTCAAAGTTCTTG ATTCTCCTGGCCCATGTGGAAAACTCACTGTCAGCAGAGTGACCGAG

GAGAAGTGCACCTTAGCCTGGAGCCTTCCACAGGAAGATGGAGGAGCAGAGATAACTCACTATATTGTAGAGAGACGGGAGACTAGCAGGCTCAATTGGG

TGATCGTGGAAGGGGAATGCCTGACCGCATCCTACGTGGTTACCAGACTCATCAAGAACAATGAATACACATTCCGCGTGAGGGCAGTGAACAAGTACGG

CCTCGGCGTGCCAGTTGAGTCAGAGCCTATTGTGGCCAGAAACTCTTTCA CGATTCCATCACAACCTGGCATACCAGAAGAAGTTGGGGCTGGCAAAGA

GCACATCATTATTCAGTGGACGAAACCTGAATCTGATGGTGGCAATGAAATCAGCAACTACCTCGTCGACAAACGGGAGAAGAAAAGCTTGCGCTGGACC

CGTGTCAACAAAGACTACGTGGTGTACGACACCAGGCTGAAGGTGACCAGCCTCATGGAAGGCTGTGATTATCAGTTCCGAGTGACTGCCGTGAACGCTG

CTGGCAACAGTGAGCCCAGTGAAGCTTCAAACTTCATCTCATGCAGAGAGCCATCAT ACACCCCTGGGCCACCTTCTGCTCCAAGAGTTGTGGATACCA

CCAAGCGCAGCATTAGTTTGGCATGGACCAAGCCCATGTACGACGGTGGTACTGACATCATAGGATACGTCCTTGAAATGCAAGAGAAGGACACAGATCA

ATGGTGCCGAGTACATACAAACGCCACGATAAGAAACAACGAATTCACTGTGCCTGACCTTAAGATGGGCCAGAAGTACTCCTTCAGGGTTGCTGCTGTG

AACGCCAAGGGTATGAGTGACTACAGTGAGACGACTGCTGAAATTGAGCCCGTGGAAAGACTAG AAATACCAGATCTTGAGCTTGCAGATGATCTGAAG

AAGACCGTGATTGTCAGGGCTGGAGCCTCCTTGCGCCTGATGGTGTCTGTCTCTGGAAGACCTTCTCCTGTCATCACGTGGAGCAAAAAAGGCATTGACC

TTGCAAATCGGGCAATTATTGACAACACAGAGAGCTACTCTTTACTCATTGTAGACAAAGTTAATCGGTATGATGCTGGAAAATACACAATTGAAGCTGA

AAATCAGTCTGGCAAGAAATCAGCAACGGTCCTAGTTAAAGTCTATG ATACTCCTGGTCCCTGCCCTTCAGTGAGCGTTAAAGAAGTTTCGAGAGATTC

TGTGACCATCACTTGGGAAATCCCCACAATTGATGGTGGTGCTCCGGTCAACAATTACATTATTGAGAAGCGAGAAGCCGCCATGAGGGCATTCAAGACA

GTAACCACCAAATGCAGCAAGACTCTTTACCGCATATCTGGACTCGTCGAGGGAACCATGTACTACTTTAGAGTGCTTCCAGAAAACATCTATGGCATCG

GAGAGCCTTGCGAAACATCAGACGCAGTTCTAGTCTCAGAAGTACCTTTGGTGCCCACAAAACTAGAAGTGGTTGATGTCACCAAATCCACTGTGACCCT

TGCTTGGGAGAAACCACTCTATGACGGTGGAAGCCGACTCACCGGATATGTTCTTGAGGCCTGCAAAGCCGGCACCGAGAGATGGATGAAAGTTGTCACT

TTGAAACCCACAGTCTTAGAGCACACTGTTATTTCCCTGAATGAAGGCGAGCAGTACTTGTTTAGAGTGAGGGCTCAAAATGAGAAAGGTGTGTCAGAAC

CGAGAGAGATCGTCACACCAGTGACAGTACAAGACCTCAGAG TGTTGCCAACGATTGACCTTTCCACAATGCCCCAAAAGACCATCCATGTCCCAGCTG

GCAGACCAATTGAGCTGGTGATACCGATCACTGGTCGGCCGCCACCTACTGCTTCCTGGTTCTTTGCTGGTTCTAAACTGAGAGAATCAGAGCGTGTCAC

AGTTGAAACCCACACTAAAGTCACCAAGCTAACCATCCGTGAAACTACTATAAGAGATACGGGAGAATATACGCTTGAACTAAAGAATGTTACTGGAACC

ACCTCAGAGACAATAAAAGTTATTATTCTTG ACAAGCCTGGTCCACCAACTGGGCCCATCAAGATTGATGAAATTGATGCCACGTCAGTTACGATATCC

TGGGAACCTCCCGAATTGGATGGTGGTGCTCCACTGAGTGGCTATGTGGTAGAGCAGCGTGATGCTCATCGTCCAGGATGGCTGCCAGTTTCTGAGTCTG

TAACAAGACCAACGTTTAAGTTTACCAGACTCACCGAAGGAAATGAATACGTGTTCCGCGTGGCTGCAACAAACCGCTTCGGGATTGGCTCGTACTTGCA

GTCTGAGGTCATAGAATGCCGAAGCAGCATCA GTATTCCTGGACCTCCAGAAACATTACAGATATTTGATGTCTCCCGTGATGGCATGACACTTACATG

GTATCCACCTGAAGATGATGGTGGCTCCCAAGTGACTGGATATATCGTGGAACGTAAAGAAGTAAGAGCTGATCGGTGGGTCCGTGTAAATAAAGTACCA

GTGACTATGACCCGGTACCGCTCCACCGGCCTTATTGAAGGCTTAGAATATGAACATCGGGTCACAGCCATTAATGCAAGAGGAACTGGAAAACCAAGTC

GTCCTTCCAAACCCACCGTTGCCATGGATCCAATTG CTCCACCAGGAAAACCACAAAATCCAAGAGTTACAGATACAACAAGGACTTCAGTCTCCCTGG

CCTGGAGTGTTCCGGAAGATGAAGGTGGATCTAAAGTCACAGGGTACTTGATCGAAATGCAAAAAGTAGATCAACGTGAATGGACCAAATGTAACACCAC

CCCAACCAAGATTCGGGAGTATACCCTAACACACCTACCTCAGGGCGCTGAATACAGATTCCGTGTCCTAGCCTGTAATGCTGGTGGACCTGGAGAACCT

GCTGAGGTACCAGGAACCGTCAAAGTCACAGAGATGCTGG AATACCCTGACTATGAACTTGATGAGAGATACCAGGAAGGTGTCTTTGTTCGACAAGGT

GGGGTCATCAGGCTTACCATCCCAATCAAAGGAAAACCATTCCCAGTATGTAAATGGACCAAGGAAGGCCAAGACATTAGTAAGCGTGCCATGATTGCAA

CATCGGAAACACATACTGAGCTTGTGATCAAAGAAGCAGACAGAAACGATTCTGGAACTTACGACTTGGTTCTGGAAAACAAATGTGGCAAGAAGACCGT

TTACATTAAGGTCAAGGTGATAGGAAGTCCCAACACTCCAGAAGGGCCACTGGAATACGATGACATACAAGCCCGCTCTGTAAGGGTCAGCTGGAGACCT

CCTGCTGACGATGGTGGTGCTGACATCCTGGGCTACATCCTTGAGAGAAGAGAGGTACCTAAGGCTGCCTGGTATACCATTGACTCCAGAGTCCGAGGCA

CATCTCTGGTGGTGAAAGGCCTCAAAGAAAACGTGGAATACCATTTCCGTGTCTCAGCAGAAAACCAGTTTGGCATAAGCAAACCCTTGAAATCTGAGGA

GCCAGTCATACCAAAGACACCACTGA ATCCACCAGAACCACCAAGCAATCCTCCTGAAGTACTTGATGTGACCAAAAGTTCCGTTAGCTTGTCATGGTC

TCGACCTAAAGATGACGGCGGCTCTCGAGTGACGGGCTACTACATTGAGCGCAAGGAGACATCCACTGACAAGTGGGTCAGACACAACAAAACCCAGATA

ACCACCACGATGTACACTGTCACCGGCCTCGTTCCCGATGCTGAGTACCAGTTCCGCATCATCGCACAGAATGACGTTGGCCTTAGTGAGACCAGCCCTG

CTTCTGAACCTGTTGTTTGCAAAGATCCCTTTG ATAAGCCAAGCCAACCAGGAGAACTTGAGATTCTCTCGATATCCAAAGACAGTGTCACCCTCCAGT

GGGAGAAACCCGAATGTGATGGTGGCAAAGAAATCCTTGGATACTGGGTTGAATACAGACAGTCTGGAGACAGTGCTTGGAAGAAGAGCAATAAGGAACG

GATCAAGGACAGACAGTTCACCATCGGCGGTTTGCTAGAAGCTACTGAATATGAGTTCCGAGTATTTGCTGAGAACGAGACTGGGCTCAGCCGACCACGT

AGAACAGCTATGTCTGTCAAGACTAAACTAACAT CTGGAGAAGCCCCAGGAGTGCGCAAAGAAATGGCTGATGTGACCACCAAATTAGGTGAAGCTGCA

CAACTCTCATGCCAGATAGTTGGAAGGCCCCTTCCTGACATTAAATGGTACCGGTTTGGTAAAGAGCTCATACAAAGCCGGAAGTACAAAATGTCCTCAG

ATGGGCGCACGCATACTCTGACAGTAATGACAGATGAACAAGAAGATGAAGGTGTTTATACATGTGTAGCCACAAATGAAGTAGGAGAAGTAGAAAGCAG

CAGCAAGCTTCTTCTGCAAGCGGCACCACAGTTCCATCCTGGTTACCCACTGAAAGAGAAGTATTACGGGGCCGTGGGGTCTACGCTTCGGCTCCACGTT

ATGTATATTGGCCGCCCAGTACCTGCCATGACTTGGTTCCATGGCCAGAAACTTTTGCAAAACTCAGAAAAAATCACCATTGAAAACACTGAGCACTATA

CTCACCTTGTCATGAAGAATGTCCAACGAAAGACTCATGCTGGGAAATACAAGGTTCAGCTCAGCAATGCCTTTGGGACAGTGGATGCCACCCTAGATGT

GGAAATACAAG ATAAACCAGACAAGCCTACTGGACCCATTGTGATTGAAGCACTACTCAAGAACTCGGTGGTGATCAGCTGGAAACCACCTGCTGATGA

TGGCGGCTCCTGGATCACCAATTACGTGGTAGAGAAATGTGAGGCCAAAGAAGGTGCTGAATGGCAATTGGTGTCTTCAGCCATCTCGGTGACAACCTGC

AGAATTGTGAACCTCACAGAGAATGCCGGCTACTATTTCCGGGTCTCAGCTCAGAACACCTTTGGCATCAGTGAGCCACTAGAGGTCGCCTCCATTGTGA

TCATCAAGAGTCCATTCG AAAAGCCAGGTGTTCCTGGTAAACCAACCATCACTGCTGTCACAAAGGATTCTTGTGTTGTGGCTTGGAAGCCACCTGCAA

GCGATGGCGGTGCAAAGATCAGAAATTACTACCTTGAGAGGCGCGAGAAGAAGCAAAACAAGTGGATTGCTGTGACGACAGAGGAAATTCGAGAAACCGT

CTTCTCAGTGCAAAACCTTATTGAAGGTCTTGAATATGAGTTCCGTGTGAAATGTGAAAACCTGGGTGGAGAGAGTGAATGGAGTGAAATATCAGAACCC

GTCACTCCAAAATCCGACGTCCCGATTCAGGCTCCACACTTCAAGGAGGAGCTGAGAAACCTGAATGTAAGGTATCAGAGCAACGCCACTCTGGTCTGCA

AGGTGACCGGTCACCCAAAGCCTATTGTGAAATGGTACAGACAAGGCAAAGAAATTATCGCCGATGGACTCAAGTACAGGATTCAAGAATTTAAGGGCGG

TTACCACCAGCTCATCATTGCAAGCGTCACAGATGATGATGCCACGGTGTACCAAGTCAGAGCCACCAACCAAGGGGGCTCCGTGTCTGGCACTGCTTCC

TTGGAAGTGGAAG TTCCAGCTAAGATACACTTGCCCAAGACTCTCGAAGGCATGGGAGCGGTCCATGCTCTCCGAGGGGAAGTGGTTAGCATCAAGATC

CCCTTCAGTGGTAAGCCAGACCCCGTGATCACCTGGCAGAAAGGACAAGATCTCATCGACAATAATGGCCACTACCAAGTGATTGTCACAAGATCCTTCA

CGTCACTTGTCTTCTCCAATGGAGTGGAGAGAAAAGATGCTGGCTTCTATGTCGTCTGTGCTAAAAACAGATTTGGAATTGATCAAAAGACAGTCGAACT

GGATGTGGCTGATGTCCCCGACCCACCCAGGGGTGTCAAAGTTAGTGACGTCTCACGCGATTCTGTCAACTTAACATGGACAGAGCCAGCTTCTGATGGT

GGTAGCAAGGTCACCAACTACATCGTGGAAAAGTGTGCAACTACTGCAGAAAGATGGCTCCGAGTGGGACAGGCCCGAGAAACCCGTTACACTGTGATCA

ACTTGTTTGGAAAAACAAGTTACCAGTTCCGAGTAATAGCTGAAAATAAATTTGGCCTGAGCAAGCCATCAGAGCCCTCAGAACCAACCGTTACC
Translation
KVPEIPKKPEEKVPVPIPKKEKAPPAKV VPEVPKKPVPEEKPPVPVPKKVEPPPAKV VPEVPKKPVPEKKVPAPTPKKVEAPPAKV VPEVPKKPIPE

EKKPTALLKKMEAPPPKA APKKREVVPVPVALPREEEEEEVPFEEVPEEEILPEEEVPSEEEAPPEEVPPEEEEVLPEEEEVLPEEEEVLPEEEEVQPE

EEALPEIKPKVPKPAPV VPKKTVPEKKVPVPVPKKVEPPPPPKV VPEIKKKVPEKKVVVPKKEEAPPTKV VPEVSKKVEERRIIPPKEEEVPPAEV 

VYEEAEEPTPEEIPEEPPSIEEEEIVEEEEEEEEVLPPRA APEVVKKAVPEAPTPVPKKAEAPPAKV VPKKIPEEKVPVPVQKKEAPPAKV VPEKKK

IPEKKVPVPKKEAVPPAKG GKAVFEEKISVAYQQEELVQERIELELVEAKVEEAFEEEEFHEVQEYFEEEEFHEVEEFIRVEERRFQEEHKVEEVHRVI

EFLEAEEVEVYEKPKIPPKKG GPEVSEKVIPPKKPPTKVIPRKEPPAKV VPEVTKKTVVEEKIRAPEEPKVPAPKA APEVPKKITPEEKVREAVPKK

PEVPPPKV VPEVPKKIIQEEKLPVVLPEDTEIYM MYEASEETVIEEEHVTLPQKARLKVAKV VPAPPQTVVTEEKTYVTIRKTRETLALKE ESETT

REAFPELKSYKAVPEIPEPPSPED DLEIIEDVLPEKRPPASKRRKTQLPTA APEAPREMPPEMNTFEEISVEPEMLPTQV VLDTYQEATVEKKTLRI

SRKKPELPSDEEV VPEAPREVVAKKKVLPPQVPEVVPVKV VPGAPKEVVSERKSLEEPPKKPAVRPVTV VPEEPKEVIPEKKVSLVPPKKPAAPPVT

V VPEAPEEVFSEDEETLAPPQEPEAPPAKV VPEAPKEVVPEKKVSVVPPKKPEAPPAKV VPEAPKEAAPEKKVPVAPKKKPEAPPVKV VPEAPKKV

VPEKKLPVAAPKKPEAPAAEV VPEVPKTAVPQKKIPEAIPPKPESPPLEV VPEVPPKEVTPEKKVPAAPPTKPEIPPPKV VPEAPQAAVVEEKTPEA

LPKKAEAAPVPV VPQVQETVPEKTRPVGPPKKPEATTVPV VPKVQKTIPEKTRPEAPPKRPEARTVPE ETVPEKTRPMAPPKKPEATTLPV VPEVQ

ETVPEKTRPVGPPKKPEATTVPV VPEVQETIPEKTRPPKKPEATPVPV VPEVQETVPEKTRPVGPPKKPEATTVSV VPEVQETIPEKTRPAAPPKKP

EATAVPE ETIPEKTRPEAPPKRPEATTVPV VPEADQAVVPEKKVPRVPPKKVEAPPITV VPEEPKEVIPEKKVSLVPPKKPAAPPVTV VPEAPEEV

FSEDEETLAPPQEPEAPPAKV VPEAPKEVVPEKKVSVVPPKKPEAPPAKV VPEAPKEAAPEKKVPVAPKKKPEAPPVKV VPEAPKKVVPEKKLPVAA

PKKPEAPAAEV VPEVPKAAVPQKKIPEAIPPKPESPPPEV VYEEPEEEIVPEEPPEEAVEEPVPAPPPKV VTEPPKKPVPEKKAPPAVVKKPEPPPA

KV VPEVPKEAPPEKKVPPKKPEAPPAKV VPEVPKEVVTEKKVAVPKKPEVPPAKV VPEVPKKPVIEEKPAIPVVEKVASPPAEV VYEEPEEVTAEE

EEPAPAVEEEEYEAPPPPAPV VPEEPKKVVPEKKFPVIKKPEAPPPKV VPEVPKKAVPVKKVPVVKKPEPPEAEV VPEVPKKLVPVKKEPVPVTKKT

EVLPEKV VPEAPKKITPEKKESVPVPEEPEAPPASV VEETPEETIYEEKATITIGRKETPPVEE EREIEKFIQPEEPELEPEPEEIPVQE EPEPEK

KVIEKPKLKPRPPARPPSPPKEDVKEKMFQLKA - UNI36362 - AVSKKKVPEKPEVVEKVEPAPLKV - UNI36362 - VPTAEKKVRKLLPEP

KPQPKEEVVLKSV - UNI36362 - VLRKKPEEEEPKVEPKKVEKAKKPEE EPQPPPKAVEVEAPPEPTPKERKVPEPAKV - UNI17655 - VP

EIKPAIPLPGPEPKPKPEPE - UNI17655 - EVKTMKAPPIEPAPTPIAAPVTAPVVGKKAE EAKPKDEAAKPKGPIKG GVAKKTPSPIEAERKK

LRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTEAESVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTC

VLRLGNKEKTSTAKLIVEE ELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVEN

ANNLECSSCVKVVE EIIREWLVKPIRDQHVKPKGTAVFTCDIAKDTPNIKWFKGYDEIPLEPNDKTEILKEGNHLFLKVKNAMPEDIDEYAVEIEGKRY

PAKLTLGE EREVELLKPIEDVTIYEKESASFDAEISEEDIPGEWKLKGELLRPSP TCEIKAEGGKRFLTLHKVKLDQAGEVLYQACNAITTAILTVKE

 EIELDFAVPLKDVTVPEKRQARFECVLTREANVIWSKGPDIIKASDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSAQLFVTG GIRLKFISP

LEDQTVKEGQTATFVCELSHEKMHVVWFKNDVKLHTTRTVLMSSEGKTYKLEIRETTLDDISQIKAQVKNLSSTANLKVLE EADPYFTVKLHDKTGVEK

DEIILKCEVSKDVPVKWFKDGEEIVPSPKHSVKTDGLRRILKIKKAELKDKGEYVCDCGTDTTKANVTVEA ARLIKVEKPLYGVEVFVGETARFEIELS

EPDVHGQWKLKGEPLTASP DCEIIEDGKKHVLVLYNCQLDMTGEISFQAANAKSAANLKVKE ELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRW

LKGTQEITGDDRFELIKDGTRHSLVIKSAAFEDEAKYMFEAEDKRTSGKLIIEG - UNI35827 - GIRLKFLTPLKDVTAKERENAVFTVELSHDNI

PVSWFKNDQRLHTSKRVSMHDEGKTHSITFKDLSIDDTSQIRVEAMGISSEAKLTVLE - UNI35827 - - UNI35899 - EGDPYFTGKLQDYTG

VEKDEVILQCEISKADAPVKWFKDGKEIKPSKNVVIKADGKKRMLILKKALKSDIGQYTCDCGTDQTSGKLDIED - UNI32138 - - UNI35827 

- - UNI35899 - DREIKLVRPLYSVEVMETETARFETEISEDDIHANWKLKGEALLQTP - UNI32138 - - UNI33036 - - UNI35899 

- ECEIKEEGKIHVLILHNCRLDQTGGVDFQAANVKSSAHLRVKP - UNI32138 - - UNI32541 - - UNI33036 - PRVIGLLRPLKDVTV

TAGETATFDCELSYEDIPVEWYLKGKKLEPNDK - UNI14991 - - UNI16643 - - UNI32541 - - UNI33036 - VVTRSEGRVHTLTL

RDVKLEDAGEVQLTAKDFKTQANLFVKE - UNI14991 - - UNI16643 - - UNI32541 - EPPVEFTKPLEDQTVEEEATAVLECEVSRENA

KVKWFKNGTEILKSKKYEIVADGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVP - UNI14991 - PPHVEFLRPLTDLQVKEKETARFECEIS

KENEK VQWFKDGAEIKKGKKYDIISKGAVRILVINKCLLNDEAEYSCEVRTARTSGMLTVLE EEEAVFTKNLANLEVSEGDTIKLVCEVSKPGAEVIW

YKGDEEIIETGRFEILTDGRKRILIIQNAQLEDAGSYNCRLPSSRTDSKVKVHE ELAAEFISKPQNLEILEGEKAEFVCTISKESFEVQWKRDDQTLES

GDKYDIIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIE EKLRIIVPLKDTKVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKD

LVYTLRIRDARLDDQANFNVSLTNHRGENVKSAANLIVEE EEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVAFDNRISYRIDKYKHS

LIIKDCGFPDEGEYVVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKK KYKFEKDGSIHRLIIKDCRLE

DECEYACGVEDRKSRARLFVEE EIPVEIIRPPQDILEAPGADVIFLAELNKDKVEVQWLRNNMIVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIA

KDKEARAKLELAA AAPKIKTADQDLVVDAGQPLTMVVPYDAYPKAEAEWFKENEPLSTKTVDTTAEQTSFRISEAKKDDKGRYKIVLQNKHGKAEGFIN

LQVID DVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLVTDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDSP

VEARSKYD DVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAA

TPFVKVADPIE ERPSPPVNLNASEQTQSSVQLTWEPPLKDGGSPILGYIIERREEGKDNWIRCNMKPVPELTYK VTGLQKGNKYLYRVSAENAAGVSD

PSEILGPLTADDAFV VEPTMDLSAFKDGLEVIVPNPIKILVPSTGYPRPKATWTFGDQVLEEGDRVKMKTISAYAELVISPSERTDKGIYTLTLENPVK

SISGEINVNVIA APPSAPKELKFSDITKDSVHLTWEPPDDDGGSPLTGYVVEKRDMSRKTWTK VMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGE

PAYTDEPVNMSAPAT TVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVEKCPRGSDKWVACGEPVPDTK KMEVTGLEEGKWYAYRVKALNRQ

GASKPSKPTEEIQAVDTQE EAPEIFLDVKLLAGITVKAGTKIELPATVTGKPEPKITWTKADTLLKPDQRITIENVPKKSTVTITDSKRSDTGTYIIEA

VNVCGRATAVVEVNVLD DKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERKATDSDVWHKLSSTVKDTNFKATKLTPNKEYIFRVAAENMY

GVGEPVQAAPIIAKYQFD DPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYR RVKGLTNKKKYRFRVLA

ENLAGPGKPSRSTEPILIKDPID DPPWPPGKPTVKDIGKTSLVLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTTEHLLTGLMEGQEYSFRV

RAVNKAGESEPSEPSDPVLCREKLY YPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVF

RVAAENAIGQSDYTEIGDSVLAKDTFT TTPGPPYALTVVDVTKRHVDLKWEPPKNDGGRPIQR RYIIEKKEKLGTRWVKAGKTSGPDCNFRVTDVIEG

TEVQFQVRAENEAGVGHPSEPTEILSIEDPTS SPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEG

IVPDKEYVLRVRAVNAVGVSEPSEISENVVAKDPDC CKPTIDLETHDIVVIEGEKLNIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVP

KSVHADAGVYTITLENKLGSATASINVKVIG GLPGPCKDIKASDITKSSCKLTWEPPEFDGGSPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIP

NGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQ QPPDPPVDVEVHNPTAKAMTITWKPPLYDGGSKIMGYIIEKITKGEDRWKRCNEHLVPVLTYTAKG

LEEGKEYQFRVRAENAAGIGEPSRATPPTKAVDPID DAPKVILRTSLEVKRGDEIALDATISGSPYPTITWIKDENVIVPEEIKKRAAPPVRRKKGEAE

EEEPFSLPLTERLSINNSKQGESQLRIRDSLRPDHGQYMIKVENDHGVAKAPCSVSVLD DTPGPPINFVFEDIRKDSVLCKWEPPLDDGGSEIINYTLE

KKDKTKPDSDWIVITSTLRNCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLLAKDPFE EPPDAPDKPIVEDVTSNSMLVKWNEPKDNGSPILGYW

LEKREVNSTHWSRVNKTLLSSLKTKVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTARDPIS SPPGPPVPRVADTSSTTIELEWEPPAFNGGGEIMG

YFVDKQLVGTNEWSRCTEKMIKVRQFTVKEIREGADYKLRVSAVNAAGEGPPGETEPVTVAEPQE EPPTVELDVSVKGGIQIMAGKTLRIPAEVTGRPV

PTKVWTIEEGELDKERVIIENVGTKSELIIKNALRKDHGRYVITATNSCGSKFAAVRVEVFD DVPGPVLDLKPVVTNRKMCLLNWSDPADDGGSDITGF

IIERKDAKMHTWRQPIETERSKCDITGLIEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLG GPPTSPERLTYTERTKSTITLDWKEPRSDGGSPIQGY

IIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNDVGESEPSLPLNVVIQDDEV VPPTIKLRLAVRGDTIKVKAGEPVNIPADVTGLPM

PKIEWSKNEKVIDKPTDTLNITKEEVSRSEAKTELSIPKAAREDKGTYTITASNRLGSVFRNVHVEVYD DRPSPPRNLAVTDIKAESCYLTWDAPLDNG

GSEITHYIIDKRDASRKKSEWEEVTNTAVERRYG IWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLERTKGSMLVSWTPPLD

NGGSPITGYWLEKREEGGTYWSRVSRAPITKVGLKGVEFNVPRLIEGVKYQFRAMAINAAGIGPPSEPSDPAVAGDPIY YPPGPPSCPEVKDKTKSSIS

LAWKPPAKDGGSPIKGYIVEMQEEGTTDWKPVNEPDKLLTACECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQE EVPEVFIDIGAQDCL

VCKAGSQVKIPAVIKGRPTPKSSWEFDGKAKKAMK DGVHDIPEDAQ LETAENSSVIIIPECTRAHSGKYSITAKNKAGQKTANCRVKVMD DAPGPPK

DLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNCGSTTFVVPDLISEQQYFFRVRAENRFGIGPPAETIQRTTARDPIY YPPDP

PIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGKKKEAWRQCNRRDVEELEFTVEDLIEGGEYEFRVKAVNEAGVSKPSATVGPVIVKDQ

TC CPPAIELKEFMEVEEGTDVNIVAKIKGVPFPTLTWFKAPPKKPDSKEPVVYDTHVNKQVVDDTCTLVIPQSRRSDTGLYSITAVNNLGTASKEMRLN

VLG GRPGPPVGPIKFESISADQMTLSWLPPKDDGGSKITNYVIEKREANRKTWVRVSSEPKECMYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETA

RNLFS SVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASL

PSDPVTARDPVA APPGPPFPKVTDWTKSSVDLEWSPPLKDGGSKITGYIVEYKEEGKEEWEK GKDKEVRGTKLVVTGLKEGAFYKFRVRAVNVAGVGE

PGEVTDVIEMKDRIV VSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWSMNERALPQEAAIETTAISSSMVIKNCQRSHQGVYSLLAKNEGGE

RKKTIIVDVLD DVPGPVGIPFLSDNLTNDSCKLTWFSPEDDGGSPITNYVIQKREADRRAWTPVTYTVTRQNATVQGLIQGKSYFFRIAAENSIGMGPF

VETPNALVIRDPIT TVPERPEDLEVKEVTKNTVSLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQ

GKPSFCTKPITCKDELA APPTLDLDFRDKLTVRVGESFALTGRYSGKPKPKIDWFKDEADVLEDDRTHIKTTPTTLALEKTKAKRSDSGKYCVVVENST

GSRKGFCQVNVVD DRPGPPVGPVIFDEVTKEYMVISWKPPLDDGGSEITNYIIEKKELGKDIWMPVTSASAKTTCKVPKLLEGKDYIFRIHAENLYGIS

DPLVSDSMKAKDRFR RVPDAPEQPVVTEVTKDSALVTWNKPNDGGKPITNYILEKRETMSKRWVRVTKEPIHPYTKYRVPDLLEGCQYEFRVSAENEIG

IGDPSPPSKPVFARDPIA AKPSPPINPEAIDTTCNSVELTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQSYKFRVLA

VNEAGESDPAHVPEPVLVKDRLE EPPELILDANMAREQHIRVGDTLRLSAIIKGVPFPKVTWKKEDREAPTKAQIDVTPVGSKLEIRNAAHEDGGIYSL

TVENPAGTKTVSVKVLVLD DKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVVTNYVVERKDVATAQWSPLSTTSKKKSHMAKHLTEGNQYLFRVAAEN

QYGRGPFVETPKPIKALDPLH HPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGDKDWIKFKTVKNLDCVVTGLQQGKTYRFRVKAE

NIIGLGLPDTTIPIECQEKLV VPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGTEIKTDDHYTVETDSFSSVLTIKNCLRKDTGEYQL

TVSNAAGTKTVAVHLTVLDVPGPPTGPINILDVTPEYMTISWQPPKDDGGSPVINYIVEKQDTRKGTWGVVSAGSSKLKLKVPHLQKGCEYVFRVKAENK

MGVGPPLDSIPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYVERREITGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLA

