Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052142 (A430107D22Rik)
Chromosomal location
Chr 17: 32527743 - 32540503 (-)
Description
RIKEN cDNA A430107D22 gene Gene [Source:MGI Symbol;Acc:MGI:2444128]
RefSeq_dna
NM_178785 
RefSeq_peptide
NP_848900.2 
UniGene
Mm.122284 Mm.463286 
MGI
MGI:2444128 
Uniprot/SWISSPROT
Q8C2K5 
Uniprot/SPTREMBL
Q8CAS7 
Human Ortholog
ENSG00000105122 (AC011492.8)
Omim not available
UniTrap UNI28486
Vector Insertion
Chr 17: 32528181 - 32528280
Public Clones CMHD-GT_467C8-3 (cmhd)
Private Clones OST29901 (lexicon) OST18822 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000063824
Sequence
CAGACGGCTGCTGGTTCTGGACTGGCCAGGAAATCAAGGTAAGGGAGGGTGTACGTGTGGCATCCTCAAGTATGTTCCTGGAGGCGAAGCTGAGAAGAGA

CCAGGGAAGATGAAGCCAGAATGTGGGCAGACAATGTTCAGAACCTTTTGGTCTCGCAGCAGAGACTCCTCCGCCATGGACCCACCGTTGCAGAGTGAAG

AAGATTCCCAAACGCAGCCCTCGCTGCCCTCTCCGCTGACATCCTACCGCTGGCACACTGGAGGCAGTGGGGAAAAGGCTGCTGGAGGGTTCCGCTGGGG

CCGCTTTGCAGGCTGGGGAAGGGCCCTGAGCCATCAGGAGCCCATGGTGAACAGCCAGCCAGCCCCCAGATCTCTGTTTCGTCGGGTCCTCTCTGCACCC

CCTAAGGAGTCACGGTCCAATCGCCTCCGGTTTTCCAAGACCCTGTGGGGAAGGCACAAGAACGTGGCACCACTGGAACCCAAGCCAAATCCGAAGGCCC

CAG AGCCAGAGCTGGAGTTGGTAGCAGACCCAGATCTACCCGTTGCACAGATCCCTGAGCCTCCCACCCCGGACATGCCTGTTTGGAACATTGATGGCT

TTACCCTTCTCGAAGGAAAGCTGGTGATGCTCGGTGAGGAGGAG GGTCCTCGCCAAATCCGAGTGGGAAGCGCCAGTTCAGAGAACAGCATGCAGGCAG

CTTTGGGGAACCTCAAGGATGCAG TTCGGACCCCTGGAAAAACTGAGCCGGAAGCTGCTGGTTCCAACCAGGTCCACAATGTTCGG AAGTTACTCAAG

AGGCTGAAGGAGAAGAAAAGAGCCAAGTCAGAACTGGGAGCCTACACCCCTCGAGATGG ACCTCCCAGTGCCCTCGGTTCCAGAGAATCGCTGGCCACA

CTCTCTGAGCTGGACCTAGGTGCTGAGAGGGACGTGAGAGTCTGGCCACTGCATCCTAGCCTCTTGGGGGAGCCCTACTGCTTCCAG GTAACCTGGGCA

GGTGGGAGCCTCTGTTTCTCATGTCGCTCGAGCGCTGAGAGAGACCGTTGGATTGAGGACCTTCGTCGGCAGTTCCAGCCGAGCCAG GACAACGTGGAG

CGGCAAGAGATGTGGCTGACGGTGTGGGTGCACGAGGCCAAAGGGCTACCCCGAGCAACTGTACCCGGAGTGCGTGCGGAGCTGTGGTTGGATGGCGCGC

