Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052155 (Acvr2a)
Chromosomal location
Chr 2: 48669677 - 48757683 (+)
Description
activin receptor IIA Gene [Source:MGI (curated);Acc:Acvr2a-001]
RefSeq_dna
NM_007396 
RefSeq_peptide
NP_031422.3 
UniGene
Mm.314338 Mm.413270 
MGI
MGI:102806 
Uniprot/SWISSPROT
P27038 
Uniprot/SPTREMBL
A2AI38 Q8BRV4 
Human Ortholog
ENSG00000121989 (ACVR2A)
Omim not available
UniTrap UNI14675
Vector Insertion
Chr 2: 48670347 - 48725808
Public Clones (sanger) FHCRC-GT-S1-11D1 (fhcrc) IST13560G2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2248
Vector Insertion
Chr 2: 48728994 - 48745817
Public Clones AL0106 (sanger) AL0479 (sanger) AR0561 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8488
Vector Insertion
Chr 2: 48754129 - 48755113
Public Clones RRO033 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000063886
Sequence
AGGAGACCGAAAACGCGGCCGAGCCGGGAGCCGGGAGCCGGAGCCACAGCCTGGACCAGAACTTGGCCGCCGCCTGCGCCACCGTCTCTCCCGTCGCCGT

CTCCCGCGGCCGCCTCGCACCGCCACCGCCGCGAGCTCGGCTACTGTGGTCCGCGGACTTTGGGTGTCCGGGTTGAAGGTCGGTCCGGACGTCGGAGCAG

CTCGGCTCCCGGACCGTCCGGGCGGCTGCGGGCGCCGCCGCCGCCGCCTCGTCGCCTCAGCCAGGCGTTTTGTTCGCTGAGACGCGAGAGGCGAGCGGAG

CTGACAGTGATTTTGACAGTGATTCCAACCCGCTTTTGTTGTTGTTGGCTTTTCGTTGTTTGGTTTGGTGTGTTGTGCGTGTATGTGGCGGTTTTTCCCC

CGTGGTACATTTTTTTAAATTGTTGTGCCTTTTTTTTAAATCCTTTTTTTTTCAACCCTGTGAACGTTTTTTGCTTCCCCCTCCCCCCCGCCTCGGGGCT

TCCGAATATGTTTTATGACGGTTGATTTTACACCAGGAGGTTTGTCTCCGAGGAAGACCCAGGGAACTGGATATCTAGCGAGAACTTCCTACGGCTTCTC

CGGCGCCTCGGGAAAATGGGAGCTGCTGCAAAGTTGGCGTTCGCCGTCTTTCTTATCTCTTGCTCTTCAG - UNI14675 - GTGCTATACTTGGCAG

ATCAGAAACTCAGGAGTGTCTTTTCTTTAATGCTAATTGGGAAAGAGACAGAACCAACCAGACTGGTGTTGAACCTTGCTATGGTGATAAAGATAAACGG

CGACATTGTTTTGCTACCTGGAAGAATATTTCTGGTTCCATTGAAATAGTGAAGCAAGGTTGTTGGCTGGATGATATCAACTGCTATGACAG GACTGAT

TGTATAGAAAAAAAAGACAGCCCTGAAGTGTACTTTTGTTGCTGTGAGGGCAATATGTGTAATGAAAAGTTCTCTTATTTTCCGGAGATGGAAGTCACAC

AGC CCACTTCAAATCCTGTTACACCGAAGCCACCCTATTACAACATTCTGCTGTATTCCTTGGTACCACTAATGTTAATTGCAGGAATTGTCATTTGTG

CATTTTGGGTGTACAGACATCACAAGATGGCCTACCCTCCTGTACTTGTTCCTACTCAA - UNI2248 - GACCCAGGACCACCCCCACCTTCCCCAT