GLSNPSPSSDPIKACRPIKPPGPPINPKLKDKSKESADLVWTKPLSDGGSPILGYVVEYQKPGTAQWDRINKDELIRQCAFRVPGLIEGNEYRFRIRAAN

IVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWSKEGKVLVKDKRVDLIHDLPRVELQIKEAVRADHGKYIISA

KNSSGHAQGSAIVNVLDRPGPCQNLKVSNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLVKANLLANNEYYFRVCAENKVGVG

PTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSADWERVHKGSIKETHYMVDKCVENQIYEFRVQTKNEGGE

SDWVRTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTSAESSKFSLTKAKRSDGGKYVITATNPAG

SFVAYATVNVLDKPGPVRNLKITDVSSDRCTIRWDPPEDDGGCEIQNYILEKCESKRMVWSTYSANVLTPSATVTRLIEGNEYIFRVRAENKIGTGPPTE

SKPVIAKTKYDRPGRPDPPEVTKVSKEEMTVVWNAPEYDGGKSITGYYLEKKEKHAVRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPSL

PSRPVVAKDPIE EPPGPPTNFKVVDTTKSSITLAWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLIRMEFTVTSLDENQEYEFRVCAQN

QVGIGRPAELKEAIKPKEILE EPPEIDLDASMRKLVVVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLT

LVNPAGEKAVFVNVKVLD DTPGPVADLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREAERKTWSTVTPEVKKTSFNVTNLVPGNEYFFRVTAVNE

YGPGVPTDIPKPVLASDPLS SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYIISYREEDQPADRWTEYSVVKDLSLIVTGLKEGKKYKFRVAA

RNAVGVSMPREAEGVYEAKEQLL LPPKILMPEQITIKAGKKLRVEAHVYGKPNPICKWKKGDDEVVTSSHLAIHKADGSSVLIIKDVTRKDSGYYSLTA

ENSSGSDTQKIKVTVMD DAPGPPQPPFDISEIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENR

FGISEPLTSPKMLAKFPFD DVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKERNSLLWVKANDTIVRSTEYPCAGLVEGLEYSFRIYAL

NKAGSSPPSKPTEYVTARMPVD DPPGKPEVVDVTKNSASLIWARPKHDGGSRIIGYFVEACKLPGDKWVRCNTTPHQIPQEEYTATGLEENAQYQFRAI

AKTAVNISQPSEPSDPVTILAENV VPPRIELSVEMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDTTPIKQAEGIKMAMKRNLCTLELFSVNRKDSGD

YTITAENSSGSKSATIKLKVLD DKPGPPASVKINKMYADRAMLSWEPPLEDGGSEITNYIIDKRETSRPNWAQVSATVPITSCTVEKLIEGHEYQFRIC

AENKYGVGDPILTEPAIAKNPYD DPPGRCDPPVISNITKDHMTVSWKAPADDGGSPITGYLVEKRETQAVNWTKVNRKPVIERTLKATGLQEGTEYEFR

VTAINKAGPGKPSDASKAVYAQDPLY YPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDHWVRCNLPEKLQKTRFEVTGLMENTE

YQFRVYAVNKIGYSDPSDVPDKHCPKDILI IPPEGELDAELRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCENVN

KYDAGKYILTLENSCGKKEYTIVVKVLD DTPGPPVNVTVKEVSKDSAYVTWDPPIIDGGSPIINYVVEKRDAERKSWSTVTTECSKTSFRVSNLEEGKS

YFFRVFAENEYGIGDPGETRDAVKASE ETPGPVVDLKALAITKSSCTIGWKKPRSDGGSRITGYVVDFLTEENKWQRVMKSLSLQYSTKDLKEGKEYTF

RVSAENENGEGTPSEIVVVAKDDVV VAPDLDLKDLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESTAVNTTLVVYDCQKSDAG

KYTITLKNVAGTKEGTLSIKVVGKPGIPTGPIKFDEVTAEAMTLKWGPPKDDGGSEITNYVLEKRDSVNNKWVTCASAVQKTTFRVTRLHEGIEYTFRVS

AENKYGVGEGLKSEPIVAKHPFD DVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITG GYHIEFKERNSLLWKRANKTPIRMKDFKVTGLTEGLEYE

FRVMAINLAGVGKPSLPSEPVVALDPID DPPGKPEVISVTRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPDCAFTVTDLVEGGKYE

FRIRAKNTAGAISAPSESTGTIICKDEYE EAPTIVLDPTIKDGLTVKAGDSIVLSAISILGKPLPKSSWSRAGKDIRPSDIAQITSTPTSSMLTVKYAT

RKDAGEYTITATNPFGTKEEHVKVSVLDVPGPPGPIEISNVSAEKATLTWTPPLEDGGSPIKAYVLEKRETSRLLWTVVSEDIQACRHVVTKLIQGNEYL

FRVSAVNHYGKGEPVQSEPVKMVDRFG GPPGPPGKPEISNVTKNTATVSWKRPTDDGGSEITGYHVERREKKGLRWVRATKTPVSDLRCKVTGLQEGNT

YEFRVSAENRAGIGPPSDASNPVLMKDVAY YPPGPPSNAHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDDAWIKDTTGTALRITQFVVPDLQ

TKEKYNFRISAINDAGVGEPAVIPNVEIVEKEVAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKHRANIENTESFTLLIIPECNR

YDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTVTTKCHKCTYKVTGLTEGCEYFF

RVMAENEYGVGEPTETTEPVRASEAPLPPDSLNIMDITKNTVSLAWPKPRHDGGSKITGYVIEAQRKGSDQWTHISTVKGLECVVRNLTEGEEYTFQVMA

VNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIARAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNVENTATSTILNINECVRSDSGPYPLT

AKNTVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWEPPENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGVEYQFRVRAQNRY

GVGPGITSASVVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQTVSKALVPGNIFKSTGLTDGIAYEFRVIAENMA

GKSKPSKPSEPMFALDPIDPPGKPVPLNITRHTVALKWAKPEYTGGFKITSYVVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGA

ISPPSEPSDAITCRDDLEAPRIMVDVRFKDTITLKAGEAFKLEADVSGRPPPTMEWTKDGKELEGTGKLEIKIADFSTHLINKDSSRTDSGAYILTATNP

GGFAKHIFNVKVLDRPGPPEGPLAVSDVTSEKCVLSWLPPLDDGGAKIDHYIVQKRETSRLAWTNVATEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGE

PLESEPVLAVDPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNKKALTDLRFKVSGLTEGHEYEFRIMAENAAGISA

PSATSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQVVTPPAGLKATSYTITSLIENQEYKIRIYAMNSEGL

GEPALVPGTPKAEERMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWAREHGESLDKASIESTSSYTLLVVGNVNRFDSGKYILTVENSSGS

KSAFVNVRVLDTPGPPQNLKIKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAET

AESVKASERPLPPGKITLTDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDRWATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPV

IAKDLVIPPAFKLLFNTFTVLAGEDLKIDVPFIGRPPPAVTWHKDDIPLKQTTRVNAESTENNSLLTIKEACREDVGHYTVKLTNSAGEATETLNVIVLD

KPGPPTGPVKMDEVTADSVTLSWEPPKYDGGSSINNYIVEKRDTSTTAWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPVVAQYPFK

VPGPPGTPFVTLASKDSMEVQWHEPVSDGGSKVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGIEYEFRVSAENIVGIGKPSKPSECYAAHDPC

DPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPDGRWMKASFTNIIDTQFEVTGLLEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVE

PPRISMDPKYRDTVVVQAGESFKIDADIYGKPIPTTQWVKGDQELSSTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGEKSVTINVKVLDRPGP

PEGPVAISGVTAEKCTLAWKPPLQDGGSDITNYIVERRETSRLVWTLVDANVQTLSCKVLKLLEGNEYIFRIMAVNKYGVGEPLESESLIAKNPFVVPDA

PKAPEVTAVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPG

PPNNPKVMDVTRSSVFLSWTKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNLEVEKLLEKHEYNFRICAINKAGVGEHADVPGPVMVEEKLEA

PDIDLDLELRKVINIRAGGSLRLFVPIKGRPTPEVKWGKVDGDIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVN

LKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPARTADPIKVAEVPQPPGKITV

DDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKNTDKWSECARVKSLDAVITNLTQGEEYLFRVIAVNEKGRSDPRSLAVPIIAKDLVIEPDVRPAFSSY

SVQVGQDLKIEVPISGRPKPSISWTKDGMPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVSNVVGQKTAAIEIITLDKPDPPKGPVKFDEISAES

ITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESEPVVAQYPYKEPGPPGTPFVTAISKESM

VVQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKALNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEAIIVKRNEITL

QWTKPVYDGGSMITGYIVEKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNA

GETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTAEKCTLA

WSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNKYIFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCW

NRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHVVDTTKNSITLA

WSKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEIAKLIEHQEYKIRVCALNKVGLGEAASVPGTVKPEDKLEAPELDLDSELRKGIVVRAG

GSARIHIPFKGRPTPEITWSKEEGEFTDKVQIEKGINFTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSVLLVWEPP

IIDGGAKVKNYVIDKRESTRKAYANVSSKCNKTSFRVENLTEGAIYYFRVMAENEFGVGVPTETSDAVKASEPPSPPGKVTLTDVSQTSASLMWEKPEHD

GGSRILGYVVEMQPKGTEKWSVVAESKVCNAVVSGLSSGQEYQFRVKAYNEKGKSDPRVLGIPVIAKDLTIQPSFKLPFNTYSVQAGEDLKIEIPVIGRP

RPKISWVKDGEPLKQTTRVNVEETATSTILHIKESSKDDFGKYSVTATNSAGTATENLSVIVLEKPGPPVGPVKFDEVSADFVVISWEPPAYTGGCQISN

YIVEKRDTTTTNWQMVSATVARTTIKISKLKTGTEYQFRIFAENRYGKSTPLDSKPVVVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGSKVTGY

HLEQKEKNSILWVKLNKIPIQDTKFKTTGLDEGLEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIVITRNSVTLKWKKPVYDGGSKITGYIV

EKKDLPDGRWMKASFTNVVETEFTVTGLVEDQRYEFRVIARNAADNFSEPSESSGAITARDEIDAPNASLDPKYRDVIIVHAGETFVLEADIRGKPIPDI

IWSKDGNELEETAARMEIKSTLQKTTLIVKDCIRTDGGQYTLKLSNVGGTKTIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGASISHYII

EKRETSRLSWTQVSNEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEALESEPVIACNPYKRPGPPSTPEASAITKDSMVLTWTRPVDDGGAEIEGYILE

KRDKEGIRWTKCNKKTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVRGYVI

ELKKAAADEWTTCTPPSGLQGKQFTVTKLKENTEYNFRICAFNTEGVGEPATIPGSVVAQERMEAPEIELDADLRKVVTLRASATLRLFVTIKGRPEPEV

KWEKAEGILTERAQIEVTSSYTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRE

TTRKAYATITNNCTKNTFKIENLQEGCSYYFRVLASNEYGIGLPAETAEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGS

EKWSACTQVKTLETTISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIAKDIEIKPSVELPFNTFNVKANDQLKIDIPFKGRPQATVAWKKDGQVLRETT

RVNVASSKTVTTLSIKEASREDVGTYELCVSNTAGSITVPITVIVLDRPGPPGPIRIDEVSCDNVSISWNPPEYDGGCQISNYIVEKRETTSTTWQVVSQ

AVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTMVVSWQVPVNDGGSQVIGYHLEYKERSSILWSKANKV

LIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKACEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPRYDGGAKITGYIVERRELPDGRWLKCNFTNV

QETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIIVKAGEVLKINADIAGRPLPVISWAKDGVEIEERAKTEIV

STDYTTTLTVKDCVRRDTGQYVLTLKNVAGTRTMAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSRLAWTICEAELRT

TSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESMAVKALDPFTTPSPPTSLEITSVTKDSMTLCWSRPETDGGSDISGYIIERREKNSLRWMRVNKKPVYD

LRVKSTGLREGCEYEYRVFAENAAGLSLPSETSPLVRAEDPVFLPSPPSKPKIVDSGKTTITIGWVKPLFDGGAPITGYTVEYKKSEETDWKVAIQSFRG

TEYTMSGLTTGDEYVFRVRSLNKMGASDPSDSSDPQVAKEREEEPVFDVDSEMRKTLIVKAGSSFTMTVPFRGRPIPNVSWSKPDTDLRTRAYIDSTDSR

TLLTIENANRNDSGKYTLTIQNVLSAASMTFVVKVLDSPGPPANITVREVTKETAMLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVT

NLQEGAIYYFRVSGENEFGVGVPAETKEGVKITE EKPSPPEKLGVTSVSKDSVSLSWLKPEHDGGSRIIHYVVEALEKGQKTWVKCAVVKTTHHVVSGL

RESHEYFFRVFAENQAGLSDPRELLLPVLIKDQLE EPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTIN

LKESVTTDAGRYEITAANSSGTTKTFINIIVLDRPGPPTGPVAISDITEESVTLKWEPPKYDGGSHVTNYIVLKRETSTAVWSEVSATVARTMIKVMKLT

TGEEYQFRIKAENRFGISDHIDSVCVVVKLPYT TTPGPPSTPWVSNVTRESITVGWHEPVSNGGSAVTGYHLEMKDRNSILWQKANKMIIRTTHFKVTT

ISAGLIYEFRVYAENAAGIGKPSHPSEPVLAIDACE EPPRNVRITDISKNSVNLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVIETQFTVSG

LTQNSQYEFRVFARNAVGSVSNPSEVVGPITCIDSYG GGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWYKDDKELQTNALVCVENSTDLAS

ILIKDANRLNSGSYELKLRNAMGSASATIRVQILD DKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVAENLEECIVTT

TKIIKGNEYVFRVRAVNKYGIGEPLESEPVVAKNAFV VTPGPPSIPEVTKITKNSMTVVWDRPTVDGGSEINGYFLERRDKKSLAWLKVLKETIRDTRQ

KVTGLTENSDYQYRVCAVNAAGVGPFSEPSDFYKAADPID DPPGPPAKIRIADSTKSSITLGWSKPVYDGGSDVTGYVVEMKQGDEEEWTIVSTRGEVR

TTEYVVSNLKPGVNYYFQVSAVNCAGQGEPITMTEPAQAKDVLE EEPEIDLDVALRTSVIAKAGEDVQLLIPFKGRPPPTVTWRKDEKNLGSDTRYSIQ

NTDSSSLLVIPQVTRNDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQKLQVKHVSLGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSG

TSFKVTDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVVLSWTKPDFDGGSIITDYLVERKGKGEQAWSHAGISKTCEIE

IGQLKEQSVLEFRVSARNEKGQSDPVTIGPLTVKELVITPEVDLSEIPGAQISVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEYVRFSKTENKITL

SIKNSKKEHGGKYTVILDNAVCRNSFPITIITLGPPSKPKGPIRFDEIKADSAIMSWDIPEDDGGGEITCYSIEKREASQTNWKMVCSSVARTTFKVSNL

VKDSEYQFRVRAENRYGVSEPLASNIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQRVNTSPISGREYRATGL

IEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVD DPPGTPDYIDVTRETITLKWNPPLRDGGSKIVAYSIEKRQGSDRWVRCNFTDVSECQYTVTGLS

PGDRYEFRIIARNAVGTISPPSQSSGLIMTRDENV VPPTVEFGPEYFDGLVIKSGDSLRIKALVQGRPVPRVTWFKDGVEIERRMNMEITDVLGSTSLF

VRDATRDHRGVYTVEAKNVSGSTKAEVTVKVQD DTPGKVVGPIRFTNITGEKMTLWWEAPLNDGCAPVTHYIIEKRETSRLAWALIEDNCEALSYTAIK

LITGNEYQFRISAVNKFGVGRPLESDPVVAQIQYT TIPDAPGVPEPSNVTGNSITLTWTRPESDGGSEIQHYILERREKKSTRWVKVISKRPISETRFK

VTGLVEGNEYEFHVMAENAAGIGPASGISRLIKCREPVNPPSAPSVVKVTDTSKTTVSLEWARPVFDGGMEIIGYIIEMCKADLGDWHKVNTEPCVKTRY

TVTDLQAGEEYKFRVSAVNGAGKGDSCEVTGTIKAVDRLSAPELDIDANFKQTHIVRAGVSIRLFIAYQGRPTPTAVWSKPDSNLSIRADIHTTDSFSTL

TVENCNRNDAGKYTLTVENNSGKKSITFTVKVLDSPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVIEKREASRRSWQVVSEKCTRQILKVSELT

EGVPYYFRVSAENEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITSYLLEMRQKGSDFWVEAGHTKQLTFTVERLVENTE

YEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPISGRPAPKVTWKLEEMRLKETDRMSIATTKDRTTLTVKDSMRG

DSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSVSAESCVLSWTEPKDDGGTEITNYIVEKRESGTTAWQLINSSVKRTQIKVTHLTKYKEYCF

RVSSENRFGVSKPLESVPIVAEHPFV VPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKIVGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEY

QFRTYALNAAGVSKASEASRPIMAQNPVD DPPGRPEVTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEG

DTYEFRVLAKNAAGVISKGSESTGPVTCRDEYA APPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKISLQYTGKRATAVI

KYCDRSDSGKYTLTVKNASGTKSVSVMVKVLD DSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECLTASYVVTRLI

KNNEYTFRVRAVNKYGLGVPVESEPIVARNSFT TIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVT

SLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSY YTPGPPSAPRVVDTTKRSISLAWTKPMYDGGTDIIGYVLEMQEKDTDQWCRVHTNATIRNNE

FTVPDLKMGQKYSFRVAAVNAKGMSDYSETTAEIEPVERLE EIPDLELADDLKKTVIVRAGASLRLMVSVSGRPSPVITWSKKGIDLANRAIIDNTESY

SLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYD DTPGPCPSVSVKEVSRDSVTITWEIPTIDGGAPVNNYIIEKREAAMRAFKTVTTKCSKTLYR

ISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVI

SLNEGEQYLFRVRAQNEKGVSEPREIVTPVTVQDLRV VLPTIDLSTMPQKTIHVPAGRPIELVIPITGRPPPTASWFFAGSKLRESERVTVETHTKVTK

LTIRETTIRDTGEYTLELKNVTGTTSETIKVIILD DKPGPPTGPIKIDEIDATSVTISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRPTFKF

TRLTEGNEYVFRVAATNRFGIGSYLQSEVIECRSSIS SIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRY

RSTGLIEGLEYEHRVTAINARGTGKPSRPSKPTVAMDPIA APPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQREWTKCNTTPTKI

REYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLE EYPDYELDERYQEGVFVRQGGVIRLTIPIKGKPFPVCKWTKEGQDISKRAMIATSE

THTELVIKEADRNDSGTYDLVLENKCGKKTVYIKVKVIGSPNTPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTSL

VVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLN NPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQIT

TTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFD DKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKE

RIKDRQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSVKTKLTS SGEAPGVRKEMADVTTK   
Transcript ENSMUST00000111846
Sequence
ATGCCAGTCTACCCGCCTGCCATAGTCACTCCACTTCAGGACACAGTTACTTCTGAGGGGCGCCCAGCGCGTTTCCAGTGCCAAGTTTCAGGGACAG AT