TATTGGCGCGCACTGCCCCCCGTGCCGGCCCAGGCCAACTCTTCTGGGCTGAACGCTTCCACTTCGAGGCGTTGCCACCTGCCCGTCGCCTGTCGCTGCG

GTTGCGCAGCGCAGGCCCGGCAGGGGCAACCGTGGGCAGGGTGGTGCTGGAGCTGGACGAGGTGAGCATCCCCCGCGCGCCTGCCGCGGGCCTAGAGCGC

TGGTTCCCGGTGCTTGGGGCGCCGGCAGGTGCGGTGCTACGAGCGCGGATCAGGGTGCGTTGTCTGCGCGTGCTGCCGTCGGAGCGCTATAAGGAGCTGG

CCGAGTTCCTCACCTTCCACTACGCGCGCCTGTGCGGGGCGCTGGAGCCGGCGCTGTCTGCTCAGGCCAAAGAGGAGCTGGCAGCAGCCATGGTGCGCGT

GCTACGAGCCACTGGCCGAGCGCAG GCATTGGTGACAGACCTAGGAACCGCAGAGCTGGCACGCTGTGGAGGCCGTGAAGCACTGCTATTCCGAGAAAA

TACCTTAGCCACAAAGGCCATTGATGAATACATGAAACTGGTGGCACAGGAGTACCTCCAGGACACCCTGG GGCAGGTTGTGCGGTGTCTCTGTGCCTC

CACTGAGGACTGTGAAGTGGACCCCAGCAAGTGCCCAACACCAGAGCTGCCAAAACACCAAGCTAGACTGCGAGACAGCTGTGAGGAGGTTTTTGAAAAC

ATCATCCATTCTTACAA CTGTTTCCCAGCAGAGCTGGGCTCCGTGTTCTCAAGTTGGCGTGAAGCATGCAAAGCACGAGGCTCTGAGGCCCTGGGCCCC

CGGCTGGTGTGTGCTTCCCTCTTCCTGAGGCTTTTATGCCCTGCCATCTTGGCACCTAGCCTCTTTGGCCTGGCACCAGAGCACCCAGCCCCAGGCCCAG

CCAGAACTCTTACACTCATCGCCAAGGTCATCCAGAACCTCGCCAACTGTGCCCC GTTTGGTGAGAAGGAAGCCTACATGGCGTTTATGAATAGCTTCC

TGGAAGATCATGGACCAGCCATGCAACACTTCCTGGACCAGGTAGCTACGGTGGATGCAGATACCACACCCAGTGGCTACCAGGGAAGTGGAGACCTGGC

CCTTCAGTTAGCAGTTCTTCATGTCCAGCTCTGCACAATCTTTGCCGAACTTGACCAG AAAACCCAAGATAGCTTGGAACCACTACCCACCATCCTTCG

AGCCATTGAGGAAGGCCGGCCTGTCCCAGTGTCTGTACCAATGCGTCTTCCCCGGATCTCCACTCAGGTCCAATCCAG CTTCTTTTCAGGGGAGAAACC

CGGCTTCCTGGCACCCCGAGACCTCCCCAAGCACACTCCCCTCATTTCCAAGAGTCAATCTCTGCGCAGCTTTCAAGGGGCAGGAAGCTGGGCCAGTCGG

CGGCCAGATGAGGAGCGGCCCCAGAGGCGGCCGCGGCCAGTGCTGCGCACACAGAGCGTCCCTGCCAGACGTCCTACCCACCGTCGCCCTTCTGCAGGTT

CCAAGCCGCGGCCCAAAGGCTCCCTACGCATGGGCCCCGCGCCTTGCGGACGGGCCTGGACTAGGGCTTCTGCCTCGCTACCTCGGAAGCCATCGGTACC

ATGGCAGCGCCAAATGGACCAGCCGGGGGACCGATACCAAACTACGGGAACGCACCGACCAGTGGGCAAG CTAGCAGAGATACAATGTGAGGTGGCTAT

