Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052214 (Opa3)
Chromosomal location
Chr 7: 19813753 - 19833210 (+)
Description
optic atrophy 3 (human) Gene [Source:MGI Symbol;Acc:MGI:2686271]
RefSeq_dna
NM_207525 
RefSeq_peptide
NP_997408.2 
UniGene
Mm.239583 
MGI
MGI:2686271 
Uniprot/SWISSPROT
Q505D7 
Human Ortholog
ENSG00000125741 (OPA3)
Omim 165300 - OPTIC ATROPHY 3, AUTOSOMAL DOMINANT  258501 - 3-@METHYLGLUTACONIC ACIDURIA, TYPE III  
UniTrap UNI16565
Vector Insertion
Chr 7: 19813934 - 19830102
Public Clones D065D06 (ggtc) (ggtc)
Private Clones OST458275 (lexicon) OST449382 (lexicon) OST398887 (lexicon) OST394981 (lexicon)
OST69059 (lexicon) OST47143 (lexicon) OST41866 (lexicon) OST41855 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000063976
Sequence
AGTCAGCAAGGTTGCGCGTGCCCCAGGGCGGCCGCCGAGATGGTGGTGGGCGCGTTCCCCATGGCGAAGCTGTTCTACTTGGGCATCCGGCAGGTTAGCA