TTGAAGGTGTCTTGGTACTGCAAAGACAAGAAAATCAAACCATCTCGGTTCTTCAGGATGACCCAGTTTGAAGACACCTACCAGCTGGAGATCGCTGAAG

CCTACCCCGAGGACGAGGGAACGTATGCCTTTGTTGCTAATAATGCTGTGGGCCAAGTGTCCAGCACTGCCACCCTGAGGCTGGAAG CCCCCGAGTCGA

TTCTGCATGAGAGGATCGGCCAGCAAATCGAAATGGAGATGAAAG CTGCCCCTGTGATCAAAAGGAGAATTGAGCCCCTGGAAGTAGCTCTGGGCCACC

TGGCCAAATTCACCTGTGAGATCCAAGGAGCCCCCAACGTCCGGTTCCAGTGGTTCAAAGCTGGCAGAGAGATCTATGAGAGCGACAAGTGTTCCATTCG

ATCTTCGAACTATGTCTCCAGCCTGGAGATCCTGAGAACCCAGGTCGTTGACTGCGGGGAGTACACCTGCAAAGCCTCCAATGAGTATGGCAGTGTCAGC

TGCACAGCCACACTAACTGTGACAG AGGCGTATCCACCAACCTTTCTCTCCAGGCCCAAGGCCCTTACGACTTTCGTGGGTAAGGCAGCCAAGTTTCTC

TGCACAGTGTCAGGGACTCCGGTGATTGAGATCATCTGGCAGAAAGATGGCGCTGCCCTGTCACCGTCACCTGACTGCAGGGTCACAGACGCAGACAACA

AACACAGTTTAGAACTCTCAAATCTTACTGTTCAGGACAGGGGTATTTACTCTTGTAAGGCTTCCAACAAATTTGGAGCAGATATCTGCCAGGCCGAGTT

GACCATCATTGACAAACCCCACTTCATTAAAGAGTTAGAGGCTGTACAGTCAGCCATCAATAAGAAGATCCACCTTGAATGCCAAGTCGATGAGGATAGG

AAAGTCACAATCACATGGAGCAAAGATGGGCAGAAACTTCCTGCTGGGAAAGATTACAAGATCTATTTTGAAGATAAAATAGCATCGCTTGAGATTCCCC

TGGCCAAACTAAAAGATTCTGGAACCTATACATGTACAGCGTCCAACGAGGCTGGGAGCAGTTCTTCGTCTGCTGCGGTCGCTGTCAGAG AACCGCCGT

CCTTTGTGAAGAAGGTGGATCCCTCTTATTTAATGCTCCCGGGTGAATCAGCACGCCTCCATTGCAAGCTGAAAGGCTCACCTGTGATCCAGGTCACTTG

GTTCAAAAATAACAAAGAACTCAGTGAGAGTAACACAGTCCGCATGTCTTTTGTCAATTCTGAGGCTATCCTCGACATCACTGATGTAAAGGTCGATGAC

AGTGGTACTTACTCCTGTGAAGCCACCAATGACGTGGGCAGCGACAGCTGCAGCACTGAAGTGGTGATCAAAG AGCCGCCTTCCTTCATCAAAACTCTT

GAGCCCGCAGACATAGTGCGAGGGGCCAATGCACTGCTCCAGTGTGAGATCGCAGGCACGGGACCCTTTGAAGTTAACTGGTTTAAAGACAAGAAGCAGA

TCCGAAGTAGCAAAAAGTACAGGTTGTTTACTCAGAAGACTTTTGTGTACCTGGAAATCTCATCTTTCAATAGTGCCGACGTTGGCGATTACGAATGTGT

AGTTGCTAACGAAGTCGGAAAGTGTGGCTGTGTCGCGACACACTTATTAAAAG AACCACCAACCTTTGTCAAGAAAGTAGATGATTTTACAGCCCTAGC

AGGACAGACCGTTACCTTACAAGCTGCCGTGAGAGGGTCAGAACCCATTTCTGTCATGTGGATGAAAGGCCAAGAAGTCATTAAAGAAGATGGAAAAATC

AAAATGAGCTTTTCCAATGGAGTTGCCGTCTTGACCATCCCTGATGTTCAGATTAGTTTGGGTGGCAAATATACATGCCTGGCTGAAAACGAAGCTGGGA

GCCAAACATCTGTCGGGGAATTGATAGTTAAAG AACCTGCCAAAATCATTGAGCGAGCAGAACTAATCCAGGTGACCGCAGGAGACCCAGCCACTCTGG

AGTACACAGTCTCAGGCACCCCAGAACTCAAGCCCAAGTGGTACAAAGATGGGAGACCCTTGGTTGCTAGTAAAAAGTACCGAATCAGTTTTAAAAACAA

CATTGCCCAACTGAAATTTTATTCTGCTGAACTGCACGACAGTGGCCAGTACACGTTTGAGATTTCCAACGAAGTGGGCAGCAGCTCCTGTGAGACCACA

TTTACCGTGTTAG ATCGAGACATTGCTCCGCTTTTCACCAAACCCTTACGTAACGTGGACAGTGTCGTTGGCGGTGCCTGCAGGTTAGACTGCAAAATT

GCTGGCTCCCTCCCCATGAGGGTTTCCTGGTTTAAGGATGGCAAAGAGCTCACTGCTTCCGACAGATACCAGATAGCATTTGTGGAAGGCACAGCCTCTT

TGGAGATCAGCAGAGTAGACATGAATGATGCAGGGAATTTCACCTGCCGGGCCACCAATTCCGTGGGAAGCAAAGACAGCAGCGGAGCCCTGATTGTGCA

AG AACCACCCAGTTTTGTAACTAAGCCAGGGTCCAGGGATGTCCTGCCCGGCTCGGCAGTCTGTCTGAAGAGTGCTTTCCAGGGCTCCGCCCCTCTCAC

CATCAAGTGGTTTAAGGGCGACAAAGAGTTGGTTTCCGGTGGAAGCTGCTATATTACCAAAGAAACTTCAGAGAGTTCCCTGGAGCTCTACGCAGTGAAA

ACCTCGGATTCGGGCACTTACACGTGCAAAGTCAGCAACGTAGCCGGGAGTGTGGAATGCAGTGCAGACTTGTTTGTGAAAG AGCCTGCTACCTTTATT

GAAAAGTTAGAGCCATCCCAACTGTTAAAGAAAGGAGATGGCACTCAGCTAGCCTGCAAGGTCACGGGTACCCCTCCAATTAAGATAACATGGTTTGCAA

ATGACCGAGAACTGAGAGAGAGCAGCAAACACAAAATGTCTTTTGCGGAGTCCACCGCAGTTTTAAGGCTTACGGATGTGGCCATTGAAGACAGTGGAGA

ATATATGTGCGAGGCACAAAACGAGGCCGGCAGTGACCACTGTACTGGCATTGTCATAGTCAAAG AGTCACCTTACTTTACCAAGGAATTTAAGTCCAT

TGAAGTATTAAAGGAGTATGACGTCATGCTGCTGGCTGAGGTGGCAGGCACCCCTCCCTTTGAGATCACTTGGTTCAAGGACAACACAACCCTGAGAAGT

GGTAGAAAGTATAAAACCTTCCTTCAGGATCAGCTGGTCAGCCTGCAGGTCCTCAAGTTTGTAGCTGCAGATGCAGGTGAATACCAATGCCGGGTGACCA

ACGAGGTCGGCAGCAGCACCTGCAGTGCCAGGGTGACATTAAGAG AACCCCCGTCCTTCATTAAGAAGATTGAAGCCACCAGCTCCCTCCGTGGGGGCA

CAGCCGCCTTCCAGGCCACTCTGAAAGGCTCCTTGCCAATCACTGTGACCTGGTTGAAAGACAATGATGAGATCACTGAAGATGACAATATAAGAATGAC

TTTTGAGAACAACGTGGCTAGTCTATACCTCAGTGGTATTGAAGTCAAGCATGATGGGAAATATGTCTGTCAAGCCAAAAATGATGCAGGCATACAAAGG

TGTTCTGCATTACTCTCAGTCAAAG AACCTGCAACAATAATGGAGGAGGCTGTGTCCATAGATGTCACTCAAGGAGACCCAGCCACTTTGCAAGTTAAA

TTTTCAGGGACTAAGGAGATTTCAGCTAAATGGTTTAAAGATGGCCAAGAACTTACCCTGGGTCCAAAATACAAAATCAGTGTCACTGACACAGTCTCAA

TACTAAAGATTATTTCCACAGAGAAGAAGGATAGTGGAGAATATACTTTTGAGGTCCAAAACGATGTTGGGAGAAGCAGCTGCAAGGCTAGCATTAATGT

TTTAG ATCTTATTATACCTCCTTCATTCACCAAAAAATTGAGAAAAATGGACAGCATTAAAGGATCTTTTATTGACTTAGAGTGTATAGTGGCTGGATC

CCATCCAATAAGCATCCAATGGTTCAAAGACGACCAAGAAATCTCAGCTAGTGACAAGCACAAATTCTCTTTTCATGACAATACCGCCTTCTTAGAGATC

AGTCAGCTGGAAGGCACAGACAGTGGTACATATACCTGTTCTGCCACCAACAAGGCAGGCCACAGCCAGTGCAGTGGTCACCTGACAGTCAAAG AACCC

CCTTACTTCGTGGAAAAGCCACAGTCACAAGATGTGAATCCCGGTACGAGGGTTCAATTGAAGGCTCTTGTGGGTGGCACTGCACCCATGACAATAAAGT

GGTTTAAAGATAACAAGGAGCTGCACCCTGGGGCAGCTCGCTCGGTTTGGAAGGATGACACCTCCACCATTCTTGAACTCTTCTCAGCCAAGGCTGCCGA

CTCCGGGACCTACATTTGCCAGCTAAGCAATGATGTTGGCACAACAAGCAGCAAGGCCACCATCTTTGTGAAAG AACCTCCTCAATTTATTAAGAAGCC

CAGTCCAGTGTTAGTGCTGAGGAATGGACAGTCAACAACATTTGAATGCCAAGTCACAGGCACCCCTGAAATCAGAGTTTCTTGGTATCTGGATGGGAAT

GAAATAACAGATCTTAGGAAATATGGCATTTCTTTTGTGGATGGTTTAGCCACTTTCCAGATTTCTAATGCCAGGGTTGAAAACAGTGGAACTTACGTCT

GTGAAGCTCGAAATGATGCAGGCACCGCGAGCTGCAGCATTGAACTAAAAGTAAAAG AGCCTCCCATCTTTATCCGGGAGCTGGAGCCTGTGGAAGTGG

TAAAAGACAGTGATGTGGAACTGGAGTGTGAAGTCATGGGGACAACTCCATTTGAAGTCACTTGGCTGAAGAATAACAAGGAAATCAGAAGTGGCAAAAA

ATACACAATGTCTGAGAAAATGTCAGTGTTTTACCTGCATATAACCAAGTGTGACCCTTCAGACGTTGGTGAATATCAGTGCATCATAGCCAACGAAGGA

GGCAGCTGTGCTTGTAGTGCTCGGGTTGCCTTGAAAG AACCACCATCGTTTATCAAGAAGATAGAAAATGTCACCACTGTCTTGAAGAGTTCCGCCACC

TTTCAGAGCACCGTGGCAGGCTCACCGCCCATTTCTATAACCTGGCTAAAAGATGACCAGATTCTTGAGGAAAATGACAATGTCCATATTTCTTTTGAGG

ACAGTGTGGCCACACTTCAAGTCCGGAGTGTGGACAATGGGCACAGTGGGCGATACACATGTCAAGCCAAGAATGAGTCAGGAATTGAGAGGTGTTATGC

TTTCCTCTTAGTACAAG AACCTGCTCAAATCATAGAGAAAGCTAAGTCGGTTGATGTTACTGAGAAAGACCCAGTCACCCTGGAGTGCGTAGTGGCTGG

AACACCAGAACTCAAAGTCAAATGGCTTAAAGATGGGAAACAAATTGTACCCAGTAGATATTTTTCAATGAGTTTTGAAAATAACGTGGCCAGTTTTAGG

ATTCAGTCAGTCATGAAGCAAGACAGTGGACAGTACACGTTCAAGGTGGAAAATGACTTTGGAAGCAGTAGCTGTGATGCCTACCTGAGAGTGCTAG AC

CAAGATATTCCCCCATCGTTCACCAAAAAGTTAACCAAAATGGATAAAGTTCTGGGTTCTTCTATCCACATGGAGTGCAAGGTTTCTGGGTCACTTCCTA

TCAGTGCTCAGTGGTTTAAAGATGGAAAAGAGATATCTACAAGTGCAAAATACAGACTGGTGTGTCACGAAAACACCGTGTCACTGGAAGTTAGTAATCT

GGAATTAGAAGACACTGCAAATTACACCTGCAAGGTGTCCAATGTAGCAGGGGACAACGCCTGTAGTGGCATCTTAACTGTGAAAG AACCACCAAGCTT

CCTAGTGAAACCCGAGAGGCAGCAAGCTATACCGGATTCTACCGTGGAATTTAAGGCTGTGCTGAAAGGAACACCACCGTTCAAAATTAAATGGCTTAAA

GATGATGTGGAACTTGTCTCAGGACCTAAGTGTTTCATTGGCTTGGAAGGGTCAACCAGCTTCTTAAACCTCTACTCAGTGGATTCTTCCAAGACTGGAC

AGTATACTTGCCAAGTTACCAATGACGTTGGTAGCGACTCTTGCACTACAATGTTGCTTGTGACAG AACCACCGAAATTTGTAAAGAAATTAGAAGCTT

CCAAAATTATAAAAGCAGGTGACTCTGCACGATTGGAATGCAAGATTACTGGATCTCCAGAAATACAAGTTGTGTGGTATAGAAACGAACACGAGCTCAC

AGCCAGCGATAAATACCAGATGACTTTCATTGACTCGGTGGCGGTCATACAGATGAACAGCCTTGGGACAGAAGACAGTGGAGATTTTATCTGTGAGGCT

CAGAATCCTGCCGGCAGCACCAGCTGCAGTACCAAGGTTATAGTAAAAG AACCACCTGTTTTTAGCAGCTTTCCGCCTATAGTAGAAACCCTTAAGAAC

ACTGAAGTTAGCCTTGAATGTGAGCTTTCAGGAACACCGCCATTTGAGGTGGTGTGGTACAAAGACAAGCGCCAGCTCCGAAGCAGCAAGAAGTACAAGG

TCGCATCTAAGAATTTCCATGCGAGCATTCACATCCTCAACGTGGAATCTACAGACATTGGCGAATACCACTGCAAAGCACAGAATGAAGTGGGCAGTGA

CGCTTGCGTTTGCGCTGTAAAGTTAAAAG AACCACCAAAATTCATTTCCAAGCTGAACAGCCTTACGGTGGTAGCTGGCGAGCCTGCTGAGCTGCAAGC

ATCCATAGAAGGTGCCCAGCCCATTTCTGTCCAGTGGCTTAAAGAGAAAGAAGAAGTGATCAGAGAGAGCGAGAACATTAGAATTTCTTTCGTCAACAAC

GTTGCAACTCTGCAGTTTGCTAAAGTGGAGCCAGCTAATGCTGGGAAGTACATTTGCCAAGTCAAGAATGATGGCGGAGTGAGGGAAAACATGGCCACGT

TGACCGTCTTAG AGCCTGCGGTCATTATAGAGAAGGCAGGGTCCATGACGGTGACTGTGGGAGAAACGTGTGCCCTGGAGTGTAAGGTGGCTGGCACTC

CGGAGCTCTCTGTTGAATGGTATAAGGACGGAAAGCTCTTGACCAGCAGCCAAAAACACAAATTTAGCTTCTACAACAAAATCTCTTCCTTAAAAATCCT

CTCAGTTGAAAAGGAAGATGCAGGCACCTACACATTCCAGGTTCAGAACAACGTTGGAAAAAGCAGTTGCACAGCTGTGGTCGATGTGTCAG ACCGAAT

GGTCCCTCCCTCTTTCACACGAAGACTGAAGGATACTGGTGGTGTCCTGGGCACCTCTTGCATCTTAGAATGTAAAGTAGCTGGATCGTCTCCCATCTCT

ATTGCCTGGTTTCATGAGAAAACTAAGATTGTCAGTGGAGCAAAGTACCAAACAACATTTTCAGATAATGTCTGCACATTGCAGTTGAATTCTCTGGACT

CATCAGATATGGGCAGTTACACATGTGTGGCTGCTAACGTGGCTGGGTCGGATGAATGTCGCGCACTGTTGACTGTACAAG AGCCACCCTCTTTTGTGA

AAGAACCTGAACCCCTGGAAGTCCTTCCGGGCAAAAACATAACCTTCACAAGTGTTATCAGAGGAACCCCTCCATTCAAGGTTGGCTGGTTTAGGGGAGC

CAGAGAACTGGTGAAAGGTAACAGATGCAATATCTATTTTGAAGACACTGTGGCAGAACTGGAATTATTTAATATCGACATATCCCAGAGTGGGGAATAC

ACCTGCGTGGTTTCTAACAATGCCGGCCAAGCATCCTGCACTACACGTCTCTTTGTGAAAG AACCAGCCACGTTTGTAAAGAAGTTAAGTGATCACTCT

GTAGAACCAGGGAAGTCTATAATTCTAGAGGGCACCTATACTGGAACACTTCCAATTTCGGTCACCTGGAAAAAAGACGGTGTTAGCATAACTCCATCTG

AAAGATGTAACATTGTCACCACGGAGAAAACGTGCATCCTGGAGATTCTGAGCAGCACCAAGGGAGATGCAGGGCATTACTCCTGTGAGATTGAAAACGA

GGCAGGAAGAGATGCTTGCGACGCTCTTGTATCTACATTAG AACCACCTTATTTTGTTACGGAGTTAGAACCTCTGGAGGCATCTGTTGGAGATTCAGT

TTCCTTGCAATGCCAAGTTGCTGGGACACCAGAAATTACAGTGTCTTGGTTCAAAGGAGACACCAAATTAAGGTCAACTCCGGAATACAGGACCTACTTT

ACAAACAACGTGGCCACACTTGTGTTTAATAAAGTGAGCATCAATGACAGCGGGGAGTACACGTGCATGGCGGAGAATAGCATAGGAACAGCAGCCTCTA

AGACCATCTTCAGAATCCAAG AGCGCCAGCTCCCGCCTTCCTTTGCAAGACAGTTAAAGGACATTGAGCAAACTGTTGGATTACCAGTTACCCTCACTT

GTCGACTAAATGGCTCTGCACCCATCCAAGTGTGCTGGTATAGAGATGGGGTGCTTTTAAGAGATGATGAAAATCTACAGATGTCATTTGTGGATAATGT

GGCAACATTAAAAATTTTGCAAACTGACCTGAGTCACTCTGGCCAGTATTCTTGCTCAGCTTCCAATCCACTTGGCACAGCATCTTCTACTGCTAGACTA

ACAGCAAGAG AACCTAAGAAATCACCCTTCTTTGATATCAAGCCAGTATCAATAGATGTTATCGCTGGAGAAAGTGCAGATTTTGAGTGTCATGTGACT

GGTGCTCAGCCAATGAGAGTCACTTGGTCAAAAGATAACAAGGAAATCCGACCTGGAGGAAACTATACTATCACGTGTGTGGGTAACACTCCCCATCTGA

GGATTCTTAAAGTGGGCAAAGGAGACTCTGGCCAATACACGTGTCAAGCCACCAATGACGTTGGCAAGGACATGTGCTCTGCTCAGCTCAGTGTGAAAG 

AACCTCCTAAGTTTATTAAGAAATTAGATGCTTCAAAAGTTGCGAAGCAGGGAGAATCCATCCAACTGGAATGTAAGATAAGTGGCTCCCCAGAGATCAA

AGTTGTGTGGTTCCGGAATGACAGCGAACTTCACGAAAGCTGGAAATACAACATGTCCTTCGTGAATTCTGTGGCCCTGCTAACCATCAATGAAGCCAGT

GCTGAGGACACTGGGGACTACATCTGTGAAGCCCACAATGGCGTTGGTGATGCCAGCTGCAGCACAGCCCTGAAAGTTAAAG CACCTCCTGTCTTTACC

CAGAAGCCTCCTCCAGTTGGAGCCCTGAAAGGTTCTGATGTGATCCTGCAGTGTGAAATTTCAGGAACACCCCCCTTTGAGGTGGTGTGGGTTAAAGATC

GGAAGCAAGTGCGAAGCAGCAAGAAATTTAAAATCACCTCCAAAAATTTTGACACGAGTCTTCATATCTTTAATCTGGAAGCCCCTGACATAGGGGAATA

TCACTGCAAAGCCACGAATGAGGTGGGAAGTGACACGTGCGCTTGCACGGTCAAGTTCAAAG AACCACCACGATTTGTGAAAAAACTCAGTGATGCGTC

CACCCTTATTGGGGATCCCGTGGAGTTACAAGCCGTGGTAGAAGGTTTCCAGCCGATTTCCGTTGTCTGGCTGAAAGATAAAGGTGAAGTCATCAGAGAG

AGCGAAAACGTTAGGATTTCCTTTGTTGATAACATCGCAACTCTCCAACTGGGAAGTCCAGAAGCATCACAGTCTGGAAAATATGTGTGCCAAATCAAAA

ACGATGCCGGGATGCGAGAGTGTTCAGCAGTCCTGACTGTCCTAG AACCAGCCACAATTGTAGAGAAACCAGAACCCATGACTGTCACAACTGGAAACC

CCTTCACATTGGAGTGTGTAGTAGCTGGGACTCCAGAACTTTCAGCCAAGTGGTTCAAAGATGGTAGAGAACTATCTTCAGGCAGCAGACATCACATTAC

ATTTGTCAGAAACCTGGCTTCCCTTAAGATCCCTTCTGCAGAAATGAATGACAAGGGCTTATATACCTTCGAGGTGGAAAACAGAGTTGGCAAAAGCAGC

TGCACTGTGTCTGTCCATGTCTCAG ACCGAGTTGTTCCACCGTCCTTCGTCCGAAGGCTTAAGGACACAAGTGCCACGCTCGGAGCTTCTGTGGTTTTG

GAGTGTCGAGTGTCGGGCTCAGCCCCCATATCAGTCGGCTGGTTTCTTGATGGAAATGAGATCATTAGCAGTCCCAAATGCCAGTCCAGCTTTGCAGATA

ACGTCTGCACTCTGACTCTGAGCTCCCTGGAGCCCTCTGACACTGGCGCATACACCTGTGTGGCTGCCAATGTAGCCGGCCAGGATGAAAGCTCTGCAGT

TCTGACTGTCCAAG AACCACCATCTTTTGAACAAACCCCTGACTCTGTGGAAGTTTTGCCTGGAATGAGCCTGACATTCACCAGTGTCATTAGAGGCAC

CCCTCCCTTCAAGGTCAAGTGGTTTAAGGGCAGCAGGGAGCTGGTGTCCGGGGAGGCTTGTACCATTTCTTTAGAAGACTTTGTCACTGAGTTGGAGCTC

CTGGAGGTGGAGCCGGGGCAGAGTGGAGATTATTCTTGCCTGGTGACCAATGATGCCGGCAGTGCTTCCTGTACCACGCATCTCTTTGTGAAAG AACCA

GCCACTTTTGTGAAAAGGTTGGCTGATACCAGTGTGGAGACAGGTAGCCCCATCGTTCTGGAGGCTACTTACTCTGGCACACCACCTATCTCTGTGAGCT

GGATGAAGAACGAATATCCTCTTTCACAGTCTCCCAACTGTGGCATCACCACAACAGAAAAATCTAGCATCCTGGAAATTCTTGAGAGCACAATAGAGGA

TTATGCACAGTACGCTTGCCTGATAGAAAATGAAGCCGGACAGGATATCTGCGAAGCTCTTGTGTCCGTCTTGG AACCACCTTACTTTATCGAACCCCT

GGAACATGTGGAAGCAGCTATTGGAGAGCCCATAACTTTACAGTGTAAAGTGGATGGAACCCCTGAGATCAGGATTTCTTGGTATAAGGAACATACAAAG

CTACGGTCAGCTCCTGCATATAAGATGCAATTCAAAAACAACGTGGCCTCCTTAGTCATCAACAAGGTGGACCACAGTGATGTGGGAGAGTACACCTGCA

AGGCAGAAAACAGCGTGGGGGCTGTTGCTTCTTCTGCCGTGCTGGTTATCAAAG AGCGTAAACTTCCACCTTCCTTTGCGAGAAAGCTGAAAGATGTCC

ACGAGACTCTTGGCTTCCCAGTTGCTTTTGAATGTCGAATCAATGGCTCAGAACCTCTTCAGGTGTCTTGGTACAAGGATGGTGAACTTTTGAAAGACGA

TGCTAATTTGCAGATGTCTTTTGTTCATCATGTTGCCACTCTTCAGATTTTGCAAACTGACCAGAGCCACGTTGGTCAGTATAACTGTTCAGCTTCTAAT

CCGCTTGGGACTGCTTCGTCCAGTGCTAAGCTCATTCTCTCAG AACATGAAGTGCCTCCCTTCTTTGACTTAAAGCCTGTGTCAGTAGACCTTGCTCTT

GGTGAAAGTGGTTCTTTTAAATGTCATGTCACTGGAACAGCACCGATCAAAATCACCTGGGCTAAAGATAACCGTGAGATTCGCCCTGGAGGCAACTACA

AGATGACTCTGGTGGAAAATACTGCCACTCTGACGGTGCTCAAAGTAGCCAAAGGTGATGCTGGACAGTATACCTGCTACGCGAGCAACGTGGCTGGAAA

GGACTCTTGTTCTGCTCAACTTGGTGTACAAG AACCCCCCAGGTTCATTAAAAAGCTAGACCAATCACGGATCGTGAAGCAGGATGAGTATACAAGATA

CGAGTGCAAAATAGGCGGGTCTCCAGAAATCAAGGTTTTGTGGTATAAGGATGAGGTGGAGATTCAAGAAAGCAGTAAATTCCGGATGTCATTCGAGGAC

TCGGTGGCCATCCTGGAGATGCACAGTCTCAGTGTGGAAGACAGCGGGGACTACACCTGTGAGGCTCGCAACGCAGCAGGGAGCGCCAGCAGCAGCACCT

CCCTGAAGGTTAAAG AACCACCCGTGTTCCGCAAAAAGCCTTTTCCGGTTGAGACACTTAAAGGAGCCGATGTTCACCTTGAGTGTGAGCTTCAGGGGA

CACCTCCCTTTCAAGTTTCTTGGCACAAAGACAAGCGAGAACTTAGGAGTGGGAAGAAGTACAAGATTATGTCTGAGAATTTGCTCACGAGCATCCACAT

CCTGAACGTAGACACGGCAGACATTGGGGAATACCAGTGCAAAGCCACAAACGATGTTGGGAGTGATACCTGTGTGGGCTCTGTCACTATGAAAG CACC

ACCACAATTTGTGAAGAAGCTCACCGACATTTCTACCATCATTGGCAAAGAAGTCCAGCTGCAGACAACAATTGAAGGCGCTGAGCCAATTTCAGTGGCG

TGGTTCAAAGACAAAGGGGAAATTGTTAGAGAGAGTGACAACATATGGATTTCTTACTCTGAAAACATCGCCACCCTCCAGTTTTCAAGAGCAGAACCAG

CCAATGCTGGGAAATACACCTGCCAGATCAAAAACGATGCTGGGATGCAGGAGTGCTACGCCACGCTATCAGTGCTCG AGCCTGCTGCAATTGTGGAAA

AGCCAGAATCTATTAAGGTGACCACAGGAGACACCTGTACCTTGGAGTGCACGGTATCAGGAACACCTGAGCTTAGTACCAAGTGGTTTAAGGACGGAAA

GGAGCTCACGAGTGACAACAAATATAAAATAAGCTTCTTCAACAAGGTGTCTGGCCTCAAGATCATCAATGTGGTGCCTGGCGACAGTGGGGTGTACAGC

TTTGAAGTGCAAAACCCTGTCGGCAAAGACAGCTGCAAAGTCTCCATTCAAGTCTCAG ATCGAATCATCCCTCCCTCGTTCACAAGAAAACTGAAAGAG

ACGAACGGTCTGTCGGGCTCCTCCGTGGTGATGGAGTGCAAAGTGTACGGATCACCCCCAATCTCTGTCCTGTGGTTCCATGACGGGAATGAGATCAGCA

GTGGCCGGAAGTACCAGACCACACTGACAGACAACACGTGTGCCCTGACGGTGAACATGCTGGAGGAAGCTGACGCCGGCGACTATACATGTATAGCTAC

CAATGTGGCAGGCTCCGACGAGTGTAGTGCCCCTCTGACTGTACGAG AGCCACCATCTTTTGTTCAGAAACCTGACCCGATGGATGTCTTAACTGGCAG

TAATGTCACGTTCACAAGCATTGTCAAAGGCTCACCTCCTTTCACTGTCAGCTGGTTCAAAGGTAGCACTGAGCTTGTGCCTGGGGCCAGGTGCAACGTG

TCTCTGCAGGACTCGGTGGGTGAACTGGAGCTGTTTGACGTGGATACGTCCCAGAGCGGAGAATACACCTGCATAGTTAGTAACGAGGCTGGCAGGGCTT

CCTGCACAACACGTCTCTTCGTAAAAG CCCCAGCCATATTTGTGAAGCGACTCAATGACTACAGCATAGAGAAAGGCAAGCCTCTGATCCTTGAAGGGA

CCTTCTCTGGAACTCCTCCGATCTCTGTTACATGGAAGAAAAATGGCATAAATGTCATAGCTTCCCAACGGTGTAATATTACCACAACTGAAAAATCAGC

CATCCTAGAAATTCTGAGCAGCACTGTCGAAGATTCAGGGCAGTACAACTGCTACATTGAAAACGCTTCTGGCAAGGACTCCTGCTCGGCCCAGATCCTG

ATTCTAG AACCACCGTATTTTGTCAAGCAGTTGGAGCCTGTGAAGGTGACGGTTGGTGACTCTGCCTCTCTACAATGCCAGCTTGCTGGAACTCCCGAG

ATTGGGGTCTCCTGGTATAAAGGAGACACAAAGCTCAGGCCCACTGCCACCTGCAAAATGCATTTTAAGAACAACGTTGCGACACTGGTTTTCACCCAGG

TTGATAGCAGCGACAGCGGAGAATATATCTGCAGGGCTGAGAACAGTGTAGGCGAGGTTTCTTCATCAACTTTCCTGACTGTTCAAG AGCAAAAACTTC

CACCATCCTTTTCTCGACAACTAAGAGATGTGCAAGAGACCGTGGGATTGCCAGTGGTTTTTGAATGTGCTGTAAGTGGGTCCGAGCCCATCTCTGTGTC

TTGGTACAAAGATGGCAAGCCGTTGAAAGACAGCCCAAATATACAAACATCATTTTTAGACAACATCGCCACTCTGAACATCTTTAAGACAGACAGGAGT

CTCTCGGGCCAGTACTCTTGCACTGCTACAAACCCCATTGGCTCTGCTTCTTCAGGCGCCAAACTCATCCTCACAG AGGGGAAGAACCCACCCTTCTTT

GATATCCCTCTGGCCCCTATGGATGCTGTTGTGGGAGAAAGTGCTGACCTGGAATGCCATGTCACGGGAACACAGCCCATTAAGGTAACCTGGGCCAAGG

ACAACAGAGAGATACGAAGTGGTGGAAACTACCAGATCAGCTATCTGGAAAACAGTGCCCACCTGACCATCGTGAAAGTGGACAAAGGTGACTCTGGCCA

GTACACCTGCTACGCCGTCAATGAAGTGGGAAAAGACTCCTGCACAGCCCAACTCAATATAAAAG AGCGCCTCATCCCACCGAGTTTCACCAAAAAACT

ATCTGAGACGGTAGAAGAGACAGAAGGGAACTCATTCAAACTGGAAGGGCGTGTGGCAGGGTCCCAGCCCATCACCGTTGCTTGGTACAAAAATAATGTA

GAGATCCACCCGACCTCCAACTGTGAGATCATGTTCAAGAACAACGCACTGCTGCTGCAGGTGAAGAGGGCCAGCATGGCCGATGCAGGCTTATACACCT

GCAAGGCGACAAATGACGCAGGCTCTGCCCTGTGCACATCGTCCATTGTCATCAAAG AGCCTAAGAAGCCGCCTGTGTTTGACCAGCACCTTGCCCCGG

TCACGGCCAGCGAAGGTGACTCTGTACAGCTCAGCTGCCACGTGCAGGGCTCCGAGCCCATTCGGATCCAGTGGTTGAAAGCTGGTAGGGAGGTAAAGCC

TTCGGACAGGTGCAGCTTCAGCTTTGCTAGCGGAACCGCCATGCTGGAACTCAAGGAGACAGCTAAAGCAGATTCAGGAGACTACGTGTGTAAGGCTTCC

AACGTGGCTGGAAGTGACACTTCAAAGTGCAAAGTGACCATTAAAG AGAAACCAGCCGCAGCCCCAGCAGCCAAGAAAGCAGCCGTGGATGGAAAACTC

TTCTTCGTGTCAGAGCCTCAGAGCATCAGAGTAGTGGAAA AAACCACTGCCACGTTTATTGCAAAAGTTGGAGGTGACCCGATCCCGAATGTCAAATGG

ACAAAAGGGAAGTGGAGACAGCTGAACCAAGGGGGTCGCATTCTTATCCATCAAAAGGGCGACGAAGCGAAGCTGGAGATTCGTGACACCACAAAAACCG

ATTCTGGCTTATACCGTTGCGTTGCCTTTAACAAGCACGGTGAAATTGAAAGCAATGTCAACCTACAGGTGGATGAAAGAAAGAAACAAGAGAAGATTGA

AGGTGATCTTCGCGCGATGCTGAAAAA GACTCCAGCCCTCAAGAAAGGATCTGGGGAAGAAGAGGAAATTGATATCATGGAACTTCTCAAAAATGTGGA

TCCTAAAGAGTATGAGAAGTATGCGCGCATGTACGGAATCACCGACTTCCGGGGCCTCCTCCAAGCGTTTGAGCTGCTGAAACAGAGCCAGGAAGAAGAG

ACTCACAGACTG GAAATCGAGGAACTAGAGAAGTCAGAAAGAGATGAAAAGGAATTCGAAGAACTTGTAGCATTTATTCAGCAAAGGCTGACACAGACA

GAG CCTGTCACTTTGATCAAGGATATTGAAAATCAGACAGTTCTGAAAGATAATGACGCCATCTTTGAAATTGACATTAAGATTAATTATCCAGAAATC

AAGCTTTCCTGGTACAAAGGGACTGAAAAGCTGGAGCCCAGTAACAAATATGAAATAAGCATCGATGGTGACCGGCACACACTCAGAGTCAAAAACTGTC

AGCCTAAAGATCAGGGCAATTACCGTCTGGTCTGTGGTCCCCACATCGCTAGTGCCAAGCTAACTGTGATTG AGCCCGCCTGGGAGCGGCATCTCCAGG

ACGTTACTCTGAAGGAAGGCCAGACTTGTACCATGACGTGTCAGTTTTCTGTACCAAATGTGAAATCTGAGTGGTTCAGAAATGGCAGAGTCCTTAAACC

TCAAGGCAGAGTGAAAACGGAAGTGGAACACAAAGTCCACAAGCTGACCATTGCCGATGTCCGTGCAGAGGACCAGGGTCAGTACACCTGCAAGCACGAA

GACCTCGAAACTTCAGCAGAGCTCAGAATCGAAG CCGAACCCATTCAGTTTACAAAGCGCATACAGAACATCGTGGTGAGCGAGCATCAGTCTGCTACT

TTCGAGTGCGAAGTGTCCTTTGACGACGCCATAGTTACCTGGTACAAAGGACCAACAGAGCTGACTGAGAGCCAGAAATACAACTTTAGAAACGACGGCC

GCTGCCATTACATGACAATCCACAATGTGACCCCAGATGACGAAG GTGTCTATTCAGTAATTGCTCGGCTGGAGCCAAGAGGCGAAGCAAGAAGCACAG

CGGAACTGTACTTAACAACCAAAG AAATAAAACTTGAGATGAAGCCTCCTG ATATTCCCGATTCCAGAGTTCCAATCCCAACCATGCCCATCAGAGCT

GTCCCACCGGAAG AAATCCCTCCTGCGGTTGCTCCTTCCATCCCTCTTTTGCTGCCATTACCTGAAGAGAAGAAGCCGCCAGCAAAACGAATTGAAG T

GACCAAAAAGGGTGTGAAAAAAGATACCAAAAAAGTTGTCACAAAGCCCAAAGAAGAGGCCCCACCACCACCAG TTGCCAAGAAGCCTCCACCTCCTAC

TCCCATGATTCCAGCAAAAG CTTCTGAGATTATTGACGTGTCCTCTAAGGCTGAAGAGGTAAAAATAACAACCATCACCAGAAAGAAAGAGGTTCACAA

AGAGAAAGAGGCTGTGTATGAACGAGAGGAAGCAGTCTACGAAAAGAAAGTTCACATAGAGCCTTGGGAAGAGCCCTATGAGGAATTGGAAACGGAACCA