ATTCCGCGAGGCACAGAAAGCTCTGTCCCTTCTGGTGGAGTCGTTGAGTACCCAAGTCCAAGCCTTGAAGGAGCAGCAGGAGCACTTCCGCTGTCAGCTG

CAGGATCTGTACTCCAGACTGGGAGCTGG TATCTCAAAGTTGGATTCTAAGGGTGGTCTCCCAAGCAACGGAAGCCACAGGCTGAAAAGTCTG - UNI

28486 - GAACAGCGCCTGACTGAGATGGAATGTTCTCAGGACCAGCTGAGGGATAGCCTCCAAAGCCTGCAACTTCTTTCAAAAACACCAGGATCTCG

GAGCCAGCCCCTGCCTCTCAAAGCACCATGTGTCAATGGAGCTGATCTGTCAATGGGCACTTGAGCATTTCACCCCACTCCATATATGGTCTGGAAGCCA

AGAGAGCCACTACAGAGGATTTTCTGACTGCCTCAGCCCTTCATGGCCTTCAGTGGGGGACAGAGTGGGAGGTGTCAATCACTCTGGTAACTGTGAGGTT

GCCCAGTAAATCCATTTCAGAAAATCACCGGTTTCTCTGCCCCTACAAATGATTAATACAAGAGAATGCCCAGTTCTCCATTCAGGTCTCCCAAATTCAT

ACCTAATTTGAAGTCTCCTGAAGTTGGAAATAATGAGCAGATCCTC
Translation
MKPECGQTMFRTFWSRSRDSSAMDPPLQSEEDSQTQPSLPSPLTSYRWHTGGSGEKAAGGFRWGRFAGWGRALSHQEPMVNSQPAPRSLFRRVLSAPPKE

SRSNRLRFSKTLWGRHKNVAPLEPKPNPKAPE EPELELVADPDLPVAQIPEPPTPDMPVWNIDGFTLLEGKLVMLGEEE GPRQIRVGSASSENSMQAA

LGNLKDAV VRTPGKTEPEAAGSNQVHNVR KLLKRLKEKKRAKSELGAYTPRDG GPPSALGSRESLATLSELDLGAERDVRVWPLHPSLLGEPYCFQ 

VTWAGGSLCFSCRSSAERDRWIEDLRRQFQPSQ DNVERQEMWLTVWVHEAKGLPRATVPGVRAELWLDGALLARTAPRAGPGQLFWAERFHFEALPPAR

RLSLRLRSAGPAGATVGRVVLELDEVSIPRAPAAGLERWFPVLGAPAGAVLRARIRVRCLRVLPSERYKELAEFLTFHYARLCGALEPALSAQAKEELAA

AMVRVLRATGRAQ ALVTDLGTAELARCGGREALLFRENTLATKAIDEYMKLVAQEYLQDTLG GQVVRCLCASTEDCEVDPSKCPTPELPKHQARLRDS

CEEVFENIIHSYN NCFPAELGSVFSSWREACKARGSEALGPRLVCASLFLRLLCPAILAPSLFGLAPEHPAPGPARTLTLIAKVIQNLANCAP PFGEK

EAYMAFMNSFLEDHGPAMQHFLDQVATVDADTTPSGYQGSGDLALQLAVLHVQLCTIFAELDQ KTQDSLEPLPTILRAIEEGRPVPVSVPMRLPRISTQ

VQSS SFFSGEKPGFLAPRDLPKHTPLISKSQSLRSFQGAGSWASRRPDEERPQRRPRPVLRTQSVPARRPTHRRPSAGSKPRPKGSLRMGPAPCGRAWT

RASASLPRKPSVPWQRQMDQPGDRYQTTGTHRPVGK LAEIQCEVAIFREAQKALSLLVESLSTQVQALKEQQEHFRCQLQDLYSRLGAG GISKLDSKG

GLPSNGSHRLKSL - UNI28486 - EQRLTEMECSQDQLRDSLQSLQLLSKTPGSRSQPLPLKAPCVNGADLSMGT

For any suggestions or comments, please send an email to unitrap@crg.es