Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000051998 (Lax1)
Chromosomal location
Chr 1: 135575677 - 135586593 (-)
Description
lymphocyte transmembrane adaptor 1 Gene [Source:MGI Symbol;Acc:MGI:2443362]
RefSeq_dna
NM_172842 
RefSeq_peptide
NP_766430.2 
UniGene
Mm.36534 
MGI
MGI:2443362 
Uniprot/SWISSPROT
Q8BHB3 
Human Ortholog
ENSG00000122188 (LAX1)
Omim not available
UniTrap UNI17748
Vector Insertion
Chr 1: 135585582 - 135586391
Public Clones not available
Private Clones OST437078 (lexicon) OST318829 (lexicon) OST180153 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000063620
Sequence
CTCTTGACAGTCGCCTCCCTACTCCCCCACAGGCCCCTCATGTTTCCATCAACTGGCAGAAACTAGAGAGTGGCCCTACTGCTTCACACTGGGAGCACAG

ACAGCTGGGTGAGAAAGAGCACGGCTCCTGCAGTGGGCATTGTGGCCACCTCCAGTAGACCAACTCTGATGAACCTTCTACCAACTCAGCCTGGAATTTC

AG - UNI17748 - CAACTTAGAAAGAGCTAAGAAAAGTGGAAGCCATACTGGCTAGTCAGTCACGACACTGAAAAGGCTTAGAAGCTGCAAAGCCCC

TCAGAGGTCCAGTGATGTACAGCACCCCGGCCCCTCCAGAGGTCACAAGAAGGAACTCAGAGCCCAGCACTCGGCAGGGGACTCTTGGCAGCCTGCAGGG

 AGAGAAAGGCCAGATCATCTTCCCTGGCTTTGTCGTGCTCCTGACCATCATCCTGGTCATCATAGCTGCCTGTATCCTGTGGAGCTGGAAGAAACAGAA

GAAGC GGCCTGTTCCTTACTTCCAAGTAGCTCCATCGTTGACTCTGCCTCCACCCAGACATCGAGCCAAAAATATTTATGACTTCTTGCCCCGGCAGCA

GACAGAGCTGG GGAGACATCAGTTGAGTGGTTTCAGTACCGAGAGCCTCCTCTCCAGAGCATCTGACAGCCCTGAGCCTGAG GCCCCCCAAGCCAATG

GTTCCCTTCAGATGCATAGAGTGTCCGTTCATACTGTGGAGTATTCAGTAAACATCTATGACAATGGCACAGTGCCCCAGATGTGCAGGCACCTGGCCTC

CTCAACACATCATGTCTGTGTCAGAACTTCCAGAAGTAACCCCAGCATTTCTTCCAAGGAGTCAAATGATTATGTCAATATCCCCACAGTAGAGGACACC

TGTGAGACTCTAACTCGCATAGAAAGCACTCCTGAAAATCACCTTGGTCTTCCAAGTGCCCTGCGGCTGGAGTTTGCTGAAGGAGGGCATGCAGGCTGTG

GGAATGCCACGGACCACGATGGTTTTTGGGCTCCAGGACCCAAGTGCAGTGATTCACTCAGCGACGGAGACGATTTATCTCAGACTTCAAATGACTACGT

CAATATGACAGGGTTGGATCTTGAGAACATCCAAGAGAATCGACCCAGGGGAGCTTTTCAGTGCTGCAGAGATTATGAAAATGTCCCATGGGTAGATACC

AATGAGAGCCAGCTGCCGACTCTGGAAGAAGTGGCATCGTCAACTGTAGACCACAGGGAACCTGTCTGGAGGACCCTCTCTTCAGTGTATCATATGGCAT

TTCAGCCGTCGGCACAGAGTGAGGACAGTGCCATGGTCCATAGAGAAGAGCAGTCAAGCGAAGACTCCAGTGACTATGAGACTGTGCTGGTTGCTGAGTT

AGAAGGCAGGGACTGGAAGCAGGGACCTGGTACTCAGCATCCTTCTGATGAAGGAACACCAGGCGACCTAGCTGGAAAGCTCTGTGAGGTGGTCTACCCT

GCTGGGTCTTTAGCCACCGAAACATCTGATGAAGATGCCTGAATGCCCTAGCATCTCGGGACTCACTTGCTGAGGGGAAGGAGGCCAAGAGGAACTGGGC

ACTAGCAGGCTTCCCCAAAGCAAAAGTTTAGGAAGTCCAGAGAATCCTTCCTGAGCAAGATTGCTGTTAGCTCTCAGGCCAACTGAAGAAAGTTAGCGAC

ACTATGTTATGGGGATGTTGGGGATAAAAAGGCACATAGCACTTAGAGTGGAAGCATGACGTGATAGAAAGTAATCAGGGTCACAAACTCCAGCTGGCTA

CCAAGCAGCTGTGGCCCCGGGCAGGCCAAAAGGAGGATCAGGCTGGGGTAGTGGGAGATTTCCAGCTTGAGAAGAGCTGGTGAGGGTGTAGAACGACAGG

AGCCCTGTTGATGCTGGTGGATTACAGATCAGATACCTGCCGTTGGAGCCGTCCATCTCACCCTTAGGATGTGAAACTACTTTCAATGTGTACAAATAAG

TTAGTCTATTGTAGATAAGGAGGGGCAGGTTCCCTTTAAGCTGTTTTTACTTTATTAACCTGAGTGATATATGGTCACTTTCTTTTTTTTTAAACTTTTG

ATTCTCTGTGAATTTCACATCATGTACCCCAATCTCATTCATCTCCCCATGCCTTTCTATCTGCCCTCCACCCTTGCAATCTCCCTCAGCAAAAGAAAAT

AAAAATAAATTAATTAAATT
Translation
 - UNI17748 - MYSTPAPPEVTRRNSEPSTRQGTLGSLQG GEKGQIIFPGFVVLLTIILVIIAACILWSWKKQKKR RPVPYFQVAPSLTLPPPRH

RAKNIYDFLPRQQTELG GRHQLSGFSTESLLSRASDSPEPE APQANGSLQMHRVSVHTVEYSVNIYDNGTVPQMCRHLASSTHHVCVRTSRSNPSISS

KESNDYVNIPTVEDTCETLTRIESTPENHLGLPSALRLEFAEGGHAGCGNATDHDGFWAPGPKCSDSLSDGDDLSQTSNDYVNMTGLDLENIQENRPRGA

FQCCRDYENVPWVDTNESQLPTLEEVASSTVDHREPVWRTLSSVYHMAFQPSAQSEDSAMVHREEQSSEDSSDYETVLVAELEGRDWKQGPGTQHPSDEG

TPGDLAGKLCEVVYPAGSLATETSDEDA

For any suggestions or comments, please send an email to unitrap@crg.es