TACACAGAGCCATATGAAGAACCCTATTATGAAGAACCAGATGAAGACTATGAAGAGATCAAGGTGGAAGCTAAAAAGCAAGTCCACGAGGAATGGGAGG

AGGACTTTGAAGAAGGACAGGAGTACTATGAGAGAGAAGAGGGCTACGATGAAGGGGAGGAAGAGTGGGAAGAGATTTACCATGAAAGAGAAATAATTCA

GGTTCAGAAGGAGGTTCATGAAG AATTACATGAGAAGAAAATCCCAGCCAAAGTGCCTGAAAAGAAAGTACCACCTCCCAAAG TTGTAAAGAAGCCAG

TAGTTGAAAAAGTTGAAAAGACTACTCGGAGAATGGAGGAAGAAAAAGTTCAAGTCATCAAAG TACCTGAAGTTTCTAAGAAGATTGTTCCACAAAAAC

CTTCCCGGACTCCAGTGCAGGAAGAAATAATTGAAGTGAAAG TACCAGCTGTGCACACAAAGAAGATGGTTATCTCTGAAGAAAAGATGTTCTTTGCTT

CTCACACAGAGGAAGAGGTGTCTGTCTCAG TCCCCGAGGTGCAAAAGAAAACTGTCACTGAAGAGAAAATTCACGTTGCAGTTTCCAAAAAGATTGAAC

CACCACCCAAAG TCCCTGAACCACCTAAAAAGCCAGTTCCAGAAGAAGTGGTCCCTGTTCCCATTCCTAAGAAGGTGGAACCCCCAGCAGCCAAAG TT

CCTGAGGCTCCCAAGAAACCTGTGCCAGAGGAGAAAAAGCCAGTTCCTATTCCCAAGAAGAAAGAGCCAGCTGCCCCTCCACAAG TCCCAGAGGCTCCA

AAGAAACCTGCTCCCGAAGAAAAGATTCCTGTTCCTGTGACAAAGAAGAAGGAAGCCCCTCCAGCTAAAG TTCCTGAAGTGCAGAAGAAGGTTGTCACA

GAAGAAAAAATAGCCATCATTACTCAAAGAGAGGAGTCCCCTCCACCAGCAG TACCAGAAATACCAAAGAAGAAAGTTCCCGAAGAAAAAAGACCTGTT

CCTAGAAAAGAGGAAGTCCCCCCACCAAAAG TGCCAGTGCCACCTAAGAAAGCTGTTCCTGAGGCGGTTGTTCCAGCTCCCATCCCTAAGAAAGCTCCT

CCCCGAG CTGAAGTTTCTAAGAAAACTGTTGTAGAAGAGAAAAGATTTGCTGCTGAAGAAAAACTATCGGTGGCAGTTCCTCAGAGAGTGGAACTCATG

CGGCACGAAG AGGAGGAATGGACTTACTCTGAAGAAGAGGAAAGAGTGTCTGTTTCGGTGTATAGGGAAGAGGAAAGAGATGAGGAGGAAGCAGAAATC

ACAGAGTATGAAG TGTTGGAAGAGCCCGAGGAATATGTTGTGGAAGAAAAGATGCACTTTATCTCTAAGAAAGTGGAAGTTGAACCAGCCAAAG TGCC

TGAGAAGAAAATTATACCAAAACCAAAAGTTCCTGCTAAAATTGAGGAGCCTCCACCCACTAAAG TTCCCGAACCACCAAAGAAAATTGTACCAGAGAA

GAAAGTTCCTGCACCAGCTCCCAAAAAGGTGCCGCCAGCCAAAG CCCCTGAAGAATCAAAGAGACCAGTTCCCGAGAAGAGGGCTCCTGCAGAAGAGGT

TGGGATAGAAGAACCTCCCCCAACCAAAG TGGCCGAAAGGCACATGAAAATTACCCAGGAAGAAAAAGTTCTTGTGGCTGTAACTAAAAAGGAGGCGCC

TCCGAGAGCGAGAG TGCCAGAGGAACCTAAGAAAGTTGCCCCTGAAGAAAGATTTCCCAAGCTCAAACCTCGAAGAGAGGAGGAGCCACCAGCTAAAG 

TGACCGAAGTTAGAAAAAGAGCTGTTAAAGAAGAAAAGGTGTCCATTGAAGTTCCAAAGAGAGAACCCCGACCCACTAAAG AAGTGACTGTGACAGAAG

AGAAGAAATGGTCTTACACCCGAGAAGAAGAAACTGTTTCAGAACATCGGGAGGAGGAGTATGAGGATTACGAAGACTATGAGGAGTATAAAGAGTTTGA

GGAGTACGAACCCACCGAAGAATATGACCAGTATGACGAGTATGCAGAGCGTGAGGTGGAGCACTATGAAGAGCATGAGGAATACGTCACAG AACCCAA

GAAGCCTGTCCCAGTGAAACCTGCCCAAGAACCGGTGCCTGCTAAACCCAAGGCTCCCCCACCAAAAG TGCTAAAGAAAGCTGTCCCTGAAGAAAAAGC

ACCCCTGCCCATTCAAAAGAAACTCAAACCTCTGCCACCCAAAG CTCCCGAAGAACCAAAGAAAGTTGTTGAAGAAAAAATACAGATTTCAATTACCAA

ACGTGAAAAGCAGCAGGTGACTGAACCGGTCGCCAAAG TGCCTATGAAGCCCAAGAGAGTTGTCCCAGAGGCAAAAATACCTGCCCCTACAAAGGAAGT

GGCAGTGCCTGTTAGAG TGCCAGGGGTACCCAAAAAACGAGAACTGGAAGAGGTTGTTGTCTTCAAAGAGGAGGTGGAAGCCCATGAAGAATACATTGT

AGAGGAAGAAGAGGAATATGTCCATGAAGAGGAGTATGTCCACAAAGAAGAATATGTCCATGAAGAAGAGTACGTCCATAAAGAGGAATATATCCACGAA

GAGGAAGAACACCTTCATGAAGAGGAGGAGACCATAGCTGAGGAAGAGGTGGTGCCTGTGGCCCCAGTCAAAG TGCCTGTGGTACCCAAGAAACCTGTT

CCAGAAGAGAAAAAACCTGTTCCTGTTCCCAAAAAGAAGGAAGCACCACCAGCCAAAG TGCCTGAGATTCCCAAGAAGCCAGAGGAAAAAGTTCCTGTG

CCTATTCCTAAAAAGGAGAAGGCTCCACCTGCCAAAG TCCCGGAAGTGCCCAAGAAGCCTGTACCAGAGGAGAAGCCACCAGTACCTGTTCCCAAAAAG

GTGGAACCACCACCAGCCAAAG TGCCAGAAGTGCCGAAGAAACCTGTGCCTGAGAAGAAGGTACCAGCGCCTACTCCTAAGAAAGTAGAGGCTCCTCCT

GCAAAAG TGCCAGAGGTGCCCAAGAAACCCATTCCAGAAGAAAAGAAACCAACAGCTCTTCTGAAAAAAATGGAAGCCCCACCCCCGAAAG CGCCAAA

GAAACGGGAGGTAGTCCCAGTTCCTGTGGCTCTACCTCGGGAAGAAGAAGAAGAAGAAGTGCCATTTGAGGAAGTTCCTGAAGAGGAAATTCTACCTGAG

GAAGAAGTTCCATCTGAGGAGGAAGCTCCACCTGAAGAAGTTCCACCAGAGGAAGAGGAAGTTCTTCCTGAAGAAGAGGAAGTTCTTCCTGAAGAAGAGG

AAGTTCTTCCTGAGGAAGAGGAAGTTCAACCTGAGGAAGAAGCTCTTCCAGAGATTAAACCTAAGGTGCCAAAACCTGCACCAG TGCCTGAGATCAAGA

AGAAAGTGCCAGAGAAGAAAGTAGTTGTTCCCAAGAAAGAGGAGGCTCCTCCCACCAAAG TTCCTGAGGTGTCTAAGAAGGTGGAAGAAAGACGGATCA

TCCCCCCTAAAGAAGAGGAAGTTCCACCAGCTGAAG TATATGAGGAGGCTGAAGAACCCACTCCAGAAGAGATTCCAGAAGAGCCGCCTAGCATAGAAG

AAGAAGAGATAGTGGAGGAAGAGGAGGAGGAGGAGGAGGTGCTGCCACCTAGAG CACCTGAAGTGGTGAAGAAAGCAGTACCCGAAGCTCCCACTCCTG

TCCCTAAGAAAGCGGAGGCACCCCCCGCAAAAG TGCCAAAGAAAATCCCTGAGGAAAAGGTTCCCGTGCCGGTCCAGAAAAAAGAGGCCCCACCAGCCA

AAG TCCCAGAAAAGAAGAAAATCCCTGAAAAGAAAGTCCCTGTGCCCAAAAAGGAAGCTGTTCCACCGGCTAAAG GGAAAGCTGTTTTTGAAGAAAAA

ATATCAGTTGCCTACCAGCAAGAAGAACTAGTCCAAGAAAGAATAGAGCTAGAACTCGTGGAAGCCAAAGTGGAAGAGGCTTTCGAAGAAGAGGAGTTCC

ACGAGGTGCAGGAATACTTTGAGGAAGAGGAGTTCCACGAGGTGGAGGAGTTCATCAGGGTGGAAGAGCGCAGGTTCCAAGAAGAGCACAAAGTGGAAGA

AGTCCACAGGGTCATTGAGTTCCTAGAGGCTGAAGAAGTGGAAGTATACGAAAAGCCCAAAATTCCACCTAAAAAAG GACCTGAGGTATCTGAGAAAGT

CATCCCTCCAAAAAAGCCACCCACTAAAGTCATTCCTCGAAAAGAGCCACCAGCTAAAG TACCTGAGGTGACCAAGAAAACGGTGGTTGAAGAAAAAAT

CCGTGCTCCTGAAGAACCGAAGGTGCCGGCACCTAAAG CACCCGAAGTACCAAAGAAAATCACTCCAGAAGAAAAAGTCCGTGAAGCTGTTCCTAAAAA

GCCTGAAGTTCCACCACCTAAAG TGCCCGAGGCTCCCAGAGAAGTTGTGGCCAAAAAGAAAGTGCTCCCTCCCCAAGTGCCGGAAGTTGTACCTGTGAA

AG TGCCTGGGGCTCCTAAAGAGGTTGTCTCTGAAAGGAAATCGCTTGAGGAACCACCTAAAAAGCCAGCAGTCCGGCCAGTCACAG TGCCCGAGGAGC

CCAAAGAGGTCATCCCTGAAAAGAAAGTGTCCCTGGTGCCTCCTAAAAAGCCAGCAGCCCCACCTGTCACAG TGCCAGAGGCTCCCAAAGAAGTTGTTC

CTGAAAAGAAAGTCTCCGTGGTGCCTCCCAAAAAGCCAGAAGCCCCACCTGCCAAAG TGCCAGAGGCACCCAAGAAAGTTGTCCCTGAGAAGAAACTGC

CAGTAGCAGCTCCTAAAAAGCCTGAAGCCCCAGCTGCTGAAG TACCCGAGGTGCCAAAGACAGCTGTTCCCCAAAAGAAGATCCCTGAGGCCATTCCCC

CCAAACCGGAAAGTCCTCCCCTTGAAG AGACTGTCCCAGAAAAGACAAGACCGATGGCTCCTCCTAAAAAGCCAGAAGCCACAACTCTCCCAG TGCCT

GAAGTCCAAGAGACTGTCCCTGAAAAGACAAGACCAGTGGGACCTCCTAAGAAGCCAGAAGCCACAACTGTCCCAG TACCTGAAGTCCAAGAAACTATC

CCTGAAAAGACAAGACCAGCGGCCCCTCCTAAAAAGCCAGAAGCCACAGCTGTCCCAG AAACTATCCCTGAAAAGACAAGACCAGAGGCCCCTCCTAAA

AGGCCAGAAGCCACAACTGTCCCAG TGCCTGAAGCTGATCAAGCAGTTGTCCCAGAAAAGAAAGTCCCCAGGGTCCCGCCCAAAAAAGTTGAAGCCCCA

CCTATTACAG TGCCTGAGGAACCTAAAGAGGTCATCCCTGAAAAGAAAGTGTCCCTGGTGCCTCCTAAAAAGCCAGCAGCCCCACCTGTCACAG TGCC

TGAGGCACCTGAAGAGGTCTTCTCTGAAGACGAAGAGACCCTGGCACCCCCTCAAGAGCCAGAGGCCCCACCTGCCAAAG TGCCAGAGGCTCCCAAAGA

AGTTGTTCCTGAAAAGAAAGTCTCCGTGGTGCCTCCCAAAAAGCCAGAAGCCCCACCTGCCAAAG TGCCAGAGGCACCCAAGGAAGCTGCCCCTGAGAA

GAAAGTGCCAGTGGCACCTAAGAAAAAGCCAGAAGCCCCACCCGTGAAAG TGCCAGAGGCACCCAAGAAAGTTGTCCCTGAGAAGAAACTGCCAGTAGC

AGCTCCTAAAAAGCCTGAAGCCCCAGCTGCTGAAG TACCCGAGGTGCCAAAGGCAGCTGTTCCCCAAAAGAAGATCCCTGAGGCCATTCCTCCCAAACC

AGAGAGTCCTCCCCCTGAAG TGTATGAGGAACCTGAAGAGGAGATTGTCCCAGAAGAGCCTCCAGAGGAGGCTGTGGAAGAACCAGTGCCAGCTCCCCC

TCCAAAAG TGACAGAGCCACCTAAGAAGCCTGTCCCTGAGAAGAAAGCGCCTCCTGCTGTTGTCAAGAAACCTGAACCCCCACCAGCGAAAG TGCCTG

AAGTGCCTAAGGAAGCTCCCCCTGAAAAGAAAGTGCCTCCCAAAAAGCCAGAAGCCCCACCTGCTAAAG TGCCAGAAGTTCCGAAAGAAGTTGTCACAG

AAAAGAAAGTGGCTGTTCCCAAAAAGCCAGAAGTCCCGCCAGCCAAAG TGCCAGAGGTGCCAAAGAAACCTGTCATTGAAGAGAAGCCAGCCATTCCTG

TTGTTGAGAAAGTGGCGTCCCCTCCTGCTGAAG TATATGAAGAACCGGAAGAAGTCACTGCTGAGGAAGAGGAGCCAGCCCCTGCTGTAGAAGAGGAGG

AATACGAAGCTCCCCCTCCCCCTGCACCAG TGCCTGAAGAGCCTAAGAAGGTTGTCCCAGAGAAGAAATTTCCTGTCATCAAAAAACCAGAGGCTCCCC

CTCCTAAAG AACCTGAGCCAGAGAAGAAGGTTATCGAGAAACCAAAACTCAAACCAAGACCCCCTGCACGTCCTCCTTCTCCACCTAAGGAAGATGTGA

AGGAGAAAATGTTCCAACTTAAAG - UNI36362 - CTGTTTCAAAGAAGAAAGTTCCTGAAAAACCCGAGGTTGTGGAAAAAGTGGAGCCTGCACCA

CTAAAAG - UNI36362 - TGCCTACAGCTGAAAAGAAAGTTCGTAAATTACTTCCTGAACCTAAGCCGCAGCCAAAGGAAGAGGTGGTGCTGAAAAG

CG - UNI36362 - TTCTAAGAAAGAAACCCGAGGAAGAAGAACCTAAAGTAGAACCTAAAAAAGTAGAAAAAGCTAAAAAACCGGAAG AGCCACAG

CCACCTCCAAAAGCCGTTGAAGTTGAAGCTCCTCCAGAGCCTACACCAAAGGAAAGGAAAGTTCCAGAACCGGCCAAAG - UNI17655 - TTCCTGA

AATTAAGCCAGCGATACCTCTCCCTGGACCTGAACCAAAGCCAAAGCCTGAGCCAG - UNI17655 - AGGTGAAAACCATGAAAGCTCCACCCATCG

AGCCGGCACCCACTCCCATCGCTGCCCCCGTGACAGCGCCTGTGGTTGGGAAGAAAGCAG AAGCCAAACCTAAGGATGAGGCTGCCAAGCCAAAAGGTC

CCATCAAAG GTGTAGCCAAAAAGACTCCTTCACCAATAGAAGCTGAAAGGAAAAAGCTCAGACCAGGAAGCGGTGGAGAGAAACCTCCAGACGAAGCTC

CGTTCACTTACCAACTCAAGGCCGTGCCACTGAAATTCGTGAAAGAAATCAAAGACATCGTTTTGACAGAGGCAGAGTCTGTGGGCTCTTCTGCCATCTT

CGAATGTTTGGTCTCCCCATCCACTGCCATTACAACCTGGATGAAGGACGGCAGCAACATCCGTGAGAGCCCAAAGCACAGATTCATTGCAGACGGCAAA

GACAGGAAGCTGCACATTATCGACGTTCAGCTGTCTGATGCTGGTGAATACACCTGTGTGCTACGCTTGGGAAATAAAGAGAAGACGTCCACTGCTAAGC

TCATCGTAGAAG AACTTCCTGTGCGCTTTGTGAAAACACTGGAGGAGGAAGTCACGGTGGTCAAGGGGCAGCCGTTGTACTTGAGCTGTGAGTTGAACA

AAGAACGCGATGTGGTCTGGAGGAAGGATGGTAAGATTGTGGTGGAGAAACCTGGCAGGATCGTGCCTGGTGTCATTGGCCTGATGCGGGCCCTGACCAT

CAATGATGCTGATGACACTGATGCCGGAACATACACTGTGACTGTGGAAAATGCCAACAACCTGGAATGTTCTTCTTGTGTAAAAGTAGTAG AAATCAT

TAGAGAATGGCTTGTGAAACCTATCCGAGATCAGCATGTGAAGCCCAAGGGAACAGCTGTTTTCACCTGTGACATAGCCAAGGACACGCCAAACATTAAG

TGGTTCAAAGGCTATGACGAGATCCCCTTGGAACCAAACGACAAGACTGAGATACTGAAAGAGGGAAACCACCTCTTTCTCAAGGTTAAGAATGCTATGC

CAGAAGATATTGATGAGTATGCAGTGGAAATTGAAGGGAAAAGATACCCAGCAAAGCTGACACTTGGAG AGCGCGAAGTTGAGCTACTTAAGCCGATAG

AAGATGTCACCATTTATGAGAAGGAAAGTGCCAGCTTTGATGCAGAAATCTCAGAGGAAGACATTCCTGGGGAGTGGAAGCTGAAGGGCGAGCTTCTGCG

GCCCTCGCCT ACTTGTGAAATCAAAGCTGAAGGTGGGAAGCGCTTCTTAACTTTGCACAAAGTGAAACTGGACCAAGCTGGCGAAGTCCTCTACCAGGC

TTGCAATGCGATCACAACTGCCATTCTGACAGTCAAAG AAATCGAGCTTGACTTTGCTGTACCCCTGAAGGATGTGACTGTCCCAGAGAAGAGACAGGC

TCGGTTTGAATGTGTCCTCACCAGAGAGGCAAATGTCATATGGTCTAAAGGGCCTGATATAATCAAGGCATCTGACAAATTTGATATTATTGCTGATGGA

AAGAAACACATTCTTGTTATCAACGACTCTCAGTTTGACGATGAAGGAGTCTATACTGCAGAGGTGGAGGGCAAGAAGACGTCAGCACAATTATTTGTGA

CAG GCATAAGACTTAAGTTCATATCACCACTGGAAGATCAAACAGTAAAAGAAGGCCAAACAGCAACTTTTGTCTGTGAGCTCTCTCATGAAAAAATGC

ACGTGGTCTGGTTCAAAAACGATGTCAAGCTACACACAACCAGGACAGTGCTCATGTCTTCTGAGGGAAAGACTTATAAGCTGGAGATAAGGGAGACCAC

ACTGGATGATATCTCACAGATCAAAGCTCAAGTGAAGAACCTCAGCTCTACAGCCAACCTGAAGGTCTTGG AGGCCGATCCCTACTTCACCGTGAAATT

ACACGACAAGACTGGCGTGGAGAAGGACGAGATCATTCTTAAGTGTGAAGTGAGCAAAGATGTTCCGGTCAAATGGTTCAAAGACGGGGAAGAGATTGTG

CCTTCGCCCAAACATTCTGTCAAGACCGACGGCCTGCGCCGCATCTTAAAGATCAAGAAGGCAGAGCTCAAAGACAAAGGGGAATATGTGTGCGACTGCG

GTACAGACACCACCAAGGCCAACGTCACTGTTGAGG CTCGACTCATAAAAGTGGAGAAACCCCTGTACGGCGTGGAAGTGTTTGTGGGTGAAACCGCCC

GCTTTGAAATTGAACTGTCTGAACCTGACGTGCATGGCCAGTGGAAGTTAAAGGGAGAGCCTTTGACTGCTTCTCCT GACTGCGAAATCATCGAAGATG

GGAAGAAACATGTCTTGGTTCTGTATAACTGTCAGCTGGATATGACCGGGGAGATATCCTTCCAGGCCGCCAACGCTAAATCAGCAGCCAACCTGAAAGT

GAAAG AACTGCCGCTCATTTTCATCACCCCTCTGAGTGACGTCAAAGTCTTTGAGAAAGATGAGGCGAAGTTTGAGTGTGAAGTATCCAGGGAGCCCAA

AACATTCCGCTGGCTGAAAGGAACCCAGGAAATCACTGGTGATGACAGATTTGAGCTCATCAAGGATGGCACCAGGCATTCATTGGTGATCAAGTCAGCA

GCTTTTGAAGATGAGGCCAAATACATGTTTGAAGCTGAAGATAAACGCACAAGCGGCAAACTGATCATTGAAG - UNI35827 - GAATCCGTCTCAA

ATTCCTGACCCCACTCAAGGATGTGACAGCCAAAGAAAGGGAAAATGCCGTGTTTACTGTGGAGCTGTCCCATGACAACATCCCAGTGAGCTGGTTCAAG

AACGACCAGCGCCTGCACACCAGCAAGCGGGTCTCCATGCATGATGAAGGGAAAACACACTCCATCACGTTCAAAGACCTGTCTATTGACGACACCTCCC

AAATTAGAGTGGAGGCCATGGGGATAAGTTCAGAGGCTAAGCTCACTGTGCTGG - UNI35827 - - UNI35899 - AGGGAGACCCATACTTCAC

AGGAAAGCTTCAAGATTACACAGGCGTGGAGAAGGATGAAGTGATTCTTCAGTGTGAAATCAGCAAAGCAGACGCACCCGTGAAATGGTTTAAGGACGGG

AAGGAAATTAAGCCGTCTAAAAACGTTGTTATCAAGGCTGACGGCAAGAAACGCATGCTGATCCTGAAGAAGGCCTTGAAATCAGATATCGGCCAATATA

CCTGTGACTGTGGGACAGACCAGACCTCTGGGAAGCTGGACATTGAAG - UNI32138 - - UNI35827 - - UNI35899 - ATCGGGAAATTA

AACTGGTGCGACCCCTGTACAGCGTGGAGGTGATGGAGACCGAGACGGCCCGCTTTGAAACTGAGATCTCTGAAGATGATATACATGCCAACTGGAAACT

GAAGGGAGAGGCACTGCTCCAAACACCT - UNI32138 - - UNI33036 - - UNI35899 - GAATGTGAAATTAAAGAAGAAGGCAAGATCCA

CGTCCTTATCTTACACAACTGCCGCCTAGACCAGACTGGAGGTGTAGATTTCCAAGCTGCCAATGTCAAATCTAGTGCCCACCTCCGAGTTAAAC - UN

I32138 - - UNI32541 - - UNI33036 - CACGGGTAATTGGTCTGCTGAGGCCTCTAAAGGATGTTACAGTGACCGCAGGGGAAACGGCCACC

TTTGACTGCGAGCTCTCCTATGAGGATATCCCAGTGGAATGGTACCTCAAAGGGAAGAAGCTGGAGCCTAACGATAAG - UNI14991 - - UNI166

43 - - UNI32541 - - UNI33036 - GTGGTGACACGTTCAGAAGGAAGAGTTCACACGCTCACCCTGAGGGATGTGAAGCTAGAAGATGCTGGC

GAAGTCCAACTAACTGCAAAGGATTTCAAAACTCAGGCCAATCTCTTTGTGAAAG - UNI14991 - - UNI16643 - - UNI32541 - AACCC

CCGGTTGAGTTCACTAAGCCTCTTGAGGACCAGACGGTCGAAGAGGAGGCCACTGCAGTACTGGAGTGTGAAGTATCCAGAGAAAATGCCAAAGTGAAAT

GGTTCAAAAATGGGACAGAAATCCTCAAAAGCAAGAAGTATGAAATCGTTGCTGATGGCAGGGTCAGGAAGCTCATTATTCATGGTTGTACCCCAGAGGA

TATCAAAACGTACACTTGTGATGCTAAAGATTTTAAGACCTCCTGTAACCTGAATGTTGTTC - UNI14991 - CTCCTCATGTGGAATTCTTAAGAC

CACTCACAGACCTCCAAGTC
Translation
MPVYPPAIVTPLQDTVTSEGRPARFQCQVSGTD DLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYAFVANNAVGQVSSTATLRLEA A

PESILHERIGQQIEMEMKA AAPVIKRRIEPLEVALGHLAKFTCEIQGAPNVRFQWFKAGREIYESDKCSIRSSNYVSSLEILRTQVVDCGEYTCKASNE

YGSVSCTATLTVTE EAYPPTFLSRPKALTTFVGKAAKFLCTVSGTPVIEIIWQKDGAALSPSPDCRVTDADNKHSLELSNLTVQDRGIYSCKASNKFGA

DICQAELTIIDKPHFIKELEAVQSAINKKIHLECQVDEDRKVTITWSKDGQKLPAGKDYKIYFEDKIASLEIPLAKLKDSGTYTCTASNEAGSSSSSAAV

AVRE EPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMSFVNSEAILDITDVKVDDSGTYSCEATNDVGSDSCSTEVVIKE

 EPPSFIKTLEPADIVRGANALLQCEIAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHLLKE EPPT

FVKKVDDFTALAGQTVTLQAAVRGSEPISVMWMKGQEVIKEDGKIKMSFSNGVAVLTIPDVQISLGGKYTCLAENEAGSQTSVGELIVKE EPAKIIERA

ELIQVTAGDPATLEYTVSGTPELKPKWYKDGRPLVASKKYRISFKNNIAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLD DRDIAPLFTKPLRN

VDSVVGGACRLDCKIAGSLPMRVSWFKDGKELTASDRYQIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSKDSSGALIVQE EPPSFVTKPGSRDVLP

GSAVCLKSAFQGSAPLTIKWFKGDKELVSGGSCYITKETSESSLELYAVKTSDSGTYTCKVSNVAGSVECSADLFVKE EPATFIEKLEPSQLLKKGDGT

QLACKVTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCTGIVIVKE ESPYFTKEFKSIEVLKEYDVMLLAE

VAGTPPFEITWFKDNTTLRSGRKYKTFLQDQLVSLQVLKFVAADAGEYQCRVTNEVGSSTCSARVTLRE EPPSFIKKIEATSSLRGGTAAFQATLKGSL

PITVTWLKDNDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKE EPATIMEEAVSIDVTQGDPATLQVKFSGTKEISAK

WFKDGQELTLGPKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKASINVLD DLIIPPSFTKKLRKMDSIKGSFIDLECIVAGSHPISIQWF

KDDQEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHSQCSGHLTVKE EPPYFVEKPQSQDVNPGTRVQLKALVGGTAPMTIKWFKDNKE

LHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKATIFVKE EPPQFIKKPSPVLVLRNGQSTTFECQVTGTPEIRVSWYLDGNEITDL

RKYGISFVDGLATFQISNARVENSGTYVCEARNDAGTASCSIELKVKE EPPIFIRELEPVEVVKDSDVELECEVMGTTPFEVTWLKNNKEIRSGKKYTM

SEKMSVFYLHITKCDPSDVGEYQCIIANEGGSCACSARVALKE EPPSFIKKIENVTTVLKSSATFQSTVAGSPPISITWLKDDQILEENDNVHISFEDS

VATLQVRSVDNGHSGRYTCQAKNESGIERCYAFLLVQE EPAQIIEKAKSVDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFR

IQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLD DQDIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHENTVSLEVS

NLELEDTANYTCKVSNVAGDNACSGILTVKE EPPSFLVKPERQQAIPDSTVEFKAVLKGTPPFKIKWLKDDVELVSGPKCFIGLEGSTSFLNLYSVDSS

KTGQYTCQVTNDVGSDSCTTMLLVTE EPPKFVKKLEASKIIKAGDSARLECKITGSPEIQVVWYRNEHELTASDKYQMTFIDSVAVIQMNSLGTEDSGD

FICEAQNPAGSTSCSTKVIVKE EPPVFSSFPPIVETLKNTEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVESTDIGEYHCKA

QNEVGSDACVCAVKLKE EPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKNDG

GVRENMATLTVLE EPAVIIEKAGSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLKILSVEKEDAGTYTFQVQNNVGKSSC

TAVVDVSD DRMVPPSFTRRLKDTGGVLGTSCILECKVAGSSPISIAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGSYTCVAANVAGSDECRA

LLTVQE EPPSFVKEPEPLEVLPGKNITFTSVIRGTPPFKVGWFRGARELVKGNRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVK

E EPATFVKKLSDHSVEPGKSIILEGTYTGTLPISVTWKKDGVSITPSERCNIVTTEKTCILEILSSTKGDAGHYSCEIENEAGRDACDALVSTLE EPP

YFVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTIFRIQE ERQLPPSF

ARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSTARLTARE EPKKSPFFDI

KPVSIDVIAGESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKE EPPKFIKKLDAS

KVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVGDASCSTALKVKA APPVFTQKPPPVGALK

GSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKE EPPRFVKKLSDASTLIGDPVE

LQAVVEGFQPISVVWLKDKGEVIRESENVRISFVDNIATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTVLE EPATIVEKPEPMTVTTGNPFTLECV

VAGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSVHVSD DRVVPPSFVRRLKDTSATLGASVVLECRVS

GSAPISVGWFLDGNEIISSPKCQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAVLTVQE EPPSFEQTPDSVEVLPGMSLTFTSVIRGTPPF

KVKWFKGSRELVSGEACTISLEDFVTELELLEVEPGQSGDYSCLVTNDAGSASCTTHLFVKE EPATFVKRLADTSVETGSPIVLEATYSGTPPISVSWM

KNEYPLSQSPNCGITTTEKSSILEILESTIEDYAQYACLIENEAGQDICEALVSVLE EPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIRISWYKEHTK

LRSAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSAVLVIKE ERKLPPSFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGELLK

DDANLQMSFVHHVATLQILQTDQSHVGQYNCSASNPLGTASSSAKLILSE EHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPIKITWAKDNREIRPG

GNYKMTLVENTATLTVLKVAKGDAGQYTCYASNVAGKDSCSAQLGVQE EPPRFIKKLDQSRIVKQDEYTRYECKIGGSPEIKVLWYKDEVEIQESSKFR

MSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSSTSLKVKE EPPVFRKKPFPVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSEN

LLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKA APPQFVKKLTDISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISYSENIAT

LQFSRAEPANAGKYTCQIKNDAGMQECYATLSVLE EPAAIVEKPESIKVTTGDTCTLECTVSGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIIN

VVPGDSGVYSFEVQNPVGKDSCKVSIQVSD DRIIPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVLWFHDGNEISSGRKYQTTLTDNTCALTVNMLE

EADAGDYTCIATNVAGSDECSAPLTVRE EPPSFVQKPDPMDVLTGSNVTFTSIVKGSPPFTVSWFKGSTELVPGARCNVSLQDSVGELELFDVDTSQSG

EYTCIVSNEAGRASCTTRLFVKA APAIFVKRLNDYSIEKGKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCY

IENASGKDSCSAQILILE EPPYFVKQLEPVKVTVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSV

GEVSSSTFLTVQE EQKLPPSFSRQLRDVQETVGLPVVFECAVSGSEPISVSWYKDGKPLKDSPNIQTSFLDNIATLNIFKTDRSLSGQYSCTATNPIGS

ASSGAKLILTE EGKNPPFFDIPLAPMDAVVGESADLECHVTGTQPIKVTWAKDNREIRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCYAVNEVGKDS

CTAQLNIKE ERLIPPSFTKKLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNVEIHPTSNCEIMFKNNALLLQVKRASMADAGLYTCKATNDAGSALC

TSSIVIKE EPKKPPVFDQHLAPVTASEGDSVQLSCHVQGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAGSDTSKC

KVTIKE EKPAAAPAAKKAAVDGKLFFVSEPQSIRVVEK KTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRC

VAFNKHGEIESNVNLQVDERKKQEKIEGDLRAMLKK KTPALKKGSGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRL 

EIEELEKSERDEKEFEELVAFIQQRLTQTE PVTLIKDIENQTVLKDNDAIFEIDIKINYPEIKLSWYKGTEKLEPSNKYEISIDGDRHTLRVKNCQPKD

QGNYRLVCGPHIASAKLTVIE EPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDL

ETSAELRIEA AEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEG GVYSVIARLEPRGEARS