TACTAGGGTTGAAGCCATTGCAGCTGTTAGAAGTGAAAGCAAGGGGAAGATTTGGTTGTGTCTGGAAAGCCCAGTTGCTCAATGAATATGTGGCTGTCAA

AATATTTCCAATACAG GACAAACAGTCCTGGCAGAATGAATATGAAGTCTATAGTCTACCTGGAATGAAGCATGAGAACATACTACAGTTCATTGGTGC

AGAGAAAAGAGGCACCAGTGTGGATGTGGACCTGTGGCTAATCACAGCATTTCATGAAAAG GGCTCACTGTCAGACTTTCTTAAGGCTAATGTGGTCTC

TTGGAATGAACTTTGTCATATTGCAGAAACCATGGCTAGAGGATTGGCATATTTACATGAGGATATACCTGGCTTAAAAGATGGCCACAAGCCTGCAATC

TCTCACAG GGACATCAAAAGTAAAAATGTGCTGTTGAAAAACAATCTGACAGCTTGCATTGCTGACTTTGGGTTGGCCTTAAAGTTCGAGGCTGGCAAG

TCTGCAGGTGACACCCATGGGCAG GTTGGTACCCGGAGGTATATGGCTCCAGAGGTGTTGGAGGGTGCTATAAACTTCCAAAGGGACGCATTTCTGAGG

ATAGATATGTACGCCATGGGATTAGTCCTATGGGAATTGGCTTCTCGTTGCACTGCTGCAGATG GACCCGTAGATGAGTACATGTTACCATTTGAGGAA

GAAATTGGCCAGCATCCATCTCTTGAAGATATGCAGGAAGTTGTTGTGCATAAAAAAAAGAGGCCTGTTTTAAGAGATTATTGGCAGAAACATGCA - U

NI8488 - GGAATGGCAATGCTCTGTGAAACGATAGAAGAATGTTGGGATCATGATGCAGAAGCCAGGTTATCAGCTGGATGTGTAGGTGAAAGAATTA

CTCAGATGCAAAGACTAACAAATATCATTACTACAGAGGACATTGTAACAGTGGTCACAATGGTGACAAATGTTGACTTTCCTCCCAAAGAATCTAGTCT

ATGATGGTGGCACCGTCTGTACACACTGAGGACTGGGACTCTGAACTGGAGCTGCTAAGCTAAGGAAAGTGCTTAGTTGATTTTCTGTGTGAAATGAGTA

GGATGCCTCCAGGACATGTACGCAAGCAGCCCCTTGTGGAAAGCATGGATCTGGGAGATGGATCTGGGAAACTTACTGCATCGTCTGCAGCACAGATATG

AAGAGGAGTCTAAGGGAAAAGCTGCAAACTGTAAAGAACTTCTGAAAATGTACTCGAAGAATGTGGCCCTCTCCAAATCAAGGATCTTTTGGACCTGGCT

AATCAAGTATTTGAAAACTGACATCAGATTTCTTAATGTCTGTCAGAAGACACTAATTCCTTAAATGAACTACTGCTATTTTTTTTAAATCAAAAACTTT

TCATTTCAGATTTTAAAAAGGGTAACTTTTTATTGCATTTGCTGTTGTTTCTATAAATGACTATTGTAATGCCAACATGACACAGCTTGTGAATGTGTAG

TGTGCTGCTGTTCTGTGTACATAGTCATCAAAGTGGGGTACAGTAAAGAGGCTTCCAAGCATTACTTTAACCTCCCTCAACAAGGTATACCTCAGTTCCA

CGGTTGCTAAATTATAAAATTGAAAACACTAACAGAATTTGAATAAATCAGTCCATGTTTTATAACAAGGTATTACAAATTCACTGTGTTATTTAAGAAA

AAATGGTAAGCTATGCTTAGTGCCAATAGTAAGTGGCTATTTGTAAAGCAGTGTTTTAGCTTTTCTTCTACTGGCTTGTAATTTAGGGAAAACAAAGTGC

TGTCTTTGAAATGGAAAAGAATATGGTGTCACCCTACCCCCCATACTTATATCAAGGTCCCAAAATATTGCATACTTAAGTAGTACTTTTTTCTTTAAGG

TGTGCTGTGTTTGGGAAATATTTGAAAACATAAAGCATGATTTAAAATTTTTTAAGTGAGCTGTGACACTGGAAAGCTCTTCATTTTTCTTTTAAAATAG

ATTTTTTTTTCCTATTTATATATATAAAATGACGGTGTATTTCTTCTTTTCACCAAACAGTGTGTGGGATATTCTTATCACTGTTTTATGATCACCTCAG