AGCCGCTGGCCAACCGTATCAAGGATGCTGCCCGCCGCAGCGAGTTCTTCAAGACCTACATCTGCCTACCGCCAGCCCAGC - UNI16565 - TGTAC

CACTGGGTGGAGATGCGGACGAAGATGCGCATAATGGGTTTCCGGGGCACTACCATCAAGCCACTGAATGAGGAGGCAGCAGCAGAGCTGGGTGCTGAGC

TGCTGGGCGAGGCCACCATCTTCATTGTGGGCGGAGGCTGCCTGGTCCTGGAGTACTGGCGCCACCAGACTCAGCAGCGCAATAAGGAGGAGGAACAGCG

GGCAGCCTGGAACGCTCTGCAGGATGAGGTGGGCCGCCTGGCACTGGCCTTAGAGGCGCTGCAGGCTCAGGCACAAGCGATGCCCTCCTTGAGTGCCCTG

GAGGAGCTGCGGGAGGAGCTGCAGGAGGTGCGTGGTCAGGTCTGCAATGCTCACTGTACTTCCAAGTGCCAGGCAGCATCTTCCAAGAAATAGCCAGCTG

CTAAGGCCTGGACTTGTTTGTGACCATGTGGCCTCCAATAGAGCCTTCTCCTCACACCTCCTGGCCCGGGATGCTCTGGCCTAGCAGAAACCACGAGGAC

CTTGATGTAGCTGTGACATGTGGTCACCCCTTACTGACAGGTTCTGGGCATTTCCCCAGGGAGCACTCAGCAGAAGCCTTCAGAGCCCATCCAGTCTCTG

ACTCAGAGCCCTCAGCCCCTCATTGGACTTTCAAGGTCTCAGACACCTGACTCTCCACTGCTCTGGCAAAGGCAAAAGATGGAACCAGGGCTCAAGTCTG

ATCATGACATAGACAAGGTCACCTGCCCATCATTGGAGCGCCTCCTTCCTTCGGTGAACACAGGCCACCTTGAGCCTTGCCTCAGGTCAATGTAGCTCCC

ATGGAGGCAGCAGAGTGCAATTGATGTTCCCGTTCTCTCTCCTCATTCTCCCTCTGAGGTCCCCAGGGGATCACGCCTGTATAGATCCCCTTACTCCTCA

GCCTGTGGCATTACCCCATTTCCTCCCTAGGCACAGACGGATCCTAGCTGGCTCGATTCTGACCTGTCTCAGTCGCAGCCCCGCTGCCCTATCCTGAAAT

GTCCCTGAACCTTGTTTCGGGTGGCACATATTTCCTCCTGTCCTTCTGTGGTATTTTTCAGTTGGGTGGGTTAGATGTCACACACACACCTGTCTGACCC

TTCATACCCCTTAGGTCTGGGTCCCTCTACCCTTTCTGTTGCCCCACCTTCCTTGCTCGATCCCCCCAGACATGACTTACTGCTGGGAATGTGATGGAGG

AAACAGAGTAACCTGTTCTCCCACCGTTCTGGAAGCCAGCGGCAGAGGTCAGGGTGTTTGGGCCCCACTTTCTTCTGGCTTCAGGGGCCCCAGATCTCCT

AGACTCTGTGTCCTGTCTTCATGTGGCTTTCTCTTCCCCCACCTGTCTCTTGCAAGGACACCTGCCCTGAATACAAGACCCACCCTAAATTTAGGATGAC

CATATTGAAAGAGCCTTTATTACATCTCTGAAGACCCTTTTTCTAAATGGAGACACACAGGCCCCAGGATTCAGACATGGAGTTTTCTTTTGAAGGCCCT

CTATTCAGCTTGCTGCCTTCTGCCATTTTAAAATGCAAGGCCCCTACTATGCTGTTTGGCTCTTCCGGCAGCCTACTCATGGCTTCTGGGGTTGGGCTAA

CCACTATAGCTCCAGAAGGATTGTGGGTGCAGCAGTCACTGTCATGGTTGTCCAGTTCCTGATGGAGCTGCAGAATAAGGAGGCCTCCTAAGGATATATG

AGGGGCATAATTAATACGGACCTTCAAACTGGGCCAGTGATCATTAACAATAGAGAAATCCGGGCTTGGTAGCTCATATCTGAAATTCCAGCACTCTGAG

GCTGAGGCAGGAATGAGCCTGGGTCCCATCGTGAGTTCCTGGACAGCCTGCTGAACCACAGGGAGAGACCCTGTCTTTAAAAAAAAAAAAAAAGGCAAAA

AGTAAAAAAGACAACCAAGCCAGACAGTGGTGATACACGCCATTAATCCCAGCACTTGGGAAGCAGAGGCAGGTGGATTCTGATCGAGACCAGCCTGGTC

TACAGAGTGAGTTCCAGGATAGCCAGGGCTACACAGAGAAACCCTGTCTCCAAAAAAACAAAACAAAAGTAAAAGAAAAAAAGACAACCTTGGAGGAAAG

GCAGAGGTTTTGGCTCTGGGGGAAAAGGAGCCGAGACTCATCCTGTGAACTCTTCCCACATTGGGAAACTAAGGCTCAGGAAAAGGGAAGCTAGGTGACT

TGGCCAAGACCCCATAGCTCAGGAGGGACCAGAGGACCCAGAAGATTCTGGCTGCAGGGCAAGATGAGATAAGGCCCAACCTCTTCCCAGTGGCCAGAGG

CACTGGGTTCTGCCCTCTTATCAGAAAAGCCCCAGGCCACACCCAAGATGTCTGACTATAGGTAACAGGTTCATTCTCCCTGGCCCTTGTCCCTAGAGGT

GGCACTTGTAGGGCTCCCCCAAGGGGATGAAAATGACCCATCCCCAGGATTCCCCAGACTGAAACCAATACTGAAACTGTACCTCAGTTTCTTCTAGAAG

AAGCTGAAGTTGGTGTCTTTAAATTTAGGAGCAGCTGAGTTAGGTGAAAGCTGAACTAGGGACAGAGGACACACATGGCTAGGTGATGAGGGGAGGACAG

AGTGAGGAGCCAGGAAAGCTGCCTGTTTGCCATGGTTACCCCTGTGGAGTCACTAAGAGTTCCAGGGCCAGCCCTGGCCACCTTGCCCTGGGTCAGTCTA

TAGCAGTTATGGCAAAGCCAAGACCGGTGAGGGCGCTGAGCTCCATCAGGTCAGTCCTTACTCCAACAGACCAGCCTCACTGGTGGTGAAGAGCCCCATA

GGAATGGTTTCTCTGCTTGCTTGGGAGGAAACAGGCACCAAGAGGAAATGTCACCTTTGGGTCACCCAAGCATGAAAGTAGGCCTCGGGGCCCACCCTGA

CCCAGTGGAGCCTTCACATGGTCCTGGTGTATGTGGACATGGCAGCCTCTCCCATGATGACAGTGCAGGAAGCCACCGTGGTGTGGTGTGTGGTTCCAGA

AGCCTCTGGGGCAGGAGGCCAGAGCAGCTTTCATGGCTCTGACTCCCTACTCATGCAATGTTACATATCCCCACAAAGGGAGAAGGAGGACAATAAATTT

ATG
Translation
MVVGAFPMAKLFYLGIRQVSKPLANRIKDAARRSEFFKTYICLPPAQL - UNI16565 - LYHWVEMRTKMRIMGFRGTTIKPLNEEAAAELGAELLG

EATIFIVGGGCLVLEYWRHQTQQRNKEEEQRAAWNALQDEVGRLALALEALQAQAQAMPSLSALEELREELQEVRGQVCNAHCTSKCQAASSKK

For any suggestions or comments, please send an email to unitrap@crg.es