TAELYLTTKE EIKLEMKPPD DIPDSRVPIPTMPIRAVPPEE EIPPAVAPSIPLLLPLPEEKKPPAKRIEV VTKKGVKKDTKKVVTKPKEEAPPPPV

 VAKKPPPPTPMIPAKA ASEIIDVSSKAEEVKITTITRKKEVHKEKEAVYEREEAVYEKKVHIEPWEEPYEELETEPYTEPYEEPYYEEPDEDYEEIKV

EAKKQVHEEWEEDFEEGQEYYEREEGYDEGEEEWEEIYHEREIIQVQKEVHEE ELHEKKIPAKVPEKKVPPPKV VVKKPVVEKVEKTTRRMEEEKVQV

IKV VPEVSKKIVPQKPSRTPVQEEIIEVKV VPAVHTKKMVISEEKMFFASHTEEEVSVSV VPEVQKKTVTEEKIHVAVSKKIEPPPKV VPEPPKKP

VPEEVVPVPIPKKVEPPAAKV VPEAPKKPVPEEKKPVPIPKKKEPAAPPQV VPEAPKKPAPEEKIPVPVTKKKEAPPAKV VPEVQKKVVTEEKIAII

TQREESPPPAV VPEIPKKKVPEEKRPVPRKEEVPPPKV VPVPPKKAVPEAVVPAPIPKKAPPRA AEVSKKTVVEEKRFAAEEKLSVAVPQRVELMRH

EE EEEWTYSEEEERVSVSVYREEERDEEEAEITEYEV VLEEPEEYVVEEKMHFISKKVEVEPAKV VPEKKIIPKPKVPAKIEEPPPTKV VPEPPKK

IVPEKKVPAPAPKKVPPAKA APEESKRPVPEKRAPAEEVGIEEPPPTKV VAERHMKITQEEKVLVAVTKKEAPPRARV VPEEPKKVAPEERFPKLKP

RREEEPPAKV VTEVRKRAVKEEKVSIEVPKREPRPTKE EVTVTEEKKWSYTREEETVSEHREEEYEDYEDYEEYKEFEEYEPTEEYDQYDEYAEREVE

HYEEHEEYVTE EPKKPVPVKPAQEPVPAKPKAPPPKV VLKKAVPEEKAPLPIQKKLKPLPPKA APEEPKKVVEEKIQISITKREKQQVTEPVAKV V

PMKPKRVVPEAKIPAPTKEVAVPVRV VPGVPKKRELEEVVVFKEEVEAHEEYIVEEEEEYVHEEEYVHKEEYVHEEEYVHKEEYIHEEEEHLHEEEETI

AEEEVVPVAPVKV VPVVPKKPVPEEKKPVPVPKKKEAPPAKV VPEIPKKPEEKVPVPIPKKEKAPPAKV VPEVPKKPVPEEKPPVPVPKKVEPPPAK

V VPEVPKKPVPEKKVPAPTPKKVEAPPAKV VPEVPKKPIPEEKKPTALLKKMEAPPPKA APKKREVVPVPVALPREEEEEEVPFEEVPEEEILPEEE

VPSEEEAPPEEVPPEEEEVLPEEEEVLPEEEEVLPEEEEVQPEEEALPEIKPKVPKPAPV VPEIKKKVPEKKVVVPKKEEAPPTKV VPEVSKKVEERR

IIPPKEEEVPPAEV VYEEAEEPTPEEIPEEPPSIEEEEIVEEEEEEEEVLPPRA APEVVKKAVPEAPTPVPKKAEAPPAKV VPKKIPEEKVPVPVQK

KEAPPAKV VPEKKKIPEKKVPVPKKEAVPPAKG GKAVFEEKISVAYQQEELVQERIELELVEAKVEEAFEEEEFHEVQEYFEEEEFHEVEEFIRVEER

RFQEEHKVEEVHRVIEFLEAEEVEVYEKPKIPPKKG GPEVSEKVIPPKKPPTKVIPRKEPPAKV VPEVTKKTVVEEKIRAPEEPKVPAPKA APEVPK

KITPEEKVREAVPKKPEVPPPKV VPEAPREVVAKKKVLPPQVPEVVPVKV VPGAPKEVVSERKSLEEPPKKPAVRPVTV VPEEPKEVIPEKKVSLVP

PKKPAAPPVTV VPEAPKEVVPEKKVSVVPPKKPEAPPAKV VPEAPKKVVPEKKLPVAAPKKPEAPAAEV VPEVPKTAVPQKKIPEAIPPKPESPPLE

E ETVPEKTRPMAPPKKPEATTLPV VPEVQETVPEKTRPVGPPKKPEATTVPV VPEVQETIPEKTRPAAPPKKPEATAVPE ETIPEKTRPEAPPKRP

EATTVPV VPEADQAVVPEKKVPRVPPKKVEAPPITV VPEEPKEVIPEKKVSLVPPKKPAAPPVTV VPEAPEEVFSEDEETLAPPQEPEAPPAKV VP

EAPKEVVPEKKVSVVPPKKPEAPPAKV VPEAPKEAAPEKKVPVAPKKKPEAPPVKV VPEAPKKVVPEKKLPVAAPKKPEAPAAEV VPEVPKAAVPQK

KIPEAIPPKPESPPPEV VYEEPEEEIVPEEPPEEAVEEPVPAPPPKV VTEPPKKPVPEKKAPPAVVKKPEPPPAKV VPEVPKEAPPEKKVPPKKPEA

PPAKV VPEVPKEVVTEKKVAVPKKPEVPPAKV VPEVPKKPVIEEKPAIPVVEKVASPPAEV VYEEPEEVTAEEEEPAPAVEEEEYEAPPPPAPV VP

EEPKKVVPEKKFPVIKKPEAPPPKE EPEPEKKVIEKPKLKPRPPARPPSPPKEDVKEKMFQLKA - UNI36362 - AVSKKKVPEKPEVVEKVEPAP

LKV - UNI36362 - VPTAEKKVRKLLPEPKPQPKEEVVLKSV - UNI36362 - VLRKKPEEEEPKVEPKKVEKAKKPEE EPQPPPKAVEVEAP

PEPTPKERKVPEPAKV - UNI17655 - VPEIKPAIPLPGPEPKPKPEPE - UNI17655 - EVKTMKAPPIEPAPTPIAAPVTAPVVGKKAE EA

KPKDEAAKPKGPIKG GVAKKTPSPIEAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTEAESVGSSAIFECLVSPSTAITTWMKDGSNI

RESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLIVEE ELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKIVVEKPG

RIVPGVIGLMRALTINDAD          - UNI35827 -  - UNI35827 - - UNI35899 -  - UNI32138 - - UNI35827 - - UN

I35899 -  - UNI32138 - - UNI33036 - - UNI35899 -  - UNI32138 - - UNI32541 - - UNI33036 -  - UNI14991

 - - UNI16643 - - UNI32541 - - UNI33036 -  - UNI14991 - - UNI16643 - - UNI32541 -  - UNI14991 - 
Transcript ENSMUST00000111843
Sequence
TTGCAATGCCAAGTTGCTGGGACACCAGAAATTACAGTGTCTTGGTTCAAAGGAGACACCAAATTAAGGTCAACTCCGGAATACAGGACCTACTTTACAA