GAAGTGTCATTACTCAGAATTCTTCACTCTGCTTCTAGACTTGTAACTTTATCACTGTACTGCGTGGTGCCATCTTGTCAGAGTAATATTTGATGTCTGT

GATATGGAGAGAATTAGCTTAGGATAAAGGTAGTGACCTTTAAGAACAGATTTCAGATATTACTGCTTTAAGACAAATCAGGGATAACAAGTTGAACTTA

TAATATGCAATGACATTAAGAGGTAACCAGTGCTGGTCTAAGGAACACAACCCAGCTTCCTCCCCAAATTACTTTTACAGCTAATTTTAGATAGTTCATG

CCTTATCCTTACGAAGAAAGTGGAATTGATGGCATGTAGGTACCAGAGTGCTTTAAAAAACATTATTACATTAGAATATAATTGGATCTTTCCTAAAGCT

TGCACGGGCCCAAGTAAAAAATTAATTCCCTGAATTTTAAATTACCAACAAATAGCCAGTATTATGTTATATACATTTTTGTTGAGTCACTTTAACATCC

ATACATTAACTTTATAAACTTCTACGTTACTATCAGGAGCTCACTGTGAATGCATTATCTTCAGATGGTTAAGACATCAGACACTACATTTTACATATAA

TGTGCACTAATCTCTGGGGAGAATAATTACAAACAATACATAGGTCAACAGACTTTAAGTGGGGAGGATAATAGCATTCTTGTTTGTATGCCACACACCA

TAGAGAACTGTGCGTTGTCTCTGTACCCAAGGTCTCACTGTATTCGTAAGGTTGCCAAGTTCAGTGTTCATTGTTTTGATTTCTACATATTTGGCCCCTC

AAACTCTTGATATAGGTTTGCTTGCACTTGTAAGCTAATCAAGGAAAACCATAAGAAAATATGCATATAAGGAAATTATTCCTCTCCATAAGCAAACTAC

TACTGGTTTTAAACATTCAACCTCCTTTAAAAGCTGATAAATGAGGGATAATACGACTGTTCGGCTTAAGAAAGCACTACAGATAAATTTTACCAAGACT

GGTTCATGATATAAGATGCTTTGTCTTTATGCTAAAATTTTTTTTTAAGGAAATCTTGGGTATTGTATGTAAATCTAGCTTATCAATTTTAAAACTTGTA

TTCTCTTAAGAACTACATTAACAGAAAGCCTTTTTTATAAGCAGTAACGTTAAGAATGTTCCAGTGACTACCTGCCCTTATACCTAGTCTTGTTAAAACT

TTCTTTTGCAGGGCATTTTAGTGTTTGGTTTACAGTAAGTGCAGAATGGGCAGATAAAAAGATTGAGTTAGGGACATTG
Translation
MGAAAKLAFAVFLISCSSG - UNI14675 - GAILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINC

YDR RTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQP PTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQ - UN

I2248 - DPGPPPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQ DKQSWQNEYEVYSLPGMKHENILQFIGAEKRGTSVDVDLWLIT

AFHEK GSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAISHR RDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQ VGTR

RYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADG GPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHA - UNI8488 -

 GMAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL
Transcript ENSMUST00000112783
Sequence
AGGAGACCGAAAACGCGGCCGAGCCGGGAGCCGGGAGCCGGAGCCACAGCCTGGACCAGAACTTGGCCGCCGCCTGCGCCACCGTCTCTCCCGTCGCCGT

