Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052146 (Rps10)
Chromosomal location
Chr 17: 27767367 - 27773574 (-)
Description
ribosomal protein S10 Gene [Source:MGI (curated);Acc:Rps10-003]
RefSeq_dna
NM_025963 
RefSeq_peptide
NP_080239.1 
MGI
MGI:1914347 
Uniprot/SWISSPROT
P63325 
Uniprot/SPTREMBL
Q3U9P0 Q5M9K7 Q3UW83 
Human Ortholog
not available
Omim not available
UniTrap UNI25813
Vector Insertion
Chr 17: 27772148 - 27772186
Public Clones not available
Private Clones OST164820 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31072
Vector Insertion
Chr 17: 27772148 - 27773575
Public Clones IST12600F12 (tigm) IST13611H1 (tigm) IST12139A1 (tigm) IST13738A1 (tigm)
IST10927B10 (tigm) IST13788C10 (tigm) IST13688A9 (tigm) IST12359E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8477
Vector Insertion
Chr 17: 27771421 - 27772148
Public Clones RST753 (baygenomics) CMHD-GT_264A8-3 (cmhd) CMHD-GT_272D8-3 (cmhd) PST9493-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15429
Vector Insertion
Chr 17: 27771270 - 27772186
Public Clones 3SD038D10 (ggtc) 3SD026H11 (ggtc) 3SD159D10 (ggtc) PST23628-NR (escells)
PST6782-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28361
Vector Insertion
Chr 17: 27771270 - 27771421
Public Clones not available
Private Clones OST32885 (lexicon) OST5354 (lexicon) OST1530 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23528
Vector Insertion
Chr 17: 27771189 - 27771270
Public Clones not available
Private Clones OST254563 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15088
Vector Insertion
Chr 17: 27769223 - 27771189
Public Clones CMHD-GT_409D11-3 (cmhd) PST13350-NL (escells) PST1628-1 (escells) PST3221-NL (escells)
PST13269-NL (escells) PST8778-NL (escells) PST13563-NL (escells) PST171-2 (escells)
PST2063-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14930
Vector Insertion
Chr 17: 27768144 - 27769302
Public Clones PST10133-NR (escells) PST2272-NR (escells) PST304-1 (escells)
Private Clones OST407658 (lexicon) OST379955 (lexicon) OST357077 (lexicon) OST353115 (lexicon)
OST282404 (lexicon) OST248456 (lexicon) OST248346 (lexicon) OST239068 (lexicon)
OST233860 (lexicon) OST230121 (lexicon) OST213884 (lexicon) OST181467 (lexicon)
OST100226 (lexicon) OST100130 (lexicon) OST43364 (lexicon) OST31307 (lexicon)
OST5941 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23681
Vector Insertion
Chr 17: 27767366 - 27767452
Public Clones not available
Private Clones OST249312 (lexicon) OST248309 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114881
Sequence
CTACAGAGCAGGACCAGACTGTGGCAGCCCATCTCAGTCCCCCATCAGACAACTGTAGACCTGCG - UNI8477 - - UNI15429 - - UNI2581

3 - - UNI28361 - - UNI31072 - ATGTTGATGCCTAAGAAGAATCGGATTGCCATCTACGAACTCCTTTTTAAGGAGGGCGTGATGGTCGCCA

AAAAGGATGTCCACATGCCTAAGCACCCGGAGCTGGCAGACAAAAATGTGCCCAACCTTCATGTAATGAAGGCCATGCAG - UNI15088 - - UNI1

5429 - - UNI23528 - - UNI28361 - TCTCTCAAGTCTCGAGGCTACGTGAAGGAACAGTTTGCTTGGAGACATTTCTACTGGTACCTTACGA

ACGAGGGCATCCAGTATCTCCGAGACTACCTGCACCTACCCCCGGAGATCGTGCCCGCCACCCTGCGTCGCAGCCGTCCCGAGACCGGCAGGCCTCGGCC

CAAAG - UNI14930 - - UNI15088 - GTCCAGAGGGTGAGCGACCTGCAAGATTCACAAGAGGGGAGGCTGACAGAGACACCTACAGAAGGAGC

GCTGTGCCCC - UNI14930 - - UNI15088 - CTGGAGCTGACAAGAAAGCTGAGGCTGGGGCTGGCTCAGCCACTGAGTTCCAGTTT - UNI1

4930 - - UNI23681 - AGAGGCGGCTTTGGTCGTGGACGTGGTCAGCCACCTCAGTGAAGTTGGAGTTTATGTTGTATTGAATAAACTTTAAAGAA

AAA
Translation
 - UNI8477 - - UNI15429 - - UNI25813 - - UNI28361 - - UNI31072 - MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPEL

ADKNVPNLHVMKAMQ - UNI15088 - - UNI15429 - - UNI23528 - - UNI28361 - SLKSRGYVKEQFAWRHFYWYLTNEGIQYLRDY

LHLPPEIVPATLRRSRPETGRPRPKG - UNI14930 - - UNI15088 - GPEGERPARFTRGEADRDTYRRSAVPP - UNI14930 - - UNI1

5088 - PGADKKAEAGAGSATEFQF - UNI14930 - - UNI23681 - RGGFGRGRGQPPQ
Transcript ENSMUST00000114882
Sequence
AGCCCGGAAGAGACGCTGCGCCGCGCACGCCCCTTCCTTTCCAGCCTCCGCCTCGGACCCTGCAGCCGCCGCG - UNI8477 - - UNI15429 - -

 UNI25813 - - UNI28361 - - UNI31072 - ATGTTGATGCCTAAGAAGAATCGGATTGCCATCTACGAACTCCTTTTTAAGGAGGGCGTGAT

GGTCGCCAAAAAGGATGTCCACATGCCTAAGCACCCGGAGCTGGCAGACAAAAATGTGCCCAACCTTCATGTAATGAAGGCCATGCAG - UNI15088 

- - UNI15429 - - UNI23528 - - UNI28361 - TCTCTCAAGTCTCGAGGCTACGTGAAGGAACAGTTTGCTTGGAGACATTTCTACTGGTA

CCTTACGAACGAGGGCATCCAGTATCTCCGAGACTACCTGCACCTACCCCCGGAGATCGTGCCCGCCACCCTGCGTCGCAGCCGTCCCGAGACCGGCAGG

CCTCGGCCCAAAG - UNI14930 - - UNI15088 - GTCCAGAGGGTGAGCGACCTGCAAGATTCACAAGAGGGGAGGCTGACAGAGACACCTACA

GAAGGAGCGCTGTGCCCC - UNI14930 - - UNI15088 - CTGGAGCTGACAAGAAAGCTGAGGCTGGGGCTGGCTCAGCCACTGAGTTCCAGTT

T - UNI14930 - - UNI23681 - AGAGGCGGCTTTGGTCGTGGACGTGGTCAGCCACCTCAGTGAAGTTGGAGTTTATGTTGTATTGAATAAACT

TTAAAGAAAAACA
Translation
 - UNI8477 - - UNI15429 - - UNI25813 - - UNI28361 - - UNI31072 - MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPEL

ADKNVPNLHVMKAMQ - UNI15088 - - UNI15429 - - UNI23528 - - UNI28361 - SLKSRGYVKEQFAWRHFYWYLTNEGIQYLRDY

LHLPPEIVPATLRRSRPETGRPRPKG - UNI14930 - - UNI15088 - GPEGERPARFTRGEADRDTYRRSAVPP - UNI14930 - - UNI1

5088 - PGADKKAEAGAGSATEFQF - UNI14930 - - UNI23681 - RGGFGRGRGQPPQ
Transcript ENSMUST00000025052
Sequence
CTTTCCAGCCTCCGCCTCGGACCCTGCAGCCGCCGCG - UNI8477 - - UNI15429 - - UNI25813 - - UNI28361 - - UNI31072 

- ATGTTGATGCCTAAGAAGAATCGGATTGCCATCTACGAACTCCTTTTTAAGGAGGGCGTGATGGTCGCCAAAAAGGATGTCCACATGCCTAAGCACCC

GGAGCTGGCAGACAAAAATGTGCCCAACCTTCATGTAATGAAGGCCATGCAG - UNI15088 - - UNI15429 - - UNI23528 - - UNI283

61 - TCTCTCAAGTCTCGAGGCTACGTGAAGGAACAGTTTGCTTGGAGACATTTCTACTGGTACCTTACGAACGAGGGCATCCAGTATCTCCGAGACTA

CCTGCACCTACCCCCGGAGATCGTGCCCGCCACCCTGCGTCGCAGCCGTCCCGAGACCGGCAGGCCTCGGCCCAAAG - UNI14930 - - UNI1508

8 - GTCCAGAGGGTGAGCGACCTGCAAGATTCACAAGAGGGGAGGCTGACAGAGACACCTACAGAAGGAGCGCTGTGCCCC - UNI14930 - - UN

I15088 - - UNI23681 - AGAGGCGGCTTTGGTCGTGGACGTGGTCAGCCACCTCAGTGAAGTTGGAGTTTATGTTGTATTGAATAAACTTTAAAG

Translation
 - UNI8477 - - UNI15429 - - UNI25813 - - UNI28361 - - UNI31072 - MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPEL

ADKNVPNLHVMKAMQ - UNI15088 - - UNI15429 - - UNI23528 - - UNI28361 - SLKSRGYVKEQFAWRHFYWYLTNEGIQYLRDY

LHLPPEIVPATLRRSRPETGRPRPKG - UNI14930 - - UNI15088 - GPEGERPARFTRGEADRDTYRRSAVPQ - UNI14930 - - UNI1

5088 - - UNI23681 - QRRLWSWTWSATSVKLEFMLY

For any suggestions or comments, please send an email to unitrap@crg.es