ACAACGTGGCCACACTTGTGTTTAATAAAGTGAGCATCAATGACAGCGGGGAGTACACGTGCATGGCGGAGAATAGCATAGGAACAGCAGCCTCTAAGAC

CATCTTCAGAATCCAAG AGCGCCAGCTCCCGCCTTCCTTTGCAAGACAGTTAAAGGACATTGAGCAAACTGTTGGATTACCAGTTACCCTCACTTGTCG

ACTAAATGGCTCTGCACCCATCCAAGTGTGCTGGTATAGAGATGGGGTGCTTTTAAGAGATGATGAAAATCTACAGATGTCATTTGTGGATAATGTGGCA

ACATTAAAAATTTTGCAAACTGACCTGAGTCACTCTGGCCAGTATTCTTGCTCAGCTTCCAATCCACTTGGCACAGCATCTTCTACTGCTAGACTAACAG

CAAGAG AACCTAAGAAATCACCCTTCTTTGATATCAAGCCAGTATCAATAGATGTTATCGCTGGAGAAAGTGCAGATTTTGAGTGTCATGTGACTGGTG

CTCAGCCAATGAGAGTCACTTGGTCAAAAGATAACAAGGAAATCCGACCTGGAGGAAACTATACTATCACGTGTGTGGGTAACACTCCCCATCTGAGGAT

TCTTAAAGTGGGCAAAGGAGACTCTGGCCAATACACGTGTCAAGCCACCAATGACGTTGGCAAGGACATGTGCTCTGCTCAGCTCAGTGTGAAAG AACC

TCCTAAGTTTATTAAGAAATTAGATGCTTCAAAAGTTGCGAAGCAGGGAGAATCCATCCAACTGGAATGTAAGATAAGTGGCTCCCCAGAGATCAAAGTT

GTGTGGTTCCGGAATGACAGCGAACTTCACGAAAGCTGGAAATACAACATGTCCTTCGTGAATTCTGTGGCCCTGCTAACCATCAATGAAGCCAGTGCTG

AGGACACTGGGGACTACATCTGTGAAGCCCACAATGGCGTTGGTGATGCCAGCTGCAGCACAGCCCTGAAAGTTAAAG CACCTCCTGTCTTTACCCAGA

AGCCTCCTCCAGTTGGAGCCCTGAAAGGTTCTGATGTGATCCTGCAGTGTGAAATTTCAGGAACACCCCCCTTTGAGGTGGTGTGGGTTAAAGATCGGAA

GCAAGTGCGAAGCAGCAAGAAATTTAAAATCACCTCCAAAAATTTTGACACGAGTCTTCATATCTTTAATCTGGAAGCCCCTGACATAGGGGAATATCAC

TGCAAAGCCACGAATGAGGTGGGAAGTGACACGTGCGCTTGCACGGTCAAGTTCAAAG AACCACCACGATTTGTGAAAAAACTCAGTGATGCGTCCACC

CTTATTGGGGATCCCGTGGAGTTACAAGCCGTGGTAGAAGGTTTCCAGCCGATTTCCGTTGTCTGGCTGAAAGATAAAGGTGAAGTCATCAGAGAGAGCG

AAAACGTTAGGATTTCCTTTGTTGATAACATCGCAACTCTCCAACTGGGAAGTCCAGAAGCATCACAGTCTGGAAAATATGTGTGCCAAATCAAAAACGA

TGCCGGGATGCGAGAGTGTTCAGCAGTCCTGACTGTCCTAG AACCAGCCACAATTGTAGAGAAACCAGAACCCATGACTGTCACAACTGGAAACCCCTT

CACATTGGAGTGTGTAGTAGCTGGGACTCCAGAACTTTCAGCCAAGTGGTTCAAAGATGGTAGAGAACTATCTTCAGGCAGCAGACATCACATTACATTT

GTCAGAAACCTGGCTTCCCTTAAGATCCCTTCTGCAGAAATGAATGACAAGGGCTTATATACCTTCGAGGTGGAAAACAGAGTTGGCAAAAGCAGCTGCA

CTGTGTCTGTCCATGTCTCAG ACCGAGTTGTTCCACCGTCCTTCGTCCGAAGGCTTAAGGACACAAGTGCCACGCTCGGAGCTTCTGTGGTTTTGGAGT

GTCGAGTGTCGGGCTCAGCCCCCATATCAGTCGGCTGGTTTCTTGATGGAAATGAGATCATTAGCAGTCCCAAATGCCAGTCCAGCTTTGCAGATAACGT

CTGCACTCTGACTCTGAGCTCCCTGGAGCCCTCTGACACTGGCGCATACACCTGTGTGGCTGCCAATGTAGCCGGCCAGGATGAAAGCTCTGCAGTTCTG

ACTGTCCAAG AACCACCATCTTTTGAACAAACCCCTGACTCTGTGGAAGTTTTGCCTGGAATGAGCCTGACATTCACCAGTGTCATTAGAGGCACCCCT

CCCTTCAAGGTCAAGTGGTTTAAGGGCAGCAGGGAGCTGGTGTCCGGGGAGGCTTGTACCATTTCTTTAGAAGACTTTGTCACTGAGTTGGAGCTCCTGG

AGGTGGAGCCGGGGCAGAGTGGAGATTATTCTTGCCTGGTGACCAATGATGCCGGCAGTGCTTCCTGTACCACGCATCTCTTTGTGAAAG AACCAGCCA

CTTTTGTGAAAAGGTTGGCTGATACCAGTGTGGAGACAGGTAGCCCCATCGTTCTGGAGGCTACTTACTCTGGCACACCACCTATCTCTGTGAGCTGGAT

GAAGAACGAATATCCTCTTTCACAGTCTCCCAACTGTGGCATCACCACAACAGAAAAATCTAGCATCCTGGAAATTCTTGAGAGCACAATAGAGGATTAT

GCACAGTACGCTTGCCTGATAGAAAATGAAGCCGGACAGGATATCTGCGAAGCTCTTGTGTCCGTCTTGG AACCACCTTACTTTATCGAACCCCTGGAA

CATGTGGAAGCAGCTATTGGAGAGCCCATAACTTTACAGTGTAAAGTGGATGGAACCCCTGAGATCAGGATTTCTTGGTATAAGGAACATACAAAGCTAC

GGTCAGCTCCTGCATATAAGATGCAATTCAAAAACAACGTGGCCTCCTTAGTCATCAACAAGGTGGACCACAGTGATGTGGGAGAGTACACCTGCAAGGC

AGAAAACAGCGTGGGGGCTGTTGCTTCTTCTGCCGTGCTGGTTATCAAAG AGCGTAAACTTCCACCTTCCTTTGCGAGAAAGCTGAAAGATGTCCACGA

GACTCTTGGCTTCCCAGTTGCTTTTGAATGTCGAATCAATGGCTCAGAACCTCTTCAGGTGTCTTGGTACAAGGATGGTGAACTTTTGAAAGACGATGCT

AATTTGCAGATGTCTTTTGTTCATCATGTTGCCACTCTTCAGATTTTGCAAACTGACCAGAGCCACGTTGGTCAGTATAACTGTTCAGCTTCTAATCCGC

TTGGGACTGCTTCGTCCAGTGCTAAGCTCATTCTCTCAG AACATGAAGTGCCTCCCTTCTTTGACTTAAAGCCTGTGTCAGTAGACCTTGCTCTTGGTG

AAAGTGGTTCTTTTAAATGTCATGTCACTGGAACAGCACCGATCAAAATCACCTGGGCTAAAGATAACCGTGAGATTCGCCCTGGAGGCAACTACAAGAT

GACTCTGGTGGAAAATACTGCCACTCTGACGGTGCTCAAAGTAGCCAAAGGTGATGCTGGACAGTATACCTGCTACGCGAGCAACGTGGCTGGAAAGGAC

TCTTGTTCTGCTCAACTTGGTGTACAAG AACCCCCCAGGTTCATTAAAAAGCTAGACCAATCACGGATCGTGAAGCAGGATGAGTATACAAGATACGAG

TGCAAAATAGGCGGGTCTCCAGAAATCAAGGTTTTGTGGTATAAGGATGAGGTGGAGATTCAAGAAAGCAGTAAATTCCGGATGTCATTCGAGGACTCGG

TGGCCATCCTGGAGATGCACAGTCTCAGTGTGGAAGACAGCGGGGACTACACCTGTGAGGCTCGCAACGCAGCAGGGAGCGCCAGCAGCAGCACCTCCCT

GAAGGTTAAAG AACCACCCGTGTTCCGCAAAAAGCCTTTTCCGGTTGAGACACTTAAAGGAGCCGATGTTCACCTTGAGTGTGAGCTTCAGGGGACACC

TCCCTTTCAAGTTTCTTGGCACAAAGACAAGCGAGAACTTAGGAGTGGGAAGAAGTACAAGATTATGTCTGAGAATTTGCTCACGAGCATCCACATCCTG

AACGTAGACACGGCAGACATTGGGGAATACCAGTGCAAAGCCACAAACGATGTTGGGAGTGATACCTGTGTGGGCTCTGTCACTATGAAAG CACCACCA

CAATTTGTGAAGAAGCTCACCGACATTTCTACCATCATTGGCAAAGAAGTCCAGCTGCAGACAACAATTGAAGGCGCTGAGCCAATTTCAGTGGCGTGGT

TCAAAGACAAAGGGGAAATTGTTAGAGAGAGTGACAACATATGGATTTCTTACTCTGAAAACATCGCCACCCTCCAGTTTTCAAGAGCAGAACCAGCCAA

TGCTGGGAAATACACCTGCCAGATCAAAAACGATGCTGGGATGCAGGAGTGCTACGCCACGCTATCAGTGCTCG AGCCTGCTGCAATTGTGGAAAAGCC

AGAATCTATTAAGGTGACCACAGGAGACACCTGTACCTTGGAGTGCACGGTATCAGGAACACCTGAGCTTAGTACCAAGTGGTTTAAGGACGGAAAGGAG

CTCACGAGTGACAACAAATATAAAATAAGCTTCTTCAACAAGGTGTCTGGCCTCAAGATCATCAATGTGGTGCCTGGCGACAGTGGGGTGTACAGCTTTG

AAGTGCAAAACCCTGTCGGCAAAGACAGCTGCAAAGTCTCCATTCAAGTCTCAG ATCGAATCATCCCTCCCTCGTTCACAAGAAAACTGAAAGAGACGA

ACGGTCTGTCGGGCTCCTCCGTGGTGATGGAGTGCAAAGTGTACGGATCACCCCCAATCTCTGTCCTGTGGTTCCATGACGGGAATGAGATCAGCAGTGG

CCGGAAGTACCAGACCACACTGACAGACAACACGTGTGCCCTGACGGTGAACATGCTGGAGGAAGCTGACGCCGGCGACTATACATGTATAGCTACCAAT

GTGGCAGGCTCCGACGAGTGTAGTGCCCCTCTGACTGTACGAG AGCCACCATCTTTTGTTCAGAAACCTGACCCGATGGATGTCTTAACTGGCAGTAAT

GTCACGTTCACAAGCATTGTCAAAGGCTCACCTCCTTTCACTGTCAGCTGGTTCAAAGGTAGCACTGAGCTTGTGCCTGGGGCCAGGTGCAACGTGTCTC

TGCAGGACTCGGTGGGTGAACTGGAGCTGTTTGACGTGGATACGTCCCAGAGCGGAGAATACACCTGCATAGTTAGTAACGAGGCTGGCAGGGCTTCCTG

CACAACACGTCTCTTCGTAAAAG CCCCAGCCATATTTGTGAAGCGACTCAATGACTACAGCATAGAGAAAGGCAAGCCTCTGATCCTTGAAGGGACCTT

CTCTGGAACTCCTCCGATCTCTGTTACATGGAAGAAAAATGGCATAAATGTCATAGCTTCCCAACGGTGTAATATTACCACAACTGAAAAATCAGCCATC

CTAGAAATTCTGAGCAGCACTGTCGAAGATTCAGGGCAGTACAACTGCTACATTGAAAACGCTTCTGGCAAGGACTCCTGCTCGGCCCAGATCCTGATTC

TAG AACCACCGTATTTTGTCAAGCAGTTGGAGCCTGTGAAGGTGACGGTTGGTGACTCTGCCTCTCTACAATGCCAGCTTGCTGGAACTCCCGAGATTG

GGGTCTCCTGGTATAAAGGAGACACAAAGCTCAGGCCCACTGCCACCTGCAAAATGCATTTTAAGAACAACGTTGCGACACTGGTTTTCACCCAGGTTGA

TAGCAGCGACAGCGGAGAATATATCTGCAGGGCTGAGAACAGTGTAGGCGAGGTTTCTTCATCAACTTTCCTGACTGTTCAAG AGCAAAAACTTCCACC

ATCCTTTTCTCGACAACTAAGAGATGTGCAAGAGACCGTGGGATTGCCAGTGGTTTTTGAATGTGCTGTAAGTGGGTCCGAGCCCATCTCTGTGTCTTGG

TACAAAGATGGCAAGCCGTTGAAAGACAGCCCAAATATACAAACATCATTTTTAGACAACATCGCCACTCTGAACATCTTTAAGACAGACAGGAGTCTCT

CGGGCCAGTACTCTTGCACTGCTACAAACCCCATTGGCTCTGCTTCTTCAGGCGCCAAACTCATCCTCACAG AGGGGAAGAACCCACCCTTCTTTGATA

TCCCTCTGGCCCCTATGGATGCTGTTGTGGGAGAAAGTGCTGACCTGGAATGCCATGTCACGGGAACACAGCCCATTAAGGTAACCTGGGCCAAGGACAA

CAGAGAGATACGAAGTGGTGGAAACTACCAGATCAGCTATCTGGAAAACAGTGCCCACCTGACCATCGTGAAAGTGGACAAAGGTGACTCTGGCCAGTAC

ACCTGCTACGCCGTCAATGAAGTGGGAAAAGACTCCTGCACAGCCCAACTCAATATAAAAG AGCGCCTCATCCCACCGAGTTTCACCAAAAAACTATCT

GAGACGGTAGAAGAGACAGAAGGGAACTCATTCAAACTGGAAGGGCGTGTGGCAGGGTCCCAGCCCATCACCGTTGCTTGGTACAAAAATAATGTAGAGA

TCCACCCGACCTCCAACTGTGAGATCATGTTCAAGAACAACGCACTGCTGCTGCAGGTGAAGAGGGCCAGCATGGCCGATGCAGGCTTATACACCTGCAA

GGCGACAAATGACGCAGGCTCTGCCCTGTGCACATCGTCCATTGTCATCAAAG AGCCTAAGAAGCCGCCTGTGTTTGACCAGCACCTTGCCCCGGTCAC

GGCCAGCGAAGGTGACTCTGTACAGCTCAGCTGCCACGTGCAGGGCTCCGAGCCCATTCGGATCCAGTGGTTGAAAGCTGGTAGGGAGGTAAAGCCTTCG

GACAGGTGCAGCTTCAGCTTTGCTAGCGGAACCGCCATGCTGGAACTCAAGGAGACAGCTAAAGCAGATTCAGGAGACTACGTGTGTAAGGCTTCCAACG

TGGCTGGAAGTGACACTTCAAAGTGCAAAGTGACCATTAAAG AGAAACCAGCCGCAGCCCCAGCAGCCAAGAAAGCAGCCGTGGATGGAAAACTCTTCT

TCGTGTCAGAGCCTCAGAGCATCAGAGTAGTGGAAA AAACCACTGCCACGTTTATTGCAAAAGTTGGAGGTGACCCGATCCCGAATGTCAAATGGACAA

AAGGGAAGTGGAGACAGCTGAACCAAGGGGGTCGCATTCTTATCCATCAAAAGGGCGACGAAGCGAAGCTGGAGATTCGTGACACCACAAAAACCGATTC

TGGCTTATACCGTTGCGTTGCCTTTAACAAGCACGGTGAAATTGAAAGCAATGTCAACCTACAGGTGGATGAAAGAAAGAAACAAGAGAAGATTGAAGGT

GATCTTCGCGCGATGCTGAAAAA GACTCCAGCCCTCAAGAAAGGATCTGGGGAAGAAGAGGAAATTGATATCATGGAACTTCTCAAAAATGTGGATCCT

AAAGAGTATGAGAAGTATGCGCGCATGTACGGAATCACCGACTTCCGGGGCCTCCTCCAAGCGTTTGAGCTGCTGAAACAGAGCCAGGAAGAAGAGACTC

ACAGACTG GAAATCGAGGAACTAGAGAAGTCAGAAAGAGATGAAAAGGAATTCGAAGAACTTGTAGCATTTATTCAGCAAAGGCTGACACAGACAGAG 

CCTGTCACTTTGATCAAGGATATTGAAAATCAGACAGTTCTGAAAGATAATGACGCCATCTTTGAAATTGACATTAAGATTAATTATCCAGAAATCAAGC

TTTCCTGGTACAAAGGGACTGAAAAGCTGGAGCCCAGTAACAAATATGAAATAAGCATCGATGGTGACCGGCACACACTCAGAGTCAAAAACTGTCAGCC

TAAAGATCAGGGCAATTACCGTCTGGTCTGTGGTCCCCACATCGCTAGTGCCAAGCTAACTGTGATTG AGCCCGCCTGGGAGCGGCATCTCCAGGACGT

TACTCTGAAGGAAGGCCAGACTTGTACCATGACGTGTCAGTTTTCTGTACCAAATGTGAAATCTGAGTGGTTCAGAAATGGCAGAGTCCTTAAACCTCAA

GGCAGAGTGAAAACGGAAGTGGAACACAAAGTCCACAAGCTGACCATTGCCGATGTCCGTGCAGAGGACCAGGGTCAGTACACCTGCAAGCACGAAGACC

TCGAAACTTCAGCAGAGCTCAGAATCGAAG CCGAACCCATTCAGTTTACAAAGCGCATACAGAACATCGTGGTGAGCGAGCATCAGTCTGCTACTTTCG

AGTGCGAAGTGTCCTTTGACGACGCCATAGTTACCTGGTACAAAGGACCAACAGAGCTGACTGAGAGCCAGAAATACAACTTTAGAAACGACGGCCGCTG

CCATTACATGACAATCCACAATGTGACCCCAGATGACGAAG GTGTCTATTCAGTAATTGCTCGGCTGGAGCCAAGAGGCGAAGCAAGAAGCACAGCGGA

ACTGTACTTAACAACCAAAG AAATAAAACTTGAGATGAAGCCTCCTG ATATTCCCGATTCCAGAGTTCCAATCCCAACCATGCCCATCAGAGCTGTCC

CACCGGAAG AAATCCCTCCTGCGGTTGCTCCTTCCATCCCTCTTTTGCTGCCATTACCTGAAGAGAAGAAGCCGCCAGCAAAACGAATTGAAG TGACC

AAAAAGGGTGTGAAAAAAGATACCAAAAAAGTTGTCACAAAGCCCAAAGAAGAGGCCCCACCACCACCAG TCCCAGAAGTTGCCAAGAAGCCTCCACCT

CCTACTCCCATGATTCCAGCAAAAG CTTCTGAGATTATTGACGTGTCCTCTAAGGCTGAAGAGGTAAAAATAACAACCATCACCAGAAAGAAAGAGGTT

CACAAAGAGAAAGAGGCTGTGTATGAACGAGAGGAAGCAGTCTACGAAAAGAAAGTTCACATAGAGCCTTGGGAAGAGCCCTATGAGGAATTGGAAACGG

AACCATACACAGAGCCATATGAAGAACCCTATTATGAAGAACCAGATGAAGACTATGAAGAGATCAAGGTGGAAGCTAAAAAGCAAGTCCACGAGGAATG

GGAGGAGGACTTTGAAGAAGGACAGGAGTACTATGAGAGAGAAGAGGGCTACGATGAAGGGGAGGAAGAGTGGGAAGAGATTTACCATGAAAGAGAAATA

ATTCAGGTTCAGAAGGAGGTTCATGAAG AATTACATGAGAAGAAAATCCCAGCCAAAGTGCCTGAAAAGAAAGTACCACCTCCCAAAG TCCCTGAACC

ACCTAAAAAGCCAGTTCCAGAAGAAGTGGTCCCTGTTCCCATTCCTAAGAAGGTGGAACCCCCAGCAGCCAAA GTCCCGGAAGTGCCCAAGAAGCCTGT

ACCAGAGGAGAAGCCACCAGTACCTGTTCCCAAAAAGGTGGAACCACCACCAGCCAAAG TGCCAGAAGTGCCGAAGAAACCTGTGCCTGAGAAGAAGGT

ACCAGCGCCTACTCCTAAGAAAGTAGAGGCTCCTCCTGCAAAAG TGCCTGAAGTACCACCCAAGGAAGTCACTCCTGAAAAGAAAGTTCCAGCAGCACC

TCCCACGAAGCCAGAAATTCCACCTCCCAAAG - UNI36362 - TGCCTACAGCTGAAAAGAAAGTTCGTAAATTACTTCCTGAACCTAAGCCGCAGC

CAAAGGAAGAGGTGGTGCTGAAAAGCG - UNI36362 - TTCTAAGAAAGAAACCCGAGGAAGAAGAACCTAAAGTAGAACCTAAAAAAGTAGAAAAA

GCTAAAAAACCGGAAG AGCCACAGCCACCTCCAAAAGCCGTTGAAGTTGAAGCTCCTCCAGAGCCTACACCAAAGGAAAGGAAAGTTCCAGAACCGGCC

AAAG - UNI17655 - TTCCTGAAATTAAGCCAGCGATACCTCTCCCTGGACCTGAACCAAAGCCAAAGCCTGAGCCAG - UNI17655 - AGGTG

AAAACCATGAAAGCTCCACCCATCGAGCCGGCACCCACTCCCATCGCTGCCCCCGTGACAGCGCCTGTGGTTGGGAAGAAAGCAG AAGCCAAACCTAAG

GATGAGGCTGCCAAGCCAAAAGGTCCCATCAAAG GTGTAGCCAAAAAGACTCCTTCACCAATAGAAGCTGAAAGGAAAAAGCTCAGACCAGGAAGCGGT

GGAGAGAAACCTCCAGACGAAGCTCCGTTCACTTACCAACTCAAGGCCGTGCCACTGAAATTCGTGAAAGAAATCAAAGACATCGTTTTGACAGAGGCAG

AGTCTGTGGGCTCTTCTGCCATCTTCGAATGTTTGGTCTCCCCATCCACTGCCATTACAACCTGGATGAAGGACGGCAGCAACATCCGTGAGAGCCCAAA

GCACAGATTCATTGCAGACGGCAAAGACAGGAAGCTGCACATTATCGACGTTCAGCTGTCTGATGCTGGTGAATACACCTGTGTGCTACGCTTGGGAAAT

AAAGAGAAGACGTCCACTGCTAAGCTCATCGTAGAAG AACTTCCTGTGCGCTTTGTGAAAACACTGGAGGAGGAAGTCACGGTGGTCAAGGGGCAGCCG

TTGTACTTGAGCTGTGAGTTGAACAAAGAACGCGATGTGGTCTGGAGGAAGGATGGTAAGATTGTGGTGGAGAAACCTGGCAGGATCGTGCCTGGTGTCA

TTGGCCTGATGCGGGCCCTGACCATCAATGATGCTGATGACACTGATGCCGGAACATACACTGTGACTGTGGAAAATGCCAACAACCTGGAATGTTCTTC

TTGTGTAAAAGTAGTAG AAATCATTAGAGAATGGCTTGTGAAACCTATCCGAGATCAGCATGTGAAGCCCAAGGGAACAGCTGTTTTCACCTGTGACAT

AGCCAAGGACACGCCAAACATTAAGTGGTTCAAAGGCTATGACGAGATCCCCTTGGAACCAAACGACAAGACTGAGATACTGAAAGAGGGAAACCACCTC

TTTCTCAAGGTTAAGAATGCTATGCCAGAAGATATTGATGAGTATGCAGTGGAAATTGAAGGGAAAAGATACCCAGCAAAGCTGACACTTGGAG AGCGC

GAAGTTGAGCTACTTAAGCCGATAGAAGATGTCACCATTTATGAGAAGGAAAGTGCCAGCTTTGATGCAGAAATCTCAGAGGAAGACATTCCTGGGGAGT

GGAAGCTGAAGGGCGAGCTTCTGCGGCCCTCGCCT ACTTGTGAAATCAAAGCTGAAGGTGGGAAGCGCTTCTTAACTTTGCACAAAGTGAAACTGGACC

AAGCTGGCGAAGTCCTCTACCAGGCTTGCAATGCGATCACAACTGCCATTCTGACAGTCAAAG AAATCGAGCTTGACTTTGCTGTACCCCTGAAGGATG

TGACTGTCCCAGAGAAGAGACAGGCTCGGTTTGAATGTGTCCTCACCAGAGAGGCAAATGTCATATGGTCTAAAGGGCCTGATATAATCAAGGCATCTGA

CAAATTTGATATTATTGCTGATGGAAAGAAACACATTCTTGTTATCAACGACTCTCAGTTTGACGATGAAGGAGTCTATACTGCAGAGGTGGAGGGCAAG

AAGACGTCAGCACAATTATTTGTGACAG GCATAAGACTTAAGTTCATATCACCACTGGAAGATCAAACAGTAAAAGAAGGCCAAACAGCAACTTTTGTC

TGTGAGCTCTCTCATGAAAAAATGCACGTGGTCTGGTTCAAAAACGATGTCAAGCTACACACAACCAGGACAGTGCTCATGTCTTCTGAGGGAAAGACTT

ATAAGCTGGAGATAAGGGAGACCACACTGGATGATATCTCACAGATCAAAGCTCAAGTGAAGAACCTCAGCTCTACAGCCAACCTGAAGGTCTTGG AGG

CCGATCCCTACTTCACCGTGAAATTACACGACAAGACTGGCGTGGAGAAGGACGAGATCATTCTTAAGTGTGAAGTGAGCAAAGATGTTCCGGTCAAATG

GTTCAAAGACGGGGAAGAGATTGTGCCTTCGCCCAAACATTCTGTCAAGACCGACGGCCTGCGCCGCATCTTAAAGATCAAGAAGGCAGAGCTCAAAGAC

AAAGGGGAATATGTGTGCGACTGCGGTACAGACACCACCAAGGCCAACGTCACTGTTGAGG CTCGACTCATAAAAGTGGAGAAACCCCTGTACGGCGTG

GAAGTGTTTGTGGGTGAAACCGCCCGCTTTGAAATTGAACTGTCTGAACCTGACGTGCATGGCCAGTGGAAGTTAAAGGGAGAGCCTTTGACTGCTTCTC

CT GACTGCGAAATCATCGAAGATGGGAAGAAACATGTCTTGGTTCTGTATAACTGTCAGCTGGATATGACCGGGGAGATATCCTTCCAGGCCGCCAACG

CTAAATCAGCAGCCAACCTGAAAGTGAAAG AACTGCCGCTCATTTTCATCACCCCTCTGAGTGACGTCAAAGTCTTTGAGAAAGATGAGGCGAAGTTTG

AGTGTGAAGTATCCAGGGAGCCCAAAACATTCCGCTGGCTGAAAGGAACCCAGGAAATCACTGGTGATGACAGATTTGAGCTCATCAAGGATGGCACCAG

GCATTCATTGGTGATCAAGTCAGCAGCTTTTGAAGATGAGGCCAAATACATGTTTGAAGCTGAAGATAAACGCACAAGCGGCAAACTGATCATTGAAG -

 UNI35827 - GAATCCGTCTCAAATTCCTGACCCCACTCAAGGATGTGACAGCCAAAGAAAGGGAAAATGCCGTGTTTACTGTGGAGCTGTCCCATGA

CAACATCCCAGTGAGCTGGTTCAAGAACGACCAGCGCCTGCACACCAGCAAGCGGGTCTCCATGCATGATGAAGGGAAAACACACTCCATCACGTTCAAA

GACCTGTCTATTGACGACACCTCCCAAATTAGAGTGGAGGCCATGGGGATAAGTTCAGAGGCTAAGCTCACTGTGCTGG - UNI35827 - - UNI35

899 - AGGGAGACCCATACTTCACAGGAAAGCTTCAAGATTACACAGGCGTGGAGAAGGATGAAGTGATTCTTCAGTGTGAAATCAGCAAAGCAGACGC

ACCCGTGAAATGGTTTAAGGACGGGAAGGAAATTAAGCCGTCTAAAAACGTTGTTATCAAGGCTGACGGCAAGAAACGCATGCTGATCCTGAAGAAGGCC

TTGAAATCAGATATCGGCCAATATACCTGTGACTGTGGGACAGACCAGACCTCTGGGAAGCTGGACATTGAAG - UNI32138 - - UNI35827 - 

- UNI35899 - ATCGGGAAATTAAACTGGTGCGACCCCTGTACAGCGTGGAGGTGATGGAGACCGAGACGGCCCGCTTTGAAACTGAGATCTCTGAAG

ATGATATACATGCCAACTGGAAACTGAAGGGAGAGGCACTGCTCCAAACACCT - UNI32138 - - UNI33036 - - UNI35899 - GAATGTG

AAATTAAAGAAGAAGGCAAGATCCACGTCCTTATCTTACACAACTGCCGCCTAGACCAGACTGGAGGTGTAGATTTCCAAGCTGCCAATGTCAAATCTAG

TGCCCACCTCCGAGTTAAAC - UNI32138 - - UNI32541 - - UNI33036 - CACGGGTAATTGGTCTGCTGAGGCCTCTAAAGGATGTTAC

AGTGACCGCAGGGGAAACGGCCACCTTTGACTGCGAGCTCTCCTATGAGGATATCCCAGTGGAATGGTACCTCAAAGGGAAGAAGCTGGAGCCTAACGAT

AAG - UNI14991 - - UNI16643 - - UNI32541 - - UNI33036 - GTGGTGACACGTTCAGAAGGAAGAGTTCACACGCTCACCCTGAG

GGATGTGAAGCTAGAAGATGCTGGCGAAGTCCAACTAACTGCAAAGGATTTCAAAACTCAGGCCAATCTCTTTGTGAAAG - UNI14991 - - UNI1

6643 - - UNI32541 - AACCCCCGGTTGAGTTCACTAAGCCTCTTGAGGACCAGACGGTCGAAGAGGAGGCCACTGCAGTACTGGAGTGTGAAGTA

TCCAGAGAAAATGCCAAAGTGAAATGGTTCAAAAATGGGACAGAAATCCTCAAAAGCAAGAAGTATGAAATCGTTGCTGATGGCAGGGTCAGGAAGCTCA

TTATTCATGGTTGTACCCCAGAGGATATCAAAACGTACACTTGTGATGCTAAAGATTTTAAGACCTCCTGTAACCTGAATGTTGTTC - UNI14991 -

 CTCCTCATGTGGAATTCTTAAGACCACTCACAGACCTCCAAGTC
Translation
LQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTIFRIQE ERQLPPSFARQLKDIEQTVGLPVTLT

CRLNGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSTARLTARE EPKKSPFFDIKPVSIDVIAGESADFECH

VTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKE EPPKFIKKLDASKVAKQGESIQLECKISGS

PEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVGDASCSTALKVKA APPVFTQKPPPVGALKGSDVILQCEISGTPPFEV

VWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVKFKE EPPRFVKKLSDASTLIGDPVELQAVVEGFQPISVVWLKD

KGEVIRESENVRISFVDNIATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTVLE EPATIVEKPEPMTVTTGNPFTLECVVAGTPELSAKWFKDGREL

SSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVGKSSCTVSVHVSD DRVVPPSFVRRLKDTSATLGASVVLECRVSGSAPISVGWFLDGNEIIS

SPKCQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAVLTVQE EPPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVSGEACT

ISLEDFVTELELLEVEPGQSGDYSCLVTNDAGSASCTTHLFVKE EPATFVKRLADTSVETGSPIVLEATYSGTPPISVSWMKNEYPLSQSPNCGITTTE

KSSILEILESTIEDYAQYACLIENEAGQDICEALVSVLE EPPYFIEPLEHVEAAIGEPITLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASL

VINKVDHSDVGEYTCKAENSVGAVASSAVLVIKE ERKLPPSFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGELLKDDANLQMSFVHHVATLQI

LQTDQSHVGQYNCSASNPLGTASSSAKLILSE EHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLK

VAKGDAGQYTCYASNVAGKDSCSAQLGVQE EPPRFIKKLDQSRIVKQDEYTRYECKIGGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVE

DSGDYTCEARNAAGSASSSTSLKVKE EPPVFRKKPFPVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSENLLTSIHILNVDTADIGEY

QCKATNDVGSDTCVGSVTMKA APPQFVKKLTDISTIIGKEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTCQI

KNDAGMQECYATLSVLE EPAAIVEKPESIKVTTGDTCTLECTVSGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVVPGDSGVYSFEVQNPVG

KDSCKVSIQVSD DRIIPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVLWFHDGNEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSD

ECSAPLTVRE EPPSFVQKPDPMDVLTGSNVTFTSIVKGSPPFTVSWFKGSTELVPGARCNVSLQDSVGELELFDVDTSQSGEYTCIVSNEAGRASCTTR

LFVKA APAIFVKRLNDYSIEKGKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILILE

 EPPYFVKQLEPVKVTVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVGEVSSSTFLTVQE EQKL

PPSFSRQLRDVQETVGLPVVFECAVSGSEPISVSWYKDGKPLKDSPNIQTSFLDNIATLNIFKTDRSLSGQYSCTATNPIGSASSGAKLILTE EGKNPP

FFDIPLAPMDAVVGESADLECHVTGTQPIKVTWAKDNREIRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKE ERLIPPSF

TKKLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNVEIHPTSNCEIMFKNNALLLQVKRASMADAGLYTCKATNDAGSALCTSSIVIKE EPKKPPVFD

QHLAPVTASEGDSVQLSCHVQGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAGSDTSKCKVTIKE EKPAAAPAAKK

AAVDGKLFFVSEPQSIRVVEK KTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVD

ERKKQEKIEGDLRAMLKK KTPALKKGSGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRL EIEELEKSERDEKEFEEL

VAFIQQRLTQTE PVTLIKDIENQTVLKDNDAIFEIDIKINYPEIKLSWYKGTEKLEPSNKYEISIDGDRHTLRVKNCQPKDQGNYRLVCGPHIASAKLT

VIE EPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLETSAELRIEA AEPIQFT

KRIQNIVVSEHQSATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEG GVYSVIARLEPRGEARSTAELYLTTKE EIKLEMK

PPD DIPDSRVPIPTMPIRAVPPEE EIPPAVAPSIPLLLPLPEEKKPPAKRIEV VTKKGVKKDTKKVVTKPKEEAPPPPV VPEVAKKPPPPTPMIPA

KA ASEIIDVSSKAEEVKITTITRKKEVHKEKEAVYEREEAVYEKKVHIEPWEEPYEELETEPYTEPYEEPYYEEPDEDYEEIKVEAKKQVHEEWEEDFE

EGQEYYEREEGYDEGEEEWEEIYHEREIIQVQKEVHEE ELHEKKIPAKVPEKKVPPPKV VPEPPKKPVPEEVVPVPIPKKVEPPAAK VPEVPKKPVP

EEKPPVPVPKKVEPPPAKV VPEVPKKPVPEKKVPAPTPKKVEAPPAKV VPEVPPKEVTPEKKVPAAPPTKPEIPPPKV - UNI36362 - VPTAEK

KVRKLLPEPKPQPKEEVVLKSV - UNI36362 - VLRKKPEEEEPKVEPKKVEKAKKPEE EPQPPPKAVEVEAPPEPTPKERKVPEPAKV - UNI1

7655 - VPEIKPAIPLPGPEPKPKPEPE - UNI17655 - EVKTMKAPPIEPAPTPIAAPVTAPVVGKKAE EAKPKDEAAKPKGPIKG GVAKKTP

SPIEAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTEAESVGSSAIFE           - UNI35827 -  - UNI35827 - - UN

I35899 -  - UNI32138 - - UNI35827 - - UNI35899 -  - UNI32138 - - UNI33036 - - UNI35899 -  - UNI32138

 - - UNI32541 - - UNI33036 -  - UNI14991 - - UNI16643 - - UNI32541 - - UNI33036 -  - UNI14991 - - UN

I16643 - - UNI32541 -  - UNI14991 - 
Transcript ENSMUST00000111841
Sequence
AGCCCGCCTGGGAGCGGCATCTCCAGGACGTTACTCTGAAGGAAGGCCAGACTTGTACCATGACGTGTCAGTTTTCTGTACCAAATGTGAAATCTGAGTG

GTTCAGAAATGGCAGAGTCCTTAAACCTCAAGGCAGAGTGAAAACGGAAGTGGAACACAAAGTCCACAAGCTGACCATTGCCGATGTCCGTGCAGAGGAC

CAGGGTCAGTACACCTGCAAGCACGAAGACCTCGAAACTTCAGCAGAGCTCAGAATCGAAG CCGAACCCATTCAGTTTACAAAGCGCATACAGAACATC

GTGGTGAGCGAGCATCAGTCTGCTACTTTCGAGTGCGAAGTGTCCTTTGACGACGCCATAGTTACCTGGTACAAAGGACCAACAGAGCTGACTGAGAGCC

AGAAATACAACTTTAGAAACGACGGCCGCTGCCATTACATGACAATCCACAATGTGACCCCAGATGACGAAG GTGTCTATTCAGTAATTGCTCGGCTGG

AGCCAAGAGGCGAAGCAAGAAGCACAGCGGAACTGTACTTAACAACCAAAG AAATAAAACTTGAGATGAAGCCTCCTG ATATTCCCGATTCCAGAGTT

CCAATCCCAACCATGCCCATCAGAGCTGTCCCACCGGAAG AAATCCCTCCTGCGGTTGCTCCTTCCATCCCTCTTTTGCTGCCATTACCTGAAGAGAAG

AAGCCGCCAGCAAAACGAATTGAAG TGACCAAAAAGGGTGTGAAAAAAGATACCAAAAAAGTTGTCACAAAGCCCAAAGAAGAGGCCCCACCACCACCA

G TCCCAGAAGTTGCCAAGAAGCCTCCACCTCCTACTCCCATGATTCCAGCAAAAG CTTCTGAGATTATTGACGTGTCCTCTAAGGCTGAAGAGGTAAA

AATAACAACCATCACCAGAAAGAAAGAGGTTCACAAAGAGAAAGAGGCTGTGTATGAACGAGAGGAAGCAGTCTACGAAAAGAAAGTTCACATAGAGCCT

TGGGAAGAGCCCTATGAGGAATTGGAAACGGAACCATACACAGAGCCATATGAAGAACCCTATTATGAAGAACCAGATGAAGACTATGAAGAGATCAAGG

TGGAAGCTAAAAAGCAAGTCCACGAGGAATGGGAGGAGGACTTTGAAGAAGGACAGGAGTACTATGAGAGAGAAGAGGGCTACGATGAAGGGGAGGAAGA

GTGGGAAGAGATTTACCATGAAAGAGAAATAATTCAGGTTCAGAAGGAGGTTCATGAAG AATTACATGAGAAGAAAATCCCAGCCAAAGTGCCTGAAAA

GAAAGTACCACCTCCCAAAG TTGTAAAGAAGCCAGTAGTTGAAAAAGTTGAAAAGACTACTCGGAGAATGGAGGAAGAAAAAGTTCAAGTCATCAAAG 

TCCCAGAGGCTCCAAAGAAACCTGCTCCCGAAGAAAAGATTCCTGTTCCTGTGACAAAGAAGAAGGAAGCCCCTCCAGCTAAAG AGGAGGAATGGACTT

ACTCTGAAGAAGAGGAAAGAGTGTCTGTTTCGGTGTATAGGGAAGAGGAAAGAGATGAGGAGGAAGCAGAAATCACAGAGTATGAAG TGTTGGAAGAGC

CCGAGGAATATGTTGTGGAAGAAAAGATGCACTTTATCTCTAAGAAAGTGGAAGTTGAACCAGCCAAAG TGCCTGAGAAGAAAATTATACCAAAACCAA

AAGTTCCTGCTAAAATTGAGGAGCCTCCACCCACTAAAG TCCCGGAAGTGCCCAAGAAGCCTGTACCAGAGGAGAAGCCACCAGTACCTGTTCCCAAAA

AGGTGGAACCACCACCAGCCAAAG TGCCAGAAGTGCCGAAGAAACCTGTGCCTGAGAAGAAGGTACCAGCGCCTACTCCTAAGAAAGTAGAGGCTCCTC

CTGCAAAAG - UNI36362 - TGCCTACAGCTGAAAAGAAAGTTCGTAAATTACTTCCTGAACCTAAGCCGCAGCCAAAGGAAGAGGTGGTGCTGAAA

AGCG - UNI36362 - TTCTAAGAAAGAAACCCGAGGAAGAAGAACCTAAAGTAGAACCTAAAAAAGTAGAAAAAGCTAAAAAACCGGAAG AGCCAC

AGCCACCTCCAAAAGCCGTTGAAGTTGAAGCTCCTCCAGAGCCTACACCAAAGGAAAGGAAAGTTCCAGAACCGGCCAAAG - UNI17655 - TTCCT

GAAATTAAGCCAGCGATACCTCTCCCTGGACCTGAACCAAAGCCAAAGCCTGAGCCAG - UNI17655 - AGGTGAAAACCATGAAAGCTCCACCCAT

CGAGCCGGCACCCACTCCCATCGCTGCCCCCGTGACAGCGCCTGTGGTTGGGAAGAAAGCAG AAGCCAAACCTAAGGATGAGGCTGCCAAGCCAAAAGG

TCCCATCAAAG GTGTAGCCAAAAAGACTCCTTCACCAATAGAAGCTGAAAGGAAAAAGCTCAGACCAGGAAGCGGTGGAGAGAAACCTCCAGACGAAGC

TCCGTTCACTTACCAACTCAAGGCCGTGCCACTGAAATTCGTGAAAGAAATCAAAGACATCGTTTTGACAGAG
Translation
MTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLETSAELRIEA AEPIQFTKRIQNIVVSEHQSATFECEVSFDD

AIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEG GVYSVIARLEPRGEARSTAELYLTTKE EIKLEMKPPD DIPDSRVPIPTMPIRAVPPE

E EIPPAVAPSIPLLLPLPEEKKPPAKRIEV VTKKGVKKDTKKVVTKPKEEAPPPPV VPEVAKKPPPPTPMIPAKA ASEIIDVSSKAEEVKITTITR

KKEVHKEKEAVYEREEAVYEKKVHIEPWEEPYEELETEPYTEPYEEPYYEEPDEDYEEIKVEAKKQVHEEWEEDFEEGQEYYEREEGYDEGEEEWEEIYH

EREIIQVQKEVHEE ELHEKKIPAKVPEKKVPPPKV VVKKPVVEKVEKTTRRMEEEKVQVIKV VPEAPKKPAPEEKIPVPVTKKKEAPPAKE EEEWT

YSEEEERVSVSVYREEERDEEEAEITEYEV VLEEPEEYVVEEKMHFISKKVEVEPAKV VPEKKIIPKPKVPAKIEEPPPTKV VPEVPKKPVPEEKPP

VPVPKKVEPPPAKV VPEVPKKPVPEKKVPAPTPKKVEAPPAKV - UNI36362 - VPTAEKKVRKLLPEPKPQPKEEVVLKSV - UNI36362 - 

VLRKKPEEEEPKVEPKKVEKAKKPEE EPQPPPKAVEVEAPPEPTPKERKVPEPAKV - UNI17655 - VPEIKPAIPLPGPEPKPKPEPE - UNI1

7655 - EVKTMKAPPIEPAPTPIAAPVTAPVVGKKAE EAKPKDEAAKPKGPIKG GVAKKTPSPIEAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKF

VKEIKDIVLTE
Transcript ENSMUST00000111840
Sequence
AGCCCGCCTGGGAGCGGCATCTCCAGGACGTTACTCTGAAGGAAGGCCAGACTTGTACCATGACGTGTCAGTTTTCTGTACCAAATGTGAAATCTGAGTG

GTTCAGAAATGGCAGAGTCCTTAAACCTCAAGGCAGAGTGAAAACGGAAGTGGAACACAAAGTCCACAAGCTGACCATTGCCGATGTCCGTGCAGAGGAC

CAGGGTCAGTACACCTGCAAGCACGAAGACCTCGAAACTTCAGCAGAGCTCAGAATCGAAG CCGAACCCATTCAGTTTACAAAGCGCATACAGAACATC

GTGGTGAGCGAGCATCAGTCTGCTACTTTCGAGTGCGAAGTGTCCTTTGACGACGCCATAGTTACCTGGTACAAAGGACCAACAGAGCTGACTGAGAGCC

AGAAATACAACTTTAGAAACGACGGCCGCTGCCATTACATGACAATCCACAATGTGACCCCAGATGACGAAG GTGTCTATTCAGTAATTGCTCGGCTGG

AGCCAAGAGGCGAAGCAAGAAGCACAGCGGAACTGTACTTAACAACCAAAG AAATAAAACTTGAGATGAAGCCTCCTG ATATTCCCGATTCCAGAGTT

CCAATCCCAACCATGCCCATCAGAGCTGTCCCACCGGAAG AAATCCCTCCTGCGGTTGCTCCTTCCATCCCTCTTTTGCTGCCATTACCTGAAGAGAAG

AAGCCGCCAGCAAAACGAATTGAAG TGACCAAAAAGGGTGTGAAAAAAGATACCAAAAAAGTTGTCACAAAGCCCAAAGAAGAGGCCCCACCACCACCA

G TCCCAGAAGTTGCCAAGAAGCCTCCACCTCCTACTCCCATGATTCCAGCAAAAG CTTCTGAGATTATTGACGTGTCCTCTAAGGCTGAAGAGGTAAA

AATAACAACCATCACCAGAAAGAAAGAGGTTCACAAAGAGAAAGAGGCTGTGTATGAACGAGAGGAAGCAGTCTACGAAAAGAAAGTTCACATAGAGCCT

TGGGAAGAGCCCTATGAGGAATTGGAAACGGAACCATACACAGAGCCATATGAAGAACCCTATTATGAAGAACCAGATGAAGACTATGAAGAGATCAAGG

TGGAAGCTAAAAAGCAAGTCCACGAGGAATGGGAGGAGGACTTTGAAGAAGGACAGGAGTACTATGAGAGAGAAGAGGGCTACGATGAAGGGGAGGAAGA

GTGGGAAGAGATTTACCATGAAAGAGAAATAATTCAGGTTCAGAAGGAGGTTCATGAAG AATTACATGAGAAGAAAATCCCAGCCAAAGTGCCTGAAAA

GAAAGTACCACCTCCCAAAG TTGTAAAGAAGCCAGTAGTTGAAAAAGTTGAAAAGACTACTCGGAGAATGGAGGAAGAAAAAGTTCAAGTCATCAAAG 

TACCTGAAGTTTCTAAGAAGATTGTTCCACAAAAACCTTCCCGGACTCCAGTGCAGGAAGAAATAATTGAAGTGAAAG TACCAGCTGTGCACACAAAGA

AGATGGTTATCTCTGAAGAAAAGATGTTCTTTGCTTCTCACACAGAGGAAGAGGTGTCTGTCTCAG TCCCCGAGGTGCAAAAGAAAACTGTCACTGAAG

AGAAAATTCACGTTGCAGTTTCCAAAAAGATTGAACCACCACCCAAAG TCCCTGAACCACCTAAAAAGCCAGTTCCAGAAGAAGTGGTCCCTGTTCCCA

TTCCTAAGAAGGTGGAACCCCCAGCAGCCAAAG TTCCTGAGGCTCCCAAGAAACCTGTGCCAGAGGAGAAAAAGCCAGTTCCTATTCCCAAGAAGAAAG

AGCCAGCTGCCCCTCCACAAG TCCCAGAGGCTCCAAAGAAACCTGCTCCCGAAGAAAAGATTCCTGTTCCTGTGACAAAGAAGAAGGAAGCCCCTCCAG

CTAAAG AGGAGGAATGGACTTACTCTGAAGAAGAGGAAAGAGTGTCTGTTTCGGTGTATAGGGAAGAGGAAAGAGATGAGGAGGAAGCAGAAATCACAG

AGTATGAAG TGTTGGAAGAGCCCGAGGAATATGTTGTGGAAGAAAAGATGCACTTTATCTCTAAGAAAGTGGAAGTTGAACCAGCCAAAG TGCCTGAG

AAGAAAATTATACCAAAACCAAAAGTTCCTGCTAAAATTGAGGAGCCTCCACCCACTAAAG TGACCGAAGTTAGAAAAAGAGCTGTTAAAGAAGAAAAG

GTGTCCATTGAAGTTCCAAAGAGAGAACCCCGACCCACTAAAG AAGTGACTGTGACAGAAGAGAAGAAATGGTCTTACACCCGAGAAGAAGAAACTGTT

TCAGAACATCGGGAGGAGGAGTATGAGGATTACGAAGACTATGAGGAGTATAAAGAGTTTGAGGAGTACGAACCCACCGAAGAATATGACCAGTATGACG

AGTATGCAGAGCGTGAGGTGGAGCACTATGAAGAGCATGAGGAATACGTCACAG AACCCAAGAAGCCTGTCCCAGTGAAACCTGCCCAAGAACCGGTGC

CTGCTAAACCCAAGGCTCCCCCACCAAAAG TCCCGGAAGTGCCCAAGAAGCCTGTACCAGAGGAGAAGCCACCAGTACCTGTTCCCAAAAAGGTGGAAC

CACCACCAGCCAAAG TGCCAGAAGTGCCGAAGAAACCTGTGCCTGAGAAGAAGGTACCAGCGCCTACTCCTAAGAAAGTAGAGGCTCCTCCTGCAAAAG

 TGCCTGAAGTACCACCCAAGGAAGTCACTCCTGAAAAGAAAGTTCCAGCAGCACCTCCCACGAAGCCAGAAATTCCACCTCCCAAAG TGCCAGAGGTG

CCAAAGAAACCTGTCATTGAAGAGAAGCCAGCCATTCCTGTTGTTGAGAAAGTGGCGTCCCCTCCTGCTGAAG TATATGAAGAACCGGAAGAAGTCACT

GCTGAGGAAGAGGAGCCAGCCCCTGCTGTAGAAGAGGAGGAATACGAAGCTCCCCCTCCCCCTGCACCAG - UNI36362 - TGCCTACAGCTGAAAA

GAAAGTTCGTAAATTACTTCCTGAACCTAAGCCGCAGCCAAAGGAAGAGGTGGTGCTGAAAAGCG - UNI36362 - TTCTAAGAAAGAAACCCGAGG

AAGAAGAACCTAAAGTAGAACCTAAAAAAGTAGAAAAAGCTAAAAAACCGGAAG AGCCACAGCCACCTCCAAAAGCCGTTGAAGTTGAAGCTCCTCCAG

AGCCTACACCAAAGGAAAGGAAAGTTCCAGAACCGGCCAAAG - UNI17655 - TTCCTGAAATTAAGCCAGCGATACCTCTCCCTGGACCTGAACCA

AAGCCAAAGCCTGAGCCAG - UNI17655 - AGGTGAAAACCATGAAAGCTCCACCCATCGAGCCGGCACCCACTCCCATCGCTGCCCCCGTGACAGC

GCCTGTGGTTGGGAAGAAAGCAG AAGCCAAACCTAAGGATGAGGCTGCCAAGCCAAAAGGTCCCATCAAAG GTGTAGCCAAAAAGACTCCTTCACCAA

TAGAAGCTGAAAGGAAAAAGCTCAGACCAGGAAGCGGTGGAGAGAAACCTCCAGACGAAGCTCCGTTCACTTACCAACTCAAGGCCGTGCCACTGAAATT

CGTGAAAGAAATCAAA
Translation
MTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLETSAELRIEA AEPIQFTKRIQNIVVSEHQSATFECEVSFDD

AIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEG GVYSVIARLEPRGEARSTAELYLTTKE EIKLEMKPPD DIPDSRVPIPTMPIRAVPPE

E EIPPAVAPSIPLLLPLPEEKKPPAKRIEV VTKKGVKKDTKKVVTKPKEEAPPPPV VPEVAKKPPPPTPMIPAKA ASEIIDVSSKAEEVKITTITR

KKEVHKEKEAVYEREEAVYEKKVHIEPWEEPYEELETEPYTEPYEEPYYEEPDEDYEEIKVEAKKQVHEEWEEDFEEGQEYYEREEGYDEGEEEWEEIYH

EREIIQVQKEVHEE ELHEKKIPAKVPEKKVPPPKV VVKKPVVEKVEKTTRRMEEEKVQVIKV VPEVSKKIVPQKPSRTPVQEEIIEVKV VPAVHTK

KMVISEEKMFFASHTEEEVSVSV VPEVQKKTVTEEKIHVAVSKKIEPPPKV VPEPPKKPVPEEVVPVPIPKKVEPPAAKV VPEAPKKPVPEEKKPVP

IPKKKEPAAPPQV VPEAPKKPAPEEKIPVPVTKKKEAPPAKE EEEWTYSEEEERVSVSVYREEERDEEEAEITEYEV VLEEPEEYVVEEKMHFISKK

VEVEPAKV VPEKKIIPKPKVPAKIEEPPPTKV VTEVRKRAVKEEKVSIEVPKREPRPTKE EVTVTEEKKWSYTREEETVSEHREEEYEDYEDYEEYK

EFEEYEPTEEYDQYDEYAEREVEHYEEHEEYVTE EPKKPVPVKPAQEPVPAKPKAPPPKV VPEVPKKPVPEEKPPVPVPKKVEPPPAKV VPEVPKKP

VPEKKVPAPTPKKVEAPPAKV VPEVPPKEVTPEKKVPAAPPTKPEIPPPKV VPEVPKKPVIEEKPAIPVVEKVASPPAEV VYEEPEEVTAEEEEPAP

AVEEEEYEAPPPPAPV - UNI36362 - VPTAEKKVRKLLPEPKPQPKEEVVLKSV - UNI36362 - VLRKKPEEEEPKVEPKKVEKAKKPEE E

PQPPPKAVEVEAPPEPTPKERKVPEPAKV - UNI17655 - VPEIKPAIPLPGPEPKPKPEPE - UNI17655 - EVKTMKAPPIEPAPTPIAAPV

TAPVVGKKAE EAKPKDEAAKPKGPIKG GVAKKTPSPIEAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIK
Transcript ENSMUST00000086376
Sequence
TCATTGAGTTCCTAGAGGCTGAAGAAGTGGAAGTATACGAAAAGCCCAAAATTCCACCTAAAAAAG GACCTGAGGTATCTGAGAAAGTCATCCCTCCAA