CTCCCGCGGCCGCCTCGCACCGCCACCGCCGCGAGCTCGGCTACTGTGGTCCGCGGACTTTGGGTGTCCGGGTTGAAGGTCGGTCCGGACGTCGGAGCAG

CTCGGCTCCCGGACCGTCCGGGCGGCTGCGGGCGCCGCCGCCGCCGCCTCGTCGCCTCAGCCAGGCGTTTTGTTCGCTGAGACGCGAGAGGCGAGCGGAG

CTGACAGTGATTTTGACAGTGATTCCAACCCGCTTTTGTTGTTGTTGGCTTTTCGTTGTTTGGTTTGGTGTGTTGTGCGTGTATGTGGCGGTTTTTCCCC

CGTGGTACATTTTTTTAAATTGTTGTGCCTTTTTTTTAAATCCTTTTTTTTTCAACCCTGTGAACGTTTTTTGCTTCCCCCTCCCCCCCGCCTCGGGGCT

TCCGAATATGTTTTATGACGGTTGATTTTACACCAGGAGGTTTGTCTCCGAGGAAGACCCAGGGAACTGGATATCTAGCGAGAACTTCCTACGGCTTCTC

CGGCGCCTCGGGAAAATGGGAGCTGCTGCAAAGTTGGCGTTCGCCGTCTTTCTTATCTCTTGCTCTTCAG - UNI14675 - GTGCTATACTTGGCAG

ATCAGAAACTCAGGAGTGTCTTTTCTTTAATGCTAATTGGGAAAGAGACAGAACCAACCAGACTGGTGTTGAACCTTGCTATGGTGATAAAGATAAACGG

CGACATTGTTTTGCTACCTGGAAGAATATTTCTGGTTCCATTGAAATAGTGAAGCAAGGTTGTTGGCTGGATGATATCAACTGCTATGACAG GACTGAT

TGTATAGAAAAAAAAGACAGCCCTGAAGTGTACTTTTGTTGCTGTGAGGGCAATATGTGTAATGAAAAGTTCTCTTATTTTCCGGAGATGGAAGTCACAC

AGC CCACTTCAAATCCTGTTACACCGAAGCCACCCTATTACAACATTCTGCTGTATTCCTTGGTACCACTAATGTTAATTGCAGGAATTGTCATTTGTG

CATTTTGGGTGTACAGACATCACAAGATGGCCTACCCTCCTGTACTTGTTCCTACTCAA - UNI2248 - GACCCAGGACCACCCCCACCTTCCCCAT

TACTAGGGTTGAAGCCATTGCAGCTGTTAGAAGTGAAAGCAAGGGGAAGATTTGGTTGTGTCTGGAAAGCCCAGTTGCTCAATGAATATGTGGCTGTCAA

AATATTTCCAATACAG GACAAACAGTCCTGGCAGAATGAATATGAAGTCTATAGTCTACCTGGAATGAAGCATGAGAACATACTACAGTTCATTGGTGC

AGAGAAAAGAGGCACCAGTGTGGATGTGGACCTGTGGCTAATCACAGCATTTCATGAAAAG GGCTCACTGTCAGACTTTCTTAAGGCTAATGTGGTCTC

TTGGAATGAACTTTGTCATATTGCAGAAACCATGGCTAGAGGATTGGCATATTTACATGAGGATATACCTGGCTTAAAAGATGGCCACAAGCCTGCAATC

TCTCACAG GGACATCAAAAGTAAAAATGTGCTGTTGAAAAACAATCTGACAGCTTGCATTGCTGACTTTGGGTTGGCCTTAAAGTTCGAGGCTGGCAAG

TCTGCAGGTGACACCCATGGGCAG GTTGGTACCCGGAGGTATATGGCTCCAGAGGTGTTGGAGGGTGCTATAAACTTCCAAAGGGACGCATTTCTGAGG

ATAGATATGTACGCCATGGGATTAGTCCTATGGGAATTGGCTTCTCGTTGCACTGCTGCAGATG GACCCGTAGATGAGTACATGTTACCATTTGAGGAA

GAAATTGGCCAGCATCCATCTCTTGAAGATATGCAGGAAGTTGTTGTGCATAAAAAAAAGAGGCCTGTTTTAAGAGATTATTGGCAGAAACATGCA - U

NI8488 - GGAATGGCAATGCTCTGTGAAACGATAGAAGAATGTTGGGATCATGATGCAGAAGCCAGGTTATCAGCTGGATGTGTAGGTGAAAGAATTA

CTCAGATGCAAAGACTAACAAATATCATTACTACAGAGGACATTGTAACAGTGGTCACAATGGTGACAAATGTTGACTTTCCTCCCAAAGAATCTAGTCT

ATGATGGTGGCACCGTCTGTACACACTGAGGACTGGGACTCTGAACTGGAGCTGCTAAGCTAAGGAAAGTGCTTAGTTGATTTTCTGTGTGAAATGAGTA

GGATGCCTCCAGGACATGTACGCAAGCAGCCCCTTGTGGAAAGCATGGATCTGGGAGATGGATCTGGGAAACTTACTGCATCGTCTGCAGCACAGATATG

AAGAGGAGTCTAAGGGAAAAGCTGCAAACTGTAAAGAACTTCTGAAAATGTACTCGAAGAATGTGGCCCTCTCCAAATCAAGGATCTTTTGGACCTGGCT

AATCAAGTATTTGAAAACTGACATCAGATTTCTTAATGTCTGTCAGAAGACACTAATTCCTTAAATGAACTACTGCTATTTTTTTTAAATCAAAAACTTT

TCATTTCAGATTTTAAAAAGGGTAACTTTTTATTGCATTTGCTGTTGTTTCTATAAATGACTATTGTAATGCCAACATGACACAGCTTGTGAATGTGTAG