AAAAGCCACCCACTAAAGTCATTCCTCGAAAAGAGCCACCAGCTAAAG TACCCGAGGTGCCAAAGACAGCTGTTCCCCAAAAGAAGATCCCTGAGGCCA

TTCCCCCCAAACCGGAAAGTCCTCCCCTTGAAG TGCCTGAAGTACCACCCAAGGAAGTCACTCCTGAAAAGAAAGTTCCAGCAGCACCTCCCACGAAGC

CAGAAATTCCACCTCCCAAAG TGCCAGAGGTGCCAAAGAAACCTGTCATTGAAGAGAAGCCAGCCATTCCTGTTGTTGAGAAAGTGGCGTCCCCTCCTG

CTGAAG TATATGAAGAACCGGAAGAAGTCACTGCTGAGGAAGAGGAGCCAGCCCCTGCTGTAGAAGAGGAGGAATACGAAGCTCCCCCTCCCCCTGCAC

CAG TGCCTGAAGAGCCTAAGAAGGTTGTCCCAGAGAAGAAATTTCCTGTCATCAAAAAACCAGAGGCTCCCCCTCCTAAAG TACCTGAGGTGCCAAAG

AAAGCTGTGCCCGTGAAGAAAGTTCCGGTTGTTAAGAAGCCAGAACCACCAGAAGCTGAAG TCCCCGAGGTGCCGAAGAAACTTGTTCCAGTCAAGAAG

GAACCTGTGCCTGTTACCAAAAAAACAGAAGTCCTGCCAGAAAAAG TACCGGAAGCACCCAAGAAAATTACCCCAGAAAAGAAAGAGTCTGTTCCCGTG

CCTGAAGAGCCAGAGGCCCCTCCTGCCTCAG TGGAAGAGACTCCTGAGGAGACAATCTATGAAGAGAAAGCAACCATTACCATTGGTAGAAAAGAGACG

CCCCCTGTTGAAG AACGCGAAATTGAAAAGTTTATTCAACCTGAAGAACCCGAACTGGAACCAGAGCCAGAAGAAATCCCAGTACAAG AACCTGAGCC

AGAGAAGAAGGTTATCGAGAAACCAAAACTCAAACCAAGACCCCCTGCACGTCCTCCTTCTCCACCTAAGGAAGATGTGAAGGAGAAAATGTTCCAACTT

AAAG - UNI36362 - CTGTTTCAAAGAAGAAAGTTCCTGAAAAACCCGAGGTTGTGGAAAAAGTGGAGCCTGCACCACTAAAAG - UNI36362 -

 TGCCTACAGCTGAAAAGAAAGTTCGTAAATTACTTCCTGAACCTAAGCCGCAGCCAAAGGAAGAGGTGGTGCTGAAAAGCG - UNI36362 - TTCT

AAGAAAGAAACCCGAGGAAGAAGAACCTAAAGTAGAACCTAAAAAAGTAGAAAAAGCTAAAAAACCGGAAG AGCCACAGCCACCTCCAAAAGCCGTTGA

AGTTGAAGCTCCTCCAGAGCCTACACCAAAGGAAAGGAAAGTTCCAGAACCGGCCAAAG - UNI17655 - TTCCTGAAATTAAGCCAGCGATACCTC

TCCCTGGACCTGAACCAAAGCCAAAGCCTGAGCCAG - UNI17655 - AGGTGAAAACCATGAAAGCTCCACCCATCGAGCCGGCACCCACTCCCATC

GCTGCCCCCGTGACAGCGCCTGTGGTTGGGAAGAAAGCAG AAGCCAAACCTAAGGATGAGGCTGCCAAGCCAAAAGGTCCCATCAAAG GTGTAGCCAA

AAAGACTCCTTCACCAATAGAAGCTGAAAGGAAAAAGCTCAGACCAGGAAGCGGTGGAGAGAAACCTCCAGACGAAGCTCCGTTCACTTACCAACTCAAG

GCCGTGCCACTGAAATTCGTGAAAGAAATCAAAGACATCGTTTTGACAGAGGCAGAGTCTGTGGGCTCTTCTGCCATCTTCGAATGTTTGGTCTCCCCAT

CCACTGCCATTACAACCTGGATGAAGGACGGCAGCAACATCCGTGAGAGCCCAAAGCACAGATTCATTGCAGACGGCAAAGACAGGAAGCTGCACATTAT

CGACGTTCAGCTGTCTGATGCTGGTGAATACACCTGTGTGCTACGCTTGGGAAATAAAGAGAAGACGTCCACTGCTAAGCTCATCGTAGAAG AACTTCC

TGTGCGCTTTGTGAAAACACTGGAGGAGGAAGTCACGGTGGTCAAGGGGCAGCCGTTGTACTTGAGCTGTGAGTTGAACAAAGAACGCGATGTGGTCTGG

AGGAAGGATGGTAAGATTGTGGTGGAGAAACCTGGCAGGATCGTGCCTGGTGTCATTGGCCTGATGCGGGCCCTGACCATCAATGATGCTGATGACACTG

ATGCCGGAACATACACTGTGACTGTGGAAAATGCCAACAACCTGGAATGTTCTTCTTGTGTAAAAGTAGTAG AAATCATTAGAGAATGGCTTGTGAAAC

CTATCCGAGATCAGCATGTGAAGCCCAAGGGAACAGCTGTTTTCACCTGTGACATAGCCAAGGACACGCCAAACATTAAGTGGTTCAAAGGCTATGACGA

GATCCCCTTGGAACCAAACGACAAGACTGAGATACTGAAAGAGGGAAACCACCTCTTTCTCAAGGTTAAGAATGCTATGCCAGAAGATATTGATGAGTAT

GCAGTGGAAATTGAAGGGAAAAGATACCCAGCAAAGCTGACACTTGGAG AGCGCGAAGTTGAGCTACTTAAGCCGATAGAAGATGTCACCATTTATGAG

AAGGAAAGTGCCAGCTTTGATGCAGAAATCTCAGAGGAAGACATTCCTGGGGAGTGGAAGCTGAAGGGCGAGCTTCTGCGGCCCTCGCCT ACTTGTGAA

ATCAAAGCTGAAGGTGGGAAGCGCTTCTTAACTTTGCACAAAGTGAAACTGGACCAAGCTGGCGAAGTCCTCTACCAGGCTTGCAATGCGATCACAACTG

CCATTCTGACAGTCAAAG AAATCGAGCTTGACTTTGCTGTACCCCTGAAGGATGTGACTGTCCCAGAGAAGAGACAGGCTCGGTTTGAATGTGTCCTCA

CCAGAGAGGCAAATGTCATATGGTCTAAAGGGCCTGATATAATCAAGGCATCTGACAAATTTGATATTATTGCTGATGGAAAGAAACACATTCTTGTTAT

CAACGACTCTCAGTTTGACGATGAAGGAGTCTATACTGCAGAGGTGGAGGGCAAGAAGACGTCAGCACAATTATTTGTGACAG GCATAAGACTTAAGTT

CATATCACCACTGGAAGATCAAACAGTAAAAGAAGGCCAAACAGCAACTTTTGTCTGTGAGCTCTCTCATGAAAAAATGCACGTGGTCTGGTTCAAAAAC

GATGTCAAGCTACACACAACCAGGACAGTGCTCATGTCTTCTGAGGGAAAGACTTATAAGCTGGAGATAAGGGAGACCACACTGGATGATATCTCACAGA

TCAAAGCTCAAGTGAAGAACCTCAGCTCTACAGCCAACCTGAAGGTCTTGG AGGCCGATCCCTACTTCACCGTGAAATTACACGACAAGACTGGCGTGG

AGAAGGACGAGATCATTCTTAAGTGTGAAGTGAGCAAAGATGTTCCGGTCAAATGGTTCAAAGACGGGGAAGAGATTGTGCCTTCGCCCAAACATTCTGT

CAAGACCGACGGCCTGCGCCGCATCTTAAAGATCAAGAAGGCAGAGCTCAAAGACAAAGGGGAATATGTGTGCGACTGCGGTACAGACACCACCAAGGCC

AACGTCACTGTTGAGG CTCGACTCATAAAAGTGGAGAAACCCCTGTACGGCGTGGAAGTGTTTGTGGGTGAAACCGCCCGCTTTGAAATTGAACTGTCT

GAACCTGACGTGCATGGCCAGTGGAAGTTAAAGGGAGAGCCTTTGACTGCTTCTCCT GACTGCGAAATCATCGAAGATGGGAAGAAACATGTCTTGGTT

CTGTATAACTGTCAGCTGGATATGACCGGGGAGATATCCTTCCAGGCCGCCAACGCTAAATCAGCAGCCAACCTGAAAGTGAAAG AACTGCCGCTCATT

TTCATCACCCCTCTGAGTGACGTCAAAGTCTTTGAGAAAGATGAGGCGAAGTTTGAGTGTGAAGTATCCAGGGAGCCCAAAACATTCCGCTGGCTGAAAG

GAACCCAGGAAATCACTGGTGATGACAGATTTGAGCTCATCAAGGATGGCACCAGGCATTCATTGGTGATCAAGTCAGCAGCTTTTGAAGATGAGGCCAA

ATACATGTTTGAAGCTGAAGATAAACGCACAAGCGGCAAACTGATCATTGAAG - UNI35827 - GAATCCGTCTCAAATTCCTGACCCCACTCAAGG

ATGTGACAGCCAAAGAAAGGGAAAATGCCGTGTTTACTGTGGAGCTGTCCCATGACAACATCCCAGTGAGCTGGTTCAAGAACGACCAGCGCCTGCACAC

CAGCAAGCGGGTCTCCATGCATGATGAAGGGAAAACACACTCCATCACGTTCAAAGACCTGTCTATTGACGACACCTCCCAAATTAGAGTGGAGGCCATG

GGGATAAGTTCAGAGGCTAAGCTCACTGTGCTGG - UNI35827 - - UNI35899 - AGGGAGACCCATACTTCACAGGAAAGCTTCAAGATTACA

CAGGCGTGGAGAAGGATGAAGTGATTCTTCAGTGTGAAATCAGCAAAGCAGACGCACCCGTGAAATGGTTTAAGGACGGGAAGGAAATTAAGCCGTCTAA

AAACGTTGTTATCAAGGCTGACGGCAAGAAACGCATGCTGATCCTGAAGAAGGCCTTGAAATCAGATATCGGCCAATATACCTGTGACTGTGGGACAGAC

CAGACCTCTGGGAAGCTGGACATTGAAG - UNI32138 - - UNI35827 - - UNI35899 - ATCGGGAAATTAAACTGGTGCGACCCCTGTAC

AGCGTGGAGGTGATGGAGACCGAGACGGCCCGCTTTGAAACTGAGATCTCTGAAGATGATATACATGCCAACTGGAAACTGAAGGGAGAGGCACTGCTCC

AAACACCT - UNI32138 - - UNI33036 - - UNI35899 - GAATGTGAAATTAAAGAAGAAGGCAAGATCCACGTCCTTATCTTACACAACT

GCCGCCTAGACCAGACTGGAGGTGTAGATTTCCAAGCTGCCAATGTCAAATCTAGTGCCCACCTCCGAGTTAAAC - UNI32138 - - UNI32541 

- - UNI33036 - CACGGGTAATTGGTCTGCTGAGGCCTCTAAAGGATGTTACAGTGACCGCAGGGGAAACGGCCACCTTTGACTGCGAGCTCTCCTA

TGAGGATATCCCAGTGGAATGGTACCTCAAAGGGAAGAAGCTGGAGCCTAACGATAAG - UNI14991 - - UNI16643 - - UNI32541 - - 

UNI33036 - GTGGTGACACGTTCAGAAGGAAGAGTTCACACGCTCACCCTGAGGGATGTGAAGCTAGAAGATGCTGGCGAAGTCCAACTAACTGCAAA

GGATTTCAAAACTCAGGCCAATCTCTTTGTGAAAG - UNI14991 - - UNI16643 - - UNI32541 - AACCCCCGGTTGAGTTCACTAAGCC

TCTTGAGGACCAGACGGTCGAAGAGGAGGCCACTGCAGTACTGGAGTGTGAAGTATCCAGAGAAAATGCCAAAGTGAAATGGTTCAAAAATGGGACAGAA

ATCCTCAAAAGCAAGAAGTATGAAATCGTTGCTGATGGCAGGGTCAGGAAGCTCATTATTCATGGTTGTACCCCAGAGGATATCAAAACGTACACTTGTG

ATGCTAAAGATTTTAAGACCTCCTGTAACCTGAATGTTGTTC - UNI14991 - CTCCTCATGTGGAATTCTTAAGACCACTCACAGACCTCCAAGTC

Translation
     YEEPEEVTAEEEEPAPAVEEEEYEAPPPPAPV VPEEPKKVVPEKKFPVIKKPEAPPPKV VPEVPKKAVPVKKVPVVKKPEPPEAEV VPEVPK

KLVPVKKEPVPVTKKTEVLPEKV VPEAPKKITPEKKESVPVPEEPEAPPASV VEETPEETIYEEKATITIGRKETPPVEE EREIEKFIQPEEPELEP

EPEEIPVQE EPEPEKKVIEKPKLKPRPPARPPSPPKEDVKEKMFQLKA - UNI36362 - AVSKKKVPEKPEVVEKVE - UNI36362 -  - UN

I36362 -   - UNI17655 -  - UNI17655 -              - UNI35827 -  - UNI35827 - - UNI35899 -  - UNI321

38 - - UNI35827 - - UNI35899 -  - UNI32138 - - UNI33036 - - UNI35899 -  - UNI32138 - - UNI32541 - - 

UNI33036 -  - UNI14991 - - UNI16643 - - UNI32541 - - UNI33036 -  - UNI14991 - - UNI16643 - - UNI3254

1 -  - UNI14991 - 
Transcript ENSMUST00000099980
Sequence
GAGCAGTCGCGCATTCCCACCTCGCCTCGGGTGTAGGGATTGCATAGGAAACAAAACCACACAGTCAAGACTGTGTGGTTTTGTTTGGAGGGTTAGAGGC

TCACCGATTCATGTCGGAGATGGTTGGAAAAACCAACTCTACGTAGGACGTCGTTTCAGAAGCAAACTTGGGCTTGGTCCCACCCTTTTTGGGCACTCCT

GAGAAATCAG AGTGCCTGAAAAGATGACTACTCAAGCACCGATGTTTACGCAGCCGTTACAAAGCGTTGTGGTACTGGAGGGTAGTACCGCAACCTTTG

AGGCTCACGTTAGTG GTTCCCCAGTTCCTGAGGTGAGCTGGTTTCGGGATGGCCAGGTGATTTCAACTTCCACTCTGCCCGGCGTGCAGATCTCCTTTA

GCGATGGCCGCGCTAGATTGATGATCCCCGCCGTGACTAAAGCCAACAGTGGACGATACTCCCTGAGAGCCACCAATGGATCTGGACAAGCGACTAGTAC

TGCTGAGCTTCTTGTGACAG CCGAGACAGCACCACCCAACTTCAGTCAGCGGCTGCAGAGCATGACTGTGAGACAAGGAAGCCAAGTGAGACTCCAAGT

GAGAGTGACTGGAATCCCTACACCTGTGGTGAAGTTCTACCGGGATGGAGCCGAAATCCAGAGCTCCCTTGATTTCCAAATTTCTCAAGAAGGAGACCTC

TACAGCTTACTGATTGCCGAAGCATACCCTGAAGACTCCGGGACCTATTCTGTAAATGCCACCAACAGCGTTGGAAGAGCTACTTCCACTGCAGAATTGG

TGGTTCAAG GTGAAGAAGTAGTACCTGCTAAAAAGACAAAGACGATCGTGTCGACTGCTCAGATTTCAGAAACAAGACAAACCCGGATTGAAAAA AAG

ATTGAAGCCCACTTTGATGCCAGATCAATCGCAACAGTTGAGATGGTCATAGATGGTGCCACTGGACAGCTGCCACATAAAACACCTCCCAGGATACCTC

CTAAGCCCAAGTCCAGGTCTCCGACACCACCTTCCATTGCTGCCAAAGCACAGCTGGCCAGACAACAGTCCCCATCACCAATAAGACACTCTCCCTCCCC

AGTCAGACACGTGCGGGCACCAACCCCATCTCCAGTCAG GTCCGTGTCTCCAGCGGGGAGGATCTCCACTTCCCCGATCAGATCCGTGAAGTCGCCACT

GCTCATTCGCAAGACTCAGACCACCACCATGGCCACAGGCCCCGAGGTGCCTCCCCCTTGGAAGCAAGAGGGCTACGTGGCCTCCTCGACTGAGGCTGAG

ATGAGAGAGACGACAATGACAAGCTCTACCCAGATCAGAAGAGAAGAGAGGTGGGAAGGGAGATACGGGGTCCAGGAGCAAGTGACCATCAGTGGAGCCG

CGGCTGCTGCGGCCAGTGCGTCGGTCAGCTCGTCATTCACGGCAGGAGCCATCACCACTGGGACTAAGGAG GTGAAACAAGAGACAGACAAGAGTGCAG

CTGTTGCGACTGTCGTTGCTGCTGTTGATATGGCCAGAGTGAGAGAACCAGCCATCAGTGCTGTAGAGCAAACTGCTCAGAGGACAACCACGACTGCTGT

GCATATACAACCTGCTCAAGAACAG GCGAGAAAAGAGGCGGAGAAGACCGCAGTAACCAAGGTTGTAGTTGCTGCCGATAAAGCCAAGGAACAGGAACT

AAAATCACGAACCAGAGAAGTGATGGTGACAACGCAAGAGCAGACTCACATATCTCATGAGCAG ATAAGAAAAGAAACTGAAAAAGCATTTGTACCAAA

GGTAGTGATCTCCGCAACCAAAGCCAAAGAGCAAGAAACTAGAATCACGGGAGAAATTACTACAAAACAAGAGCAAAAGCGAATAACTCAAGAAACA AT

GATGAAGGAAACTAGGAAAACAGTGGTACCCAAAGTCATAGTTGCCACGCCCAAGATTAAAGAGCAAGATTTAGTATCAAGAAGTAGAGAAGCCATCACT

ACCAAAAGAGATCAAGTTCAAATAACTCAGGAAAAG AAGAGAAAGGAAGTGGAAACAACTGCCTTGTCTACAATAGCAGTTGCTACTGCTAAAGCCAAA

GAGCAAGAAACAGTTCTGAGGTCTAGAGAAGCCATGGCCACTAGACAAGAACACATCCAAGTTACCCATGGACAG GTGGGCGTTGGGAAGAAGGCAGAA

GCCGTGGCAACAGTTGTAGCTGCTGTGGACCAGGCCCGAGTGAGGGAACCCAGAGAGCCTACGCATGTGGAGGAATCGCATTCTCAGCAGACTACGTTAG

AGTATGGCTACAAAGAACACATTTCCACCACAAAGGTCCCAGAGCAGCCCCGGCGCCCAGCCTCAGAGCCCCACGTTGTCCCTCAAGCAGTCAAGCCTGC

TGTGATTCAGGCTCCTTCTGAGACTCATATCAAAACTACTGACCAAATGGGAATGCATATATCGTCACAG GTCAAGAAAACTACAGATATCTCAACAGA

AAGATTAGTTCATGTGGATAAACGCCCCCGCACAGCGAGCCCTCACTTTACTGTTTCAAAAATTTCTGTACCTAAGACAGAACATGGATATGAG GCATC

GATAGCTGGTAGCGCTATCGCCACACTACAAAAAGAATTGTCAGCCACATCTTCAACTCAGAAGATCACCAAATCCGTGAAGGCACCCACCGTGAAGCCT

GGGGAGACGAGAGTAAGGGCGGAGCCCACCCCTTCCCCACAGTTCCCCTTTGCTGACATGCCGCCGCCAGACACTTACAAGAGTCAGGCTGGCATTGAGG

TGAAGAAGGAAGTCGGGGTGAGCATCAGTGGCAGCACCGTTCGTGAGGAGCACTTCGAAGTACTGCGCGGACGTGAAGCCAAG GTAACAGAGACAGCAC

GAGTGCCTGCTCCTGCTGAAGTGCCTGTTACTCCGCCTACCTTGGTCTCG GGCTTAAAAAACGTGACTGTCATAGAAGGCGAATCTGTCACCTTGGAGT

GCCACATCTCTGGATACCCATCCCCCAAGGTGACATGGTACAGAGAAGACTACCAAATCGAAAGTTCCATTGATTTCCAGATAACCTTCCAGGGTGGAAT

TGCTCGTCTCATGATCCGCGAAGCCTTTGCGGAAGACAGCGGACGGTTTACCTGCAGCGCCGTGAATGAGGCCGGGACCGTCAGCACTTCCTGCTATCTT

GCTGTGCAAG TGTCAGAAGAGTTTGACAAGGAAACAACTCTGACTGAGAAATTTGCCACCGAAGAGAAACG CTTCGTGGAGTCAAGAGATGTAGTCAT

GACCGACACCAGCATCACAGAGGAGCAGGCAGGGCCTGGAGAGCCTGCTGCGCCTTTCTTCATTTCAAAGCCGGTGGTCCAGAAACTGGTGGAGGGTGGG

AGTGTTGTGTTTGAATGCCAGATCGGCGGCAACCCAAAGCCCCACGTCTACTGGAAAAAATCTGGCGTTCCTCTCACCACTGGATACAG ATACAAAGTG

AGTTATAACAAGCAGACTGGGGAATGCAGACTGGTGATTTCTATGACGTTCGCTGATGATGCTGGAGAATACACTATTGTCATCCGAAACAAGCACGGGG

AGACGTCTGCATCTGCCTCCTTGCTGGAGGAAG CTGATTACGAGGCATTGGTGAAGACTCAGCAAGAAATGCTTTACCAGACACAAATGAGCACATTTA

TTCAAGAACCCAAAGTGGGGGAAATAGCACCTGGATTTGCATATTCTGAATATGAGAAGGAATATGAAAAGGAACAGGCCTTAATTAGGAAGAAAATGGC

CAAAGATACTGTGATGGTCAGGACTTTTGTAGAAGACCAA GAATTCCACATCTCTTCTTTTGAAGAGAGGCTCATTAAAGAGATTGAATACAGAATAAT

AAAGACTACGCTGGAAGAACTTCTTGAGGAGGATGGAGAAGAGAAGATGGCAGTCGACATTTCTGAATCTGAAGCTATCGAGTCAGGATTTGATATAAGG

ATAAAAAATTATAGAATTCTTGAGGGGATGGGTGTCACTTTTCATTGCAAGATGTCTGGATATCCGTTACCCAAG ATTGCGTGGTATAAGGATGGCAAG

CGCATCAGACATGGGGAAAGATATCAAATGGACTTTCTACAAGATGGCAGAGCCAGCCTGCGTATACCTGTTGTCCTTCCAGAGGACGAGGGCATCTATA

CTGCATTTGCCAGCAATATCAAAGGAAATGCGATTTGCTCTGGGAAGCTGTACGTGGAGCCTGCTGCACCATTTAGCGCTCCAACTTACATGCCCACACC

AGAAGCAGTGAGCAGAATCAG GTCTGTCTCTCCACGTTCACTGAGCAGGTCACCTATACGTATGTCTCCTGCGATGTCCCCTGCACGAATGTCCCCCGC

ACGGATGTCCCCTGCACGGATGTCCCCCGCACGGATGTCTCCTGGACGCAGGCTGGAGGAGACAGATGAATCACAGCTGGAGAGACTGTATAAGCCAGTC

TTTGTATTAAAACCTGCTTCTTTCAAATGTTTAGAAGGACAGACTGCCAGATTTGACTTGAAGGTTGTGGGCAGACCCATGCCAGAGACATTCTGGTTTC

ACAATG GACAGCAAATTGTCAATGATTATACGCACAAAGTCGTCATTAAAGAAGATGGAACTCAGTCACTGATCATTGTCCCTGCGTCACCCAGCGATT

CAGGAGAATGGACAGTGGTGGCCCAAAACAGAGCAGGAAAATCCACAATATCTGTGACTTTAACTGTAGAAG CTGTGGAACACCAGATCAAGCCAGCAT

TTGTGGAAAAACTGAAAAATGTCAACATAAAGGAAGGTTCCAGGCTCGAAATGAAAGTCAGAGCTACAGGCAACCCCAACCCTGACATTGTGTGGCTGAA

AAACAGTGACATCATTGTTCCTCATAAATACCCAAGGATCAG GATTGAAGGAACCAGAGGAGAAGCCGCCCTTAAGATTGATTCCATTATCAGCCAAGA

TTCAGCCTGGTATACAGCCACGGCTATTAACAAGGCAGGCCGAGACACCACAAGGTGCAAAGTCAATGTTGAGGTTGAGTTTGCAGAACCTGAACCGGAA

AGAAAGCTGATTATTCCACGAGGAACGTACAGAGCAAAGGAGATTGCTGCCCCAGAACTGGAGCCTCTCCATTTGAGATACGGTCAAGAACAGTGGGAGG

AGGGTGACCTCTATGACAAGGAGAAACAACAGAAACCGTTTTTCAAGAAAAAACTCACTTCCCTCAGACTGAAGCGCTTTGGACCTGCCCACTTTGAGTG

CAGACTCACACCAATTGGTGACCCAACCATGGTGGTGGAGTGGCTTCACGATGGGAAGCCCCTGGAGGCGGCCAACAGGCTTCGGATGATTAATGAATTC

GGCTACTGCAGCCTTGATTATGGAGCAGCGTATTCCAGAGACAGTGGTGTCATCACCTGCAGAGCTACTAACAAATATGGGACAGATCACACCTCTGCTA

CTCTTATTGTCAAAGATGAGAAAAGCCTAGTGGAAGAATCTCAACTGCCTGATGGGAAAAAAGGCTTACAGAGGATAGAAGAACTAGAGAGAATGGCTCA

CGAAGGTGCGCTGACAGGTGTGACAACAGATCAAAAAGAAAAACAAAAGCCAGACATTGTCTTGTTCCCAGAGCCAGTGAGAGTGCTGGAAGGGGAGACA

GCCAGATTCCGCTGCCGAGTGACAGGCTACCCTCAGCCCAAGGTCAACTGGTACCTCAATGGACAGCTCATCCGGAAAAGCAAAAGGTTCAGAGTTCGCT

ATGATGGCATTCACTATCTGGATATTGTGGACTGCAAATCCTATGACACAGGTGAAGTCAAGGTCACTGCGGAAAATCCTGAAGGTGTGACGGAACACAA

AGTAAAACTTGAAATCCAACAGAGGGAGGATTTCAGATCTGTCCTTAGGCGTGCTCCCGAGCCAAAGCCCGAGTTTCATGTACACGAACCGGGGAAACTT

CAGTTCGAAGTGCAGAAGGTAGACAGACCCGTGGACACCAGCGAAACCAAAGAAGTGGTGAAGCTGAAAAGGGCTGAAAGGATTACCCATGAGAAGGTGT

CCGAGGAGTCTGAAGAACTGCGCAGTAAATTTAAGCGCCGGACGGAAGAGGGATACTATGAAGCCATCACAGCCGTGGAGCTGAAGTCTCGCAAGAAGGA

TGAGTCTTACGAAGAGCTCCTCAAGAAAACTAAAGATGAGCTTCTGCACTGGACCAAAGAGTTAACTGAAGAGGAGAAGAAAGCCTTGGCTGAAGAAGGC

AAAATCACGATTCCAACCTTTAAACCTGAGCGAATCGAACTTAGCCCTAGTATGGAGGCACCCAAAATCTTTGAACGAATCCAGAGCCAGACCGTTGGCC

AAGGATCTGATGCTCACTTTAGAGTCAGGGTTGTGGGAAAACCAGACCCTGAGTGTGAATGGTATAAAAATGGTGTAAAAATTGAGCGATCTGACCGAAT

CTACTGGTACTGGCCAGAAGACAATGTTTGTGAACTGGTCATAAGAGATGTAACTGCAGAGGACTCTGCCAGCATCATGGTAAAGGCCATCAACATAGCT

GGGGAAACCTCAAGCCACGCATTCCTGCTCGTCCAAG CCAAGCAACTGATCACTTTTACACAAGAATTGCAAGATGTTGTTGCTAAGGAAAAGGACACC

ATGGCAACATTTGAATGTGAAACTTCAGAACCATTTATCAAAGTAAAATGGTATAAAGATGGTATCGAAGTTCATGCAGGGGATAAGTATAGGATGCACT

CTGACCGAAAAGTTCACTTCCTGTCTGTGCTGACCATCGACACATCTGATGCTGAAGACTACAGCTGTGTACTTGTGGAAGATGAAAATATCAAGACGAC

AGCGAAACTTATTGTGGAAG GTGCAGTAGTTGAATTTGTGAAAGAACTTCAGGACATAGAAGTCCCAGAGTCATACTCAGGAGAGTTAGAGTGCATCAT

ATCTCCAGAAAACATAGAAGGCAAATGGTATCACAATGATGTGGAGTTGAAGTCCAATGGCAAATACTCAATTACATCCCGCCGTGGGCGCCAGAACCTC

ACAGTCAAGGATGTAACCAAAGAGGACCAGGGAGAGTACAGCTTTGTTGTTGATGGGAAAAAGACAACCTGTAAACTGAAGATGAAAC CCCGACCTATT

GCTATTCTCCAAGGACTTAGCGATCAAAAGGTCTGCGAGGGTGACATTGTTCAACTTGAAGTCAAAGTCTCCTTAGAAAATGTAGAAGGTGTCTGGATGA

AAGATGGTCAAGAAGTACAACACAGTGACAGAGTTCACATTGTAATAGACAAGCAGTCCCACATGCTACTTATTGAAGACATGACCAAAGAAGATGCTGG

GAATTACTCCTTCACTATTCCTGCCCTTGGACTCTCCACCAGTGGGAATGTCTCTGTCTATA GTGTTGATGTGATAACACCTCTCAAAGATGTCAATGT

GATTGAAGGTACCAAGGCTGTACTTGAATGCAAGGTCTCAGTTCCCGATGTAACTTCTGTTAAATGGTACCTAAATGATGAACAAATCAAGCCTGATGAT

CGTGTGCAATCCATTGTCAAAGGCACCAAACAGCGACTTGTGATTAACCGAACCCATGCTTCTGATGAAGGACCTTACAAGCTGATGGTTGGCAGGGTGG

AAACCAGCTGTAACCTGTCTGTAGAGA AAATTAAAATTATCAGAGGTCTCCGTGACCTTACCTGCACAGAAACACAAAATGTGGTCTTTGAGGTTGAGC

TATCCCACTCAGGAATTGATGTTGTATGGAATTTTAAGGGCAAGGAAATTAAGCCCAGTTCTAAATATAAAATTGAAGCTCATGGGAAAATATACAAACT

GACAGTCCTCAATATGATGAAAGATGATGAAGGGGAGTATGCATTCTATGCAGGAGAAAATACAACATCTGGAAAGCTAACTGTGGCAG GAGGAGCCAT

CTCCACACCACTCACAGACCAGACTGTGGCTGAATCCCAGGAGGCTGTGTTTGAATGTGAAGTTGCCAACCCTGAGTCTGAGGGGGAATGGCTGAAGGAT

GGAAAGCACTTGGCTCTGAGTAACAACTTCAGAGGTGAATCCGATGGCCACAAAAGGAGGCTTGTCATCGCTGCCGCCAAGTTAGATGACGCTGGAGAAT

ATACCTACAAGGTGGCTACCTCCAAAACATCTGCCAAGCTGAAAGTTGAAG CTGTCAAAATTAAGAAGACCCTGAGGAACCTCACTGTGACAGAGACAC

AGGATGCAGTCTTCTCTGTTGAACTCACACACCCAGATGTCAAAGGGGTCCAGTGGATCAAAAACGGAGTTGTCTTAGATTCCAACGACAAGTATGAGAT

CTCAGTCAAAGGGACACTTTATTCACTGAAGATTAAAAACTGTGCCATGGCAGATGAATCTGTCTACGGCTTCAAACTGGGGAGGCTAGGAGCTAGCGCC

CGGCTGCACGTTGAGA CTGTCAAGATTATTAAGAAACCAAAGGACGTGACCGCCTTGGAAAACGCCACTGTTACCTTCGAAGTCAGTGTTTCCCATGAC

ACGGTGCCAGTAAAATGGTTCCATAAGAACGTGGAGATTAAGCCAAGTGACAAGCACAGACTGGTCTCAGAGAGAAAAGTCCACAAACTCATGCTTCAGA

GCATCTCCCCCTCGGATGCCGGCGAGTACACAGCCATGGTGGGCCAGCTGGAGTGCAAAGCCAAGCTGTTTGTGGAGA CACTCCATATCACAAAGACTA

TGAAAAGTATCGAGGTTCCTGAAACCAAAGCTGCCTCTTTCGAGTGTGAGGTGTCCCACTTCAATGTCCCCTCCATGTGGCTAAAGAACGGAGTGGAAAT

TGAGATGAGTGAAAAATTCAAGATCGTCGTGCAGGGGAAACTGCACCAGCTGATCATCATGAACACGAGCACGGAGGACTCAGCGGAATACACATTTGTT

TGTGGCAATGACCAAGTCAGTGCTACCCTGACAGTGACCC CAATCATGATTACATCCATGCTGAAAGACATCAATGCTGAAGAAAAAGATACCATAACT

TTTGAGGTGACAGTAAACTATGAAGGCATCTCTTACAAATGGTTAAAGAACGGTGTGGAGATCAAGTCGACTGACAGGTGCCAGATGAGAACCAAGAAGC

TCACGCACTCGCTGAACATCAGGAATGTTCACTTTGGAGATGCTGCTGATTATACTTTTGTGGCTGGAAAAGCCACATCGACGGCCACCCTTTATGTGGA

AG CTCGTCATATAGAATTTAGGAAACACATTAAGGATATTAAGGTTCTGGAGAAGAAACGAGCCATGTTTGAATGTGAAGTTTCTGAGCCCGACATAAC

TGTTCAGTGGATGAAAGATGGCCAAGAGCTTCAGATAGCAGACAG GATAAAGATCCAGAAGGAGAAATATGTCCACCGCCTTCTGATCCCATCCACACG

CATGTCTGATGCCGGGAAATATACAGTGGTGGCAGGAGGCAACATGTCAACTGCTAACCTCTTTGTCGAAGGCAGGGATGTCCGCATCCGGAGCATTAAG

AAGGAGGTCCAG GTCATTGAGAAGCAGCGTGCTGTCGTGGAGTTCGAAGTCAATGAGGATGACGTAGACGCCCACTGGTATAAAGATGGCATTGAAATC

AACTTCCAAGTTCAAGAGCGACACCAGTATGTGGTGGAGAGAAGAATTCACCGGATGTTTATATCAGAAACAAGACACAGTGACGCAGGCGAATACACCT

TTGTGGCAGGCAGAAACAGGAGTTCTGTGACTCTTTATGTCAATG CTCCAGAACCACCCCAAGTCCTGCAGGAACTCCAGCCTGTCACTGTACAGTCCG

GCAAGCCGGCTCGCTTCTGCGCCGTGATATCAGGCAGACCGCAGCCCAAAATTTCCTGGTACAAGGAGGAGCAGCTGCTTTCCACTGGCTTCAAGTGCAA

ATTTCTGCACGACGGGCAGGAGTACACACTTCTGCTCATTGAGGCTTTCCCAGAGGATGCGGCAGTCTACACCTGTGAAGCCAAGAATGACTACGGAGTA

GCCACAACGTCGGCTTCTCTGTCCGTGGAAG TTCCAGAAGTTGTATCTCCGGATCAGGAAATGCCAGTCTACCCGCCTGCCATAGTCACTCCACTTCAG

GACACAGTTACTTCTGAGGGGCGCCCAGCGCGTTTCCAGTGCCAAGTTTCAGGGACAG ATTTGAAGGTGTCTTGGTACTGCAAAGACAAGAAAATCAAA

CCATCTCGGTTCTTCAGGATGACCCAGTTTGAAGACACCTACCAGCTGGAGATCGCTGAAGCCTACCCCGAGGACGAGGGAACGTATGCCTTTGTTGCTA

ATAATGCTGTGGGCCAAGTGTCCAGCACTGCCACCCTGAGGCTGGAAG CCCCCGAGTCGATTCTGCATGAGAGGATCGGCCAGCAAATCGAAATGGAGA

TGAAAG AAGAACTCTTTGAGGGGGAAGCTGATGGCTCAGGAGATGCAAGAGGAGCCTTCTCTGACTCGGAAGACATAGACCACCACTCCCTGATGGCCA

GGAGATATGCAAATAGAACGTCATCTACAAGCTCCTGGCCTGAATATTTCAAGCCGACTTTTACTCAAAAACTCACATTTCAATATGCTTTAGAGGGTGA

ACCTATTGTGTTTACATGCAGCCTGGTTGCCTACCCAACTCCAGAAATGACTTGGTTTCATAATAACAGGCCGATCCCAACAGGTCTCCGTCGGGTCGTA

AGAACCGAGACTGACTTACACCAACACTCTTCCAGCTTAGAGGTGAAAAGGGTCCAAGGCCGAGATTCGGGCAGTTACAGGTTCTTGGCGGTTAATAGTG

AGGGGTCTGCCGAGTCCAGTGCATCACTGCATGTTATCCAGAAAGGGCAAGATGAGAGATACTTAGAATTTCTGAAAAGGGCAGAGCAGACATGGGAAAA

CACGCGGGGTCTAGGTGAAAGGAGAGAAGAGAGGATAAAGGTTGGCCTGAGGTTTACTGGCTCCCCCTTTAACAAAAAGCAAGATGTGGAAGAGAAGGGA

ATGGTGAGAACCATACACTTTAGGTCAGCGAGCCCTGTCAGGAGGGCAGACTATGTGTACAATGACGAGTGGTCAGAAAGCAAATTTGATATCAGAGGAT

GCCTGAGCGTAGGTGAGAGTTTCCTAGATGAGGAAACCAAAATGAAATTGCAGCGGTTACGGGAGGCAAGAAAAATCTTCTTAGAGAAAAAGAAATTATC

GCTTTTAGAAGCGTCGTCTGAAGTAAACTCGGTGACTGTGAGAAGTGAGGATATTGTTGGAGATGCTCCACTCTCTAGAGAGGAAGGGAAGCGTGGGTTT

GGACGCGAGTTTGCTGAAGACAGACATAGGGTCGATAACTCAGCAGAAGGAGTCATCGAGAATCCGTATTCCGTTCCAAATCAAATACATCAAAACAGAG

AACCTCCTTCAAGTGTCCGAGCCACTGGTGATGAAGATCTCCAGACGGAAAATAGCCCGGACCAAGAGACCTTTCTAGAAGAAAGCCTCCAGAAAGGCTA

TTTGTGTGAGCATGTCCTAGTAGGTGAAAACCTGCAAGCCGTGGAGTGGTTTGAAGAGTCTGTGACCAGCACTGTGATCAGAGAACCATTGCCATTCACC

TCTAATGAGGAAGTGCATGGATATAAGAGTAGAGGAATATGTGAATCTCCTGATAAGGTGTCTCAGGTTCTTACACCATATCCTAGTGAGTCCTTGGATA

CATTTGTTGATGCTAAAGAGACCGAAGATGTAGATAGTGGAGGAGGAACACAGAGGGGTTGGCAAGAGGGGCAGTGCCACGCTTCCACCAAAGTGGAAGA

ATTCAAAGTGGAGCATGAGGAGAAAACACGGTCTTTCGAAAATTACTTCCAAAAACATCCACAACGTTGCCCACCTTCATTTCTCCAGGATATTGAATCA

CAAGAAGTTTATGAAGGTGACAGCTGTAAATTTGTGTGTCACTTTCAAGGATACCCTCAGCCCATTGTGACCTGGTATAACAATGAGATGCCCGTACCGC

GTAGTCAAGGTTTTACCACTCATACATTCGAGAACTACTCAACGTTAACCTTTCCTTCTGTTCAGCCCCAGCATGGAGGCTCTGTTACCTGTGTGCTGTT

TAACCAGTATGGAACAGTTAAAGCAACCAGTATGCTTAGAGTGAAGGCAAAACCAAGGTATGAGTCCCAGCCTCATAAGGTCCCAGTGTGGCCTGACTAC

GCAGATGAAGAAGAGGAGCTGGCCTTGGTGTTTGACCAGGCAAGAAGGATTCACCCATCTTTTAGTCAAGAGAGGCAAGAACATCTCCATATGTTAAAAG

CTCACCTCCCAGAACTCCCCTCTGCAGACAGAGAGCTGCTCTCCTTCCCTGTAGAAATTCAGATAACTGCAGCCACTCCAACCCCAGAGCAGAACAAAGA

ATGCAGGGAACTGTTTGAGTTGGAGCCTGAAGTAACACCTCGAGATCAAGCCATCCAGTCACCAAAACACAAATTTATCTTCTCCTCTGATATTACCAAT

GAGCCGCCAAAGATGCTACAGGAAATGCCAAGGAGTGCCAGTTGTAGGGAAGGGAATTCTGTAATGCTTGAATGTTTAATATCAGGGGAGCCTCAGCCAG

TGGTCATGTGGTTTCATAATGGAGTTCTCGTAAAGCCGAACCAAAGGTTTGAGATGGAAGAAGTTAATTGTAGCTACAGATTATATATCAATGATGCCAG

TTCACAAGACTCTGGAAGGTATCAGTGTGTGGCTCAAAATGACTCAGGCATAGCTGAGAGTATTTTAGATTTAACTGTAGAACCCATCACTTATAGGGAA

TATAGTCAGTTGGAAAATGAAAGCAGAATTTATGCACAGTATTCCAAAAATCAACAAACACAAGTTCAGGGGGAACCTGTAAGGACACATTTTTATGATC

ATACAGTTAGTCCTTTTGCTGCCCAATCAAATATAAAAGAATATACTATAAGGGAGTATTTTCAAAGCCTTGAGACAGTTGGGGAGTTGGAAAAGAAAAA

TGAGGTATACTGTCCAACTACTGTTGAAAAACTATCCAAGTCTATGCAGCATGCTTCTAGACCCACAGACATCGAGAAGCCTCACAGAATGGAGTTTCTA

CAATGCCAAGATGAGGAACATATAGGTGAGAGGTCTCAGTCACTCCAAGCAGGGGCTACCATTTGTCCATTTGTTGATGACTTCAGCAAAGCTAACATTA

GAAACAAAGTCAGCGATGATGTTGGATATCATGGACCGGACTGGGGAAATATGAAAGGACATTCTCAAAGTGATTATGTGCTAAATATCCACTCCAAGAG

AACCTCTAACACAGTTCAGGACGTGGAAGACTCACCTGTCCCTACCTATGAAGAAGCCCTTGAAGAAGAAAGGTACTACCCCGGGAAAAAGGTGAGGCAT

AAGGTCATTGCGTTCGAAAAGCTGCAGCGTGCAGAAAGGGGAGTTGTAGAAAAGAGACGGACCAAGAAATCCTTTGTTACAGCACCACAAAAGAAATGGG

ATAATCGAGAGTTTTCATTAACACAAAATGAACCAGGCTCGAGCAATATGTATCGGGCAGAGGAAGTGGCTTCACACACAGAAGCAGATTCCTCTAACAT

CATAATGGATTTGAAGCAGCTTTCCTCTCAAGCTCACGAGGAGTTTGAAATAGAAGAGAGGGGACGACAGGAAGAAATACTTCCCCTAGACCAAGAAAAG

TTTGAGCTCGAAGCACCTGTTACATTTGACCTAAAGCAGTTTCACTCACAGATTGAAAGTACAGGCATGAATTTCCAAGGTTTGGCCAATGGCCAACAAG

ATAAAAGCTCTTTAAAAACTCAACAACCTGCTTCAGAAATGGCTAATCCTGAAGATGTTGTCTTTGATCTAAAGCAAATGTATTCTCACATAGAAGATCC

AGGCGAGGTGTTCCAGGGCCAAGAAACTGAAAGCAAGCAGGAAACATGCCACAAAGAAGAGATTTCTATCTACCAAAGCTTTCAATATGCCCAGGAAGAA

AACACAGCAATTTTAAAACCTGATCATGTGCCTGAGTCGTTTTCTGAAGTGATCCATGGTGAAGCACGGGCTTTGTTTCAGACTCCATCTGCTGATGTGG

AAGAAGCTAACGTTTCTGAGACAGGTGCTTCTGTAGAAAATGGAGATAAGACTTTCATTTCACAGTTGAAAAGGGCAGCCAGTGAAGAAGAGTGTTTGGA

GGATCATGAAATGGAGGACGGACCCACCTTGAAACCAGCATTTGGTATGACTCAGGGGTATGAAGGAACTCTAGAAAACCCCAGAGGTGCTGTTCATGGA

GCAGAAGTGCCTCACAGACGGCTGTCTCTGAGTCAGGACTTGCCATTCTTGATGACTGGAGAGCAGCAGGACCTAAAGGAACAGTTGAGTGAATCAATTG

AGGCCTCAGGAGAGGAAACCTATCATGAAGTTCACGTACCAAGTGAAAGCTCTTTCTCCACCATGGAAGGAGAAAAGATAGAAAAGAGTTTGCTTGAAAA

TCTCCCTCGATTGGAGGAGGCCCAAACCACTAAAGAGGGAGAATATGAGACCTCTCTAACACAGTACTTACTTGCTGAGGGAAGGTATGAGGTGCCTGAA

GTTAGAGACACCAAACACAAGGCACAACTTGTTCAGAGCGACTCAACCACTTCAATGGAGGTTGAAGAAGTAACTTTCAACACCGTGTATGAATATTACA

ACCAGAAACAGGAATCCGTAGGGCGACCCTATTCTCCTGAGTCTGATATTTCCATTGATGTGGGAAGTACAAGCAGCGAAGATCTGTCTGAGTTGGATCA

GTTCTATAGCCCACCATCATCTGTAGAAAATTTAGAATCTCCAAAGTCTCCTGATTTATATTTTAAGCCTTCAGATAGAATTGAGCAACCTGTAGCAAAT

TCAAGAGCTGAGGAAAATGGGGAAAGATACTCAACACCTTCTGAAGGTGAAATACCAGAAAGATACTCCACACCCTCAGGGGAGGCTCTGGAGAGATACT

CCACTCCTCCAGGGGAGGCTCTGGAGAGATACTCCACTCCTCCAGGGGAGGCTCTGGAGAGATATTCCACTCCTCCAGGGGAGGCTCTGGAGAGATTTTC

TACACCCCCAGGGGAGGCTCTGGAGAGATTTTCCACTCCCCCAGGGGAGGCTCTGGAGAGATATTCCACTCCCCCAGGGGAGGCTCTGGAGAGATTTTCC

ACTCCCCCAGGTGAGAAACTAGAGAGAGGTTTTATTCCCACTAGAGGACCAAACCATGCTAGAAATGTAAGCAGGAACCTGTCAGAGCTAGAGAGGGAAG

ACAGCACTGCGAATGAGCATTTCCATACACCTACGGACGAGAGGAGCTCACCTTATGAAACATGGCGTTCAGACTCATTCGGCACACCCAATGAAGCCAT

CGAACCCAAAGACAATGAAATGCCTCCATCTTTCATCGAGCCTCTAAGTAGAAGGAAGATATACGAAAATACAACATTAGGCTTCATCATTGAAGTTGAG

GGTCTTCCGGTTCCCGGTGTGAAATGGTATCGAAATAAATCTTTGCTGGAGCCAGATGACAGGATCAAAATGGAAAGGGTGGGCAATGTGTGTTCTCTGG

AAATTGCCAACATTCAAAAAGGAGACGGAGGAGAGTACCTGTGCCATGCGGTAAACATCATAGGGGAGGCAAAGAGCTTTGCAATTGTAGACGTCATCCC

CCAAGAGGAAAGAGCTGTGGCCCTGCCGCCACCAGTAACCCACCAACACATCATGGAGTTTGACGTGGCAAACAGCAACTCGTCGAGAACACCTTCGCCT

CAAGAGATTGTCCTGGAAGTGGAACTAAGTGAAAAGGATGTGAAGGAATTTGAAAAGCAGGTGAAAATAGTCACAGTTCCTGAATTCACTCCTGATCATA

AAAGCATGATTGTGAGCTTAGATATTCTCCCGCTGAGTTTAGTCGATCCCAGTGCGGAGTCCCAAGGGCAAGAAGGCAGAGAGTTTAAGATCGATTTGGA

AGCCTTCGAAATGCCTCCTCGCTTCATAACACCCATCTGCGACTTTAGAATTCCAGAAAATTCCAGCGCTGTGTTCAAATGTTCAGTTATAGGCATTCCT

CCCCCAGAAGTCAGATGGTATAAGGAGTACATGTGCATTGAGCCAGACGACACAAAGTATGTGATTAGCGAGGAGAAAGGAAGTCACAGCCTTAGAATCC

AAGATGTTGGCCCTTCCGACTGTGCGACATACAGATGCAGAGCTCTGAATAGCGCAGGAGAGGCCATCTGCCGAGGCTTCCTCACCATGGGAGACTCCCA

AGTCTCTGCTGTGGCCACCAGGACAAGCAAAGTGACTTTAAGCAGTCAGAAGGAGGAGCTAGTCTTAAGGAGCAGATACGCAGACAGCTTTTTTGAATTC

CAGGTGGTGGATGGCCCTCCCAGGTTCATCAAAGGCATTTCAGATTGCCACGCACCCTTAGGGACAGCGGCATATTTCCAGTGTTTAGTCCGTGGTTCAC

CGAGACCCACCGTTTCTTGGTACAAAGATGGGAAACTGGTCCAAGGATCACGGTTCAGTGCTGAGGAAAGTGGCATAGGGTTCCACAATTTGTTCATAAC

AGGCTTAGTTAAAGGTGACGAGGGGGAATACAGCTGTGTAGCTACAAACAACTCGGGAATGGCTAGGAGCTCAGCTATCCTCACCCTCTCTTAA
Translation
 MTTQAPMFTQPLQSVVVLEGSTATFEAHVSG GSPVPEVSWFRDGQVISTSTLPGVQISFSDGRARLMIPAVTKANSGRYSLRATNGSGQATSTAELLV

TA AETAPPNFSQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELVVQG

 GEEVVPAKKTKTIVSTAQISETRQTRIEK KIEAHFDARSIATVEMVIDGATGQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPV

RHVRAPTPSPVR RSVSPAGRISTSPIRSVKSPLLIRKTQTTTMATGPEVPPPWKQEGYVASSTEAEMRETTMTSSTQIRREERWEGRYGVQEQVTISGA

AAAAASASVSSSFTAGAITTGTKE VKQETDKSAAVATVVAAVDMARVREPAISAVEQTAQRTTTTAVHIQPAQEQ ARKEAEKTAVTKVVVAADKAKEQ

ELKSRTREVMVTTQEQTHISHEQ IRKETEKAFVPKVVISATKAKEQETRITGEITTKQEQKRITQET MMKETRKTVVPKVIVATPKIKEQDLVSRSRE

AITTKRDQVQITQEK KRKEVETTALSTIAVATAKAKEQETVLRSREAMATRQEHIQVTHGQ VGVGKKAEAVATVVAAVDQARVREPREPTHVEESHSQ

QTTLEYGYKEHISTTKVPEQPRRPASEPHVVPQAVKPAVIQAPSETHIKTTDQMGMHISSQ VKKTTDISTERLVHVDKRPRTASPHFTVSKISVPKTEH

GYE ASIAGSAIATLQKELSATSSTQKITKSVKAPTVKPGETRVRAEPTPSPQFPFADMPPPDTYKSQAGIEVKKEVGVSISGSTVREEHFEVLRGREAK

 VTETARVPAPAEVPVTPPTLVS GLKNVTVIEGESVTLECHISGYPSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGT

VSTSCYLAVQV VSEEFDKETTLTEKFATEEKR RFVESRDVVMTDTSITEEQAGPGEPAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSGV

PLTTGYR RYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEA ADYEALVKTQQEMLYQTQMSTFIQEPKVGEIAPGFAYSEYEK

EYEKEQALIRKKMAKDTVMVRTFVEDQ EFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAIESGFDIRIKNYRILEGMGVTFHCKMS

GYPLPK IAWYKDGKRIRHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPFSAPTYMPTPEAVSRIR RSVSPRSLSR

SPIRMSPAMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPASFKCLEGQTARFDLKVVGRPMPETFWFHNG GQQIVNDYTHKVV

IKEDGTQSLIIVPASPSDSGEWTVVAQNRAGKSTISVTLTVEA AVEHQIKPAFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRI

R RIEGTRGEAALKIDSIISQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQK

PFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSATLIVKDEKSLVE

ESQLPDGKKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDC

KSYDTGEVKVTAENPEGVTEHKVKLEIQQREDFRSVLRRAPEPKPEFHVHEPGKLQFEVQKVDRPVDTSETKEVVKLKRAERITHEKVSEESEELRSKFK

RRTEEGYYEAITAVELKSRKKDESYEELLKKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPERIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVV

GKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQA AKQLITFTQELQDVVAKEKDTMATFECETSE

PFIKVKWYKDGIEVHAGDKYRMHSDRKVHFLSVLTIDTSDAEDYSCVLVEDENIKTTAKLIVEG GAVVEFVKELQDIEVPESYSGELECIISPENIEGK

WYHNDVELKSNGKYSITSRRGRQNLTVKDVTKEDQGEYSFVVDGKKTTCKLKMKP PRPIAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWMKDGQEVQ

HSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGNVSVYS SVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQSI

VKGTKQRLVINRTHASDEGPYKLMVGRVETSCNLSVEK KIKIIRGLRDLTCTETQNVVFEVELSHSGIDVVWNFKGKEIKPSSKYKIEAHGKIYKLTVL

NMMKDDEGEYAFYAGENTTSGKLTVAG GGAISTPLTDQTVAESQEAVFECEVANPESEGEWLKDGKHLALSNNFRGESDGHKRRLVIAAAKLDDAGEYT

YKVATSKTSAKLKVEA AVKIKKTLRNLTVTETQDAVFSVELTHPDVKGVQWIKNGVVLDSNDKYEISVKGTLYSLKIKNCAMADESVYGFKLGRLGASA

RLHVET TVKIIKKPKDVTALENATVTFEVSVSHDTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQSISPSDAGEYTAMVGQLECKAKLFVET TLHI

TKTMKSIEVPETKAASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTP PIMITSMLKDINAEE

KDTITFEVTVNYEGISYKWLKNGVEIKSTDRCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEA ARHIEFRKHIKDIKVLEKKRAMFECE

VSEPDITVQWMKDGQELQIADR RIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNMSTANLFVEGRDVRIRSIKKEVQ VIEKQRAVVEFEVNEDDVDA

HWYKDGIEINFQVQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSVTLYVNA APEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKE

EQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEV VPEVVSPDQEMPVYPPAIVTPLQDTVTSEGRPARFQCQVSGTD 

DLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYAFVANNAVGQVSSTATLRLEA APESILHERIGQQIEMEMKE EELFEGEADGSGDA

RGAFSDSEDIDHHSLMARRYANRTSSTSSWPEYFKPTFTQKLTFQYALEGEPIVFTCSLVAYPTPEMTWFHNNRPIPTGLRRVVRTETDLHQHSSSLEVK

RVQGRDSGSYRFLAVNSEGSAESSASLHVIQKGQDERYLEFLKRAEQTWENTRGLGERREERIKVGLRFTGSPFNKKQDVEEKGMVRTIHFRSASPVRRA

DYVYNDEWSESKFDIRGCLSVGESFLDEETKMKLQRLREARKIFLEKKKLSLLEASSEVNSVTVRSEDIVGDAPLSREEGKRGFGREFAEDRHRVDNSAE

GVIENPYSVPNQIHQNREPPSSVRATGDEDLQTENSPDQETFLEESLQKGYLCEHVLVGENLQAVEWFEESVTSTVIREPLPFTSNEEVHGYKSRGICES

PDKVSQVLTPYPSESLDTFVDAKETEDVDSGGGTQRGWQEGQCHASTKVEEFKVEHEEKTRSFENYFQKHPQRCPPSFLQDIESQEVYEGDSCKFVCHFQ

GYPQPIVTWYNNEMPVPRSQGFTTHTFENYSTLTFPSVQPQHGGSVTCVLFNQYGTVKATSMLRVKAKPRYESQPHKVPVWPDYADEEEELALVFDQARR

IHPSFSQERQEHLHMLKAHLPELPSADRELLSFPVEIQITAATPTPEQNKECRELFELEPEVTPRDQAIQSPKHKFIFSSDITNEPPKMLQEMPRSASCR

EGNSVMLECLISGEPQPVVMWFHNGVLVKPNQRFEMEEVNCSYRLYINDASSQDSGRYQCVAQNDSGIAESILDLTVEPITYREYSQLENESRIYAQYSK

NQQTQVQGEPVRTHFYDHTVSPFAAQSNIKEYTIREYFQSLETVGELEKKNEVYCPTTVEKLSKSMQHASRPTDIEKPHRMEFLQCQDEEHIGERSQSLQ

AGATICPFVDDFSKANIRNKVSDDVGYHGPDWGNMKGHSQSDYVLNIHSKRTSNTVQDVEDSPVPTYEEALEEERYYPGKKVRHKVIAFEKLQRAERGVV

EKRRTKKSFVTAPQKKWDNREFSLTQNEPGSSNMYRAEEVASHTEADSSNIIMDLKQLSSQAHEEFEIEERGRQEEILPLDQEKFELEAPVTFDLKQFHS

QIESTGMNFQGLANGQQDKSSLKTQQPASEMANPEDVVFDLKQMYSHIEDPGEVFQGQETESKQETCHKEEISIYQSFQYAQEENTAILKPDHVPESFSE

VIHGEARALFQTPSADVEEANVSETGASVENGDKTFISQLKRAASEEECLEDHEMEDGPTLKPAFGMTQGYEGTLENPRGAVHGAEVPHRRLSLSQDLPF

LMTGEQQDLKEQLSESIEASGEETYHEVHVPSESSFSTMEGEKIEKSLLENLPRLEEAQTTKEGEYETSLTQYLLAEGRYEVPEVRDTKHKAQLVQSDST

TSMEVEEVTFNTVYEYYNQKQESVGRPYSPESDISIDVGSTSSEDLSELDQFYSPPSSVENLESPKSPDLYFKPSDRIEQPVANSRAEENGERYSTPSEG

EIPERYSTPSGEALERYSTPPGEALERYSTPPGEALERYSTPPGEALERFSTPPGEALERFSTPPGEALERYSTPPGEALERFSTPPGEKLERGFIPTRG

PNHARNVSRNLSELEREDSTANEHFHTPTDERSSPYETWRSDSFGTPNEAIEPKDNEMPPSFIEPLSRRKIYENTTLGFIIEVEGLPVPGVKWYRNKSLL

EPDDRIKMERVGNVCSLEIANIQKGDGGEYLCHAVNIIGEAKSFAIVDVIPQEERAVALPPPVTHQHIMEFDVANSNSSRTPSPQEIVLEVELSEKDVKE

FEKQVKIVTVPEFTPDHKSMIVSLDILPLSLVDPSAESQGQEGREFKIDLEAFEMPPRFITPICDFRIPENSSAVFKCSVIGIPPPEVRWYKEYMCIEPD

DTKYVISEEKGSHSLRIQDVGPSDCATYRCRALNSAGEAICRGFLTMGDSQVSAVATRTSKVTLSSQKEELVLRSRYADSFFEFQVVDGPPRFIKGISDC

HAPLGTAAYFQCLVRGSPRPTVSWYKDGKLVQGSRFSAEESGIGFHNLFITGLVKGDEGEYSCVATNNSGMARSSAILTLS

For any suggestions or comments, please send an email to unitrap@crg.es