TGTGCTGCTGTTCTGTGTACATAGTCATCAAAGTGGGGTACAGTAAAGAGGCTTCCAAGCATTACTTTAACCTCCCTCAACAAGGTATACCTCAGTTCCA

CGGTTGCTAAATTATAAAATTGAAAACACTAACAGAATTTGAATAAATCAGTCCATGTTTTATAACAAGGTATTACAAATTCACTGTGTTATTTAAGAAA

AAATGGTAAGCTATGCTTAGTGCCAATAGTAAGTGGCTATTTGTAAAGCAGTGTTTTAGCTTTTCTTCTACTGGCTTGTAATTTAGGGAAAACAAAGTGC

TGTCTTTGAAATGGAAAAGAATATGGTGTCACCCTACCCCCCATACTTATATCAAGGTCCCAAAATATTGCATACTTAAGTAGTACTTTTTTCTTTAAGG

TGTGCTGTGTTTGGGAAATATTTGAAAACATAAAGCATGATTTAAAATTTTTTAAGTGAGCTGTGACACTGGAAAGCTCTTCATTTTTCTTTTAAAATAG

ATTTTTTTTTCCTATTTATATATATAAAATGACGGTGTATTTCTTCTTTTCACCAAACAGTGTGTGGGATATTCTTATCACTGTTTTATGATCACCTCAG

GAAGTGTCATTACTCAGAATTCTTCACTCTGCTTCTAGACTTGTAACTTTATCACTGTACTGCGTGGTGCCATCTTGTCAGAGTAATATTTGATGTCTGT

GATATGGAGAGAATTAGCTTAGGATAAAGGTAGTGACCTTTAAGAACAGATTTCAGATATTACTGCTTTAAGACAAATCAGGGATAACAAGTTGAACTTA

TAATATGCAATGACATTAAGAGGTAACCAGTGCTGGTCTAAGGAACACAACCCAGCTTCCTCCCCAAATTACTTTTACAGCTAATTTTAGATAGTTCATG

CCTTATCCTTACGAAGAAAGTGGAATTGATGGCATGTAGGTACCAGAGTGCTTTAAAAAACATTATTACATTAGAATATAATTGGATCTTTCCTAAAGCT

TGCACGGGCCCAAGTAAAAAATTAATTCCCTGAATTTTAAATTACCAACAAATAGCCAGTATTATGTTATATACATTTTTGTTGAGTCACTTTAACATCC

ATACATTAACTTTATAAACTTCTACGTTACTATCAGGAGCTCACTGTGAATGCATTATCTTCAGATGGTTAAGACATCAGACACTACATTTTACATATAA

TGTGCACTAATCTCTGGGGAGAATAATTACAAACAATACATAGGTCAACAGACTTTAAGTGGGGAGGATAATAGCATTCTTGTTTGTATGCCACACACCA

TAGAGAACTGTGCGTTGTCTCTGTACCCAAGGTCTCACTGTATTCGTAAGGTTGCCAAGTTCAGTGTTCATTGTTTTGATTTCTACATATTTGGCCCCTC

AAACTCTTGATATAGGTTTGCTTGCACTTGTAAGCTAATCAAGGAAAACCATAAGAAAATATGCATATAAGGAAATTATTCCTCTCCATAAGCAAACTAC

TACTGGTTTTAAACATTCAACCTCCTTTAAAAGCTGATAAATGAGGGATAATACGACTGTTCGGCTTAAGAAAGCACTACAGATAAATTTTACCAAGACT

GGTTCATGATATAAGATGCTTTGTCTTTATGCTAAAATTTTTTTTTAAGGAAATCTTGGGTATTGTATGTAAATCTAGCTTATCAATTTTAAAACTTGTA

TTCTCTTAAGAACTACATTAACAGAAAGCCTTTTTTATAAGCAGTAACGTTAAGAATGTTCCAGTGACTACCTGCCCTTATACCTAGTCTTGTTAAAACT

TTCTTTTGCAGGGCATTTTAGTGTTTGGTTTACAGTAAGTGCAGAATGGGCAGATAAAAAGATTGAGTTAGGGACATTG
Translation
FYTRRFVSEEDPGNWISSENFLRLLRRLGKMGAAAKLAFAVFLISCSSG - UNI14675 - GAILGRSETQECLFFNANWERDRTNQTGVEPCYGDKD

KRRHCFATWKNISGSIEIVKQGCWLDDINCYDR RTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQP PTSNPVTPKPPYYNILLYSLVPLMLIA

GIVICAFWVYRHHKMAYPPVLVPTQ - UNI2248 - DPGPPPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQ DKQSWQNEYEVYS

LPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEK GSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAISHR RDIKSKNVLLKNNL

TACIADFGLALKFEAGKSAGDTHGQ VGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADG GPVDEYMLPFEEEIGQHPSLEDMQEV

VVHKKKRPVLRDYWQKHA - UNI8488 - GMAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL

For any suggestions or comments, please send an email to unitrap@